


| Basic Information | |
|---|---|
| Family ID | F083156 |
| Family Type | Metagenome |
| Number of Sequences | 113 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MSDGGRERASLGVEVSKSSQKWSVQRSAVRSIAWLD |
| Number of Associated Samples | 101 |
| Number of Associated Scaffolds | 113 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 64.81 % |
| % of genes near scaffold ends (potentially truncated) | 88.50 % |
| % of genes from short scaffolds (< 2000 bps) | 90.27 % |
| Associated GOLD sequencing projects | 98 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (71.681 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (30.973 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.743 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.442 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 48.44% β-sheet: 0.00% Coil/Unstructured: 51.56% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 113 Family Scaffolds |
|---|---|---|
| PF03544 | TonB_C | 1.77 |
| PF03401 | TctC | 0.88 |
| PF01434 | Peptidase_M41 | 0.88 |
| PF13432 | TPR_16 | 0.88 |
| PF01569 | PAP2 | 0.88 |
| PF00903 | Glyoxalase | 0.88 |
| PF14066 | DUF4256 | 0.88 |
| PF02371 | Transposase_20 | 0.88 |
| PF14559 | TPR_19 | 0.88 |
| PF01694 | Rhomboid | 0.88 |
| PF12146 | Hydrolase_4 | 0.88 |
| PF02452 | PemK_toxin | 0.88 |
| PF14534 | DUF4440 | 0.88 |
| PF07291 | MauE | 0.88 |
| PF01872 | RibD_C | 0.88 |
| PF13531 | SBP_bac_11 | 0.88 |
| PF01548 | DEDD_Tnp_IS110 | 0.88 |
| PF01847 | VHL | 0.88 |
| PF07883 | Cupin_2 | 0.88 |
| PF12697 | Abhydrolase_6 | 0.88 |
| PF01047 | MarR | 0.88 |
| PF12710 | HAD | 0.88 |
| PF08334 | T2SSG | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
|---|---|---|---|
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 1.77 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.77 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.88 |
| COG0465 | ATP-dependent Zn proteases | Posttranslational modification, protein turnover, chaperones [O] | 0.88 |
| COG0705 | Membrane-associated serine protease, rhomboid family | Posttranslational modification, protein turnover, chaperones [O] | 0.88 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.88 |
| COG2337 | mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin module | Defense mechanisms [V] | 0.88 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 71.68 % |
| Unclassified | root | N/A | 28.32 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459005|F1BAP7Q01EN904 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 511 | Open in IMG/M |
| 3300000955|JGI1027J12803_103399905 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 593 | Open in IMG/M |
| 3300000955|JGI1027J12803_106815977 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 841 | Open in IMG/M |
| 3300000956|JGI10216J12902_101938809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_58 | 1007 | Open in IMG/M |
| 3300000956|JGI10216J12902_124626140 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp. | 620 | Open in IMG/M |
| 3300002568|C688J35102_119437183 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 695 | Open in IMG/M |
| 3300003203|JGI25406J46586_10235408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 537 | Open in IMG/M |
| 3300003990|Ga0055455_10289311 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 523 | Open in IMG/M |
| 3300004643|Ga0062591_101094683 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 767 | Open in IMG/M |
| 3300005167|Ga0066672_10494540 | Not Available | 795 | Open in IMG/M |
| 3300005177|Ga0066690_10851830 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 587 | Open in IMG/M |
| 3300005179|Ga0066684_10734549 | Not Available | 658 | Open in IMG/M |
| 3300005180|Ga0066685_10693944 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300005184|Ga0066671_10970821 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 536 | Open in IMG/M |
| 3300005290|Ga0065712_10163481 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Rhodothermaeota → Rhodothermia → Rhodothermales → Rubricoccaceae → Rubrivirga → Rubrivirga marina | 1274 | Open in IMG/M |
| 3300005290|Ga0065712_10230758 | All Organisms → cellular organisms → Bacteria | 1011 | Open in IMG/M |
| 3300005293|Ga0065715_11082332 | Not Available | 524 | Open in IMG/M |
| 3300005355|Ga0070671_100298752 | Not Available | 1371 | Open in IMG/M |
| 3300005437|Ga0070710_11105438 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 582 | Open in IMG/M |
| 3300005439|Ga0070711_100254500 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1379 | Open in IMG/M |
| 3300005447|Ga0066689_10345217 | Not Available | 928 | Open in IMG/M |
| 3300005468|Ga0070707_101816723 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 577 | Open in IMG/M |
| 3300005518|Ga0070699_100051943 | All Organisms → cellular organisms → Bacteria | 3549 | Open in IMG/M |
| 3300005526|Ga0073909_10725824 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 500 | Open in IMG/M |
| 3300005536|Ga0070697_100081232 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2671 | Open in IMG/M |
| 3300005543|Ga0070672_101372598 | Not Available | 632 | Open in IMG/M |
| 3300005548|Ga0070665_100793750 | Not Available | 960 | Open in IMG/M |
| 3300005555|Ga0066692_10273884 | Not Available | 1068 | Open in IMG/M |
| 3300005556|Ga0066707_10377590 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 924 | Open in IMG/M |
| 3300005559|Ga0066700_11160939 | Not Available | 504 | Open in IMG/M |
| 3300005560|Ga0066670_10628133 | Not Available | 653 | Open in IMG/M |
| 3300005560|Ga0066670_10845530 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300005566|Ga0066693_10248406 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_58 | 704 | Open in IMG/M |
| 3300005569|Ga0066705_10592213 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 681 | Open in IMG/M |
| 3300005569|Ga0066705_10655076 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 638 | Open in IMG/M |
| 3300005574|Ga0066694_10572787 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 526 | Open in IMG/M |
| 3300005575|Ga0066702_10758019 | Not Available | 578 | Open in IMG/M |
| 3300005587|Ga0066654_10868629 | Not Available | 516 | Open in IMG/M |
| 3300005598|Ga0066706_11311892 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 547 | Open in IMG/M |
| 3300005618|Ga0068864_102725516 | Not Available | 500 | Open in IMG/M |
| 3300005719|Ga0068861_100126175 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2071 | Open in IMG/M |
| 3300005841|Ga0068863_101465723 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 691 | Open in IMG/M |
| 3300005937|Ga0081455_10194526 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1524 | Open in IMG/M |
| 3300005937|Ga0081455_10325714 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1092 | Open in IMG/M |
| 3300006032|Ga0066696_10549582 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 754 | Open in IMG/M |
| 3300006032|Ga0066696_10980077 | Not Available | 538 | Open in IMG/M |
| 3300006034|Ga0066656_10355593 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
| 3300006034|Ga0066656_10534981 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 762 | Open in IMG/M |
| 3300006046|Ga0066652_100996596 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 795 | Open in IMG/M |
| 3300006046|Ga0066652_101217331 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 713 | Open in IMG/M |
| 3300006046|Ga0066652_101601683 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → unclassified Planctomyces → Planctomyces sp. SH-PL14 | 599 | Open in IMG/M |
| 3300006173|Ga0070716_100410286 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 977 | Open in IMG/M |
| 3300006237|Ga0097621_100640276 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
| 3300006797|Ga0066659_11028030 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 689 | Open in IMG/M |
| 3300006800|Ga0066660_10140917 | Not Available | 1774 | Open in IMG/M |
| 3300006844|Ga0075428_100580468 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1198 | Open in IMG/M |
| 3300007004|Ga0079218_12390392 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 621 | Open in IMG/M |
| 3300009098|Ga0105245_11340437 | Not Available | 765 | Open in IMG/M |
| 3300009137|Ga0066709_102066565 | Not Available | 788 | Open in IMG/M |
| 3300010303|Ga0134082_10470980 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300010335|Ga0134063_10037209 | All Organisms → cellular organisms → Bacteria | 2092 | Open in IMG/M |
| 3300010371|Ga0134125_11836115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Labilitrichaceae → Labilithrix → Labilithrix luteola | 659 | Open in IMG/M |
| 3300010396|Ga0134126_11310397 | Not Available | 802 | Open in IMG/M |
| 3300012181|Ga0153922_1083231 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300012198|Ga0137364_10819744 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 703 | Open in IMG/M |
| 3300012201|Ga0137365_10761363 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 707 | Open in IMG/M |
| 3300012203|Ga0137399_11563435 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 547 | Open in IMG/M |
| 3300012205|Ga0137362_11694288 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 519 | Open in IMG/M |
| 3300012207|Ga0137381_10201396 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1725 | Open in IMG/M |
| 3300012350|Ga0137372_10417421 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1013 | Open in IMG/M |
| 3300012351|Ga0137386_11008522 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 592 | Open in IMG/M |
| 3300012354|Ga0137366_10094140 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 2272 | Open in IMG/M |
| 3300012358|Ga0137368_10453048 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_17 | 833 | Open in IMG/M |
| 3300012361|Ga0137360_11855321 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300012582|Ga0137358_10229633 | Not Available | 1264 | Open in IMG/M |
| 3300012685|Ga0137397_10165333 | All Organisms → cellular organisms → Bacteria | 1641 | Open in IMG/M |
| 3300012925|Ga0137419_11692355 | Not Available | 539 | Open in IMG/M |
| 3300012961|Ga0164302_11451169 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 563 | Open in IMG/M |
| 3300012984|Ga0164309_11904815 | Not Available | 510 | Open in IMG/M |
| 3300014745|Ga0157377_11696489 | Not Available | 509 | Open in IMG/M |
| 3300015053|Ga0137405_1107965 | Not Available | 948 | Open in IMG/M |
| 3300015085|Ga0167632_1001308 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 3872 | Open in IMG/M |
| 3300015241|Ga0137418_10469465 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1012 | Open in IMG/M |
| 3300015372|Ga0132256_103035187 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 564 | Open in IMG/M |
| 3300015373|Ga0132257_100489008 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1508 | Open in IMG/M |
| 3300016371|Ga0182034_10482308 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1031 | Open in IMG/M |
| 3300018000|Ga0184604_10126371 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 821 | Open in IMG/M |
| 3300018061|Ga0184619_10526380 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 519 | Open in IMG/M |
| 3300018429|Ga0190272_12777120 | Not Available | 539 | Open in IMG/M |
| 3300018482|Ga0066669_11569431 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300019361|Ga0173482_10120184 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 982 | Open in IMG/M |
| 3300019865|Ga0193748_1019747 | Not Available | 634 | Open in IMG/M |
| 3300019888|Ga0193751_1121357 | All Organisms → cellular organisms → Bacteria | 974 | Open in IMG/M |
| 3300020022|Ga0193733_1180104 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 555 | Open in IMG/M |
| 3300022756|Ga0222622_10777871 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 698 | Open in IMG/M |
| 3300022756|Ga0222622_11357845 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 523 | Open in IMG/M |
| 3300025227|Ga0207638_1005835 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 542 | Open in IMG/M |
| 3300025915|Ga0207693_10730044 | Not Available | 766 | Open in IMG/M |
| 3300025923|Ga0207681_11277027 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300026327|Ga0209266_1282966 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 523 | Open in IMG/M |
| 3300026552|Ga0209577_10357414 | All Organisms → cellular organisms → Bacteria | 1072 | Open in IMG/M |
| 3300026740|Ga0207439_100542 | All Organisms → cellular organisms → Bacteria | 1038 | Open in IMG/M |
| 3300027821|Ga0209811_10330473 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300028784|Ga0307282_10409834 | Not Available | 657 | Open in IMG/M |
| 3300028885|Ga0307304_10293266 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 717 | Open in IMG/M |
| 3300031231|Ga0170824_125258465 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 897 | Open in IMG/M |
| 3300031753|Ga0307477_10632848 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 719 | Open in IMG/M |
| 3300032955|Ga0335076_10265348 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1610 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 30.97% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 13.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.96% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.19% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.54% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.65% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 2.65% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.65% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.65% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.77% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.77% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.77% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.77% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.77% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.77% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.89% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.89% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.89% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.89% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.89% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.89% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.89% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.89% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.89% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.89% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300003990 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300012181 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ006 MetaG | Host-Associated | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300013832 | Permafrost microbial communities from Nunavut, Canada - A3_5cm_0M | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015085 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4B, Ice margin, adjacent to proglacial lake) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019865 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1s1 | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025227 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in- M7 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300026740 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05A1w-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E41_09816920 | 2170459005 | Grass Soil | MSDGGRERASLGVKVWKSSLRVNAERSAVRSIAWL |
| JGI1027J12803_1033999051 | 3300000955 | Soil | MALGPNETKMSDGGRKRASLGVKVWKSSQKRSVRRSAVRSIAWLGLCGFIGG |
| JGI1027J12803_1068159772 | 3300000955 | Soil | SNENKMSDGGRGRASLGVKVWKSSQKWSVRWSAVRSIVRLDVVVVTKER* |
| JGI10216J12902_1019388091 | 3300000956 | Soil | MSDGGRGRTSLEVDVWKSSQKWSAQRSAVRSIAWLDADVASLAT* |
| JGI10216J12902_1246261402 | 3300000956 | Soil | SDGGRECASLGAEVWKSSQKGSVQRSAVRSIAWLDVDVTSSLILEDES* |
| C688J35102_1194371831 | 3300002568 | Soil | MSDGGRERASLGVKVWKSSQKWSVQRSAVRSIVWLDGRVPC |
| JGI25406J46586_102354081 | 3300003203 | Tabebuia Heterophylla Rhizosphere | MSDGGRGRASLGVKVWKSSQKWSVRRSAVRSLAWLGFYTAYRS* |
| Ga0055455_102893112 | 3300003990 | Natural And Restored Wetlands | HRPNENKMSDGGRERTSLGVEGWKSSKKWSVQRSAVRSIAWLDLFG* |
| Ga0062595_1000399201 | 3300004479 | Soil | MSDGGRGRASVAVGVWESSQKRSVQRSAVRSIVWLGDGSFFTIK |
| Ga0062592_1009202073 | 3300004480 | Soil | RPNENKMSDGGRDRASLGVKVWKSSQKCSVRRSAVRSIAWLDGGVIIFGRGLIS* |
| Ga0062591_1010946832 | 3300004643 | Soil | MRPNENKMSDGGRDRASLGVKVWKSSQKWSVQRSAVRSIAWLG |
| Ga0066672_104945403 | 3300005167 | Soil | PNENKMSDGGRDRASLGIGVWKSSQKWSVQRSAVRSIAWLDVAVEFT* |
| Ga0066690_108518301 | 3300005177 | Soil | VCAVASNENKMSDGGRDRASLGVKGWKSSQEWSVQRSAVRSIAWLDV |
| Ga0066684_107345491 | 3300005179 | Soil | ENKMSDGGRERASSGVEVWKSSQSWSVQRSAVRSIAWLDHSRRHA* |
| Ga0066685_106939442 | 3300005180 | Soil | MSDGARGRASLGVKVWRSSQKWSVQRSTVRSIAWLGLFTDS |
| Ga0066671_109708212 | 3300005184 | Soil | MRPNENKMSDGGRGRASLGVEVWKSSQKWSAQRSAVRSIAWLDGW |
| Ga0065712_101634812 | 3300005290 | Miscanthus Rhizosphere | MSDGGRERVSLGLKMWKSSQNVDAERSAVRSVAWLGSRGVIL* |
| Ga0065712_102307583 | 3300005290 | Miscanthus Rhizosphere | SNENKMSDGGRERALLVLKVWEYVDPKRSAVRSIAWLDSVA* |
| Ga0065715_110823322 | 3300005293 | Miscanthus Rhizosphere | VSSNENKMSEGGRGRALLGVRVWKSSQRSSVQRPAVRSIAWLDASF |
| Ga0070671_1002987523 | 3300005355 | Switchgrass Rhizosphere | LPSNETKMSDGGLERASLGVEVCKASQMWTYSGSAVRSIAWLDGGRRSSSM* |
| Ga0070710_111054382 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDGGRESAPLGVKVWKSSQNEATKRSAVRFIAWLGFMGDTTH |
| Ga0070711_1002545003 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDGGRGRAPLGVKVWKSSQKWSIQRSAVRSIAWLDPYVTRTPT* |
| Ga0066689_103452172 | 3300005447 | Soil | SSNENKMSDGGRERGLLGVEVWKPSQNEDTKRSAVRSIAWLGHPAT* |
| Ga0070707_1018167232 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MNTSNENKMSDGGRDRASVGVGVWKSSQKWSAQRSAVRSIAWLDLMWQL* |
| Ga0070699_1000519431 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRLTSNENKMSDGGRGRASLGVEMQNSSQNVDAQRSAVRSIAWLD |
| Ga0073909_107258242 | 3300005526 | Surface Soil | MGVARERPNENKMSDGGRGRTSLGVKMWKSSQKWSVQQSAVRSIAWLGL |
| Ga0070697_1000812321 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MRDWTPGLPNENKMSDGGRERASLGIEVSKSSQKWSVQRSAVRSIAWL |
| Ga0070672_1013725981 | 3300005543 | Miscanthus Rhizosphere | MEFRLHARRRPNENKMSDGGRHRASLGVKAWKSSQKWSVQRSVVRSI |
| Ga0070665_1007937502 | 3300005548 | Switchgrass Rhizosphere | MSDGGRGRASIGVKVWKSSQKWSVQRSAVRSIAWLGLPFM* |
| Ga0066661_102971203 | 3300005554 | Soil | MGIMLSNENKTSDGGRGRASLGLKVWKSSQKWRVQRSAVRSIAWLGLCGF |
| Ga0066692_102738843 | 3300005555 | Soil | MSGGGRGRASLGVKAWESSQKLSAQRSAVRSIAWL |
| Ga0066707_103775903 | 3300005556 | Soil | MSDGGRDRASIGVEVWKSSQKWTVRRSAVRSIAWLDEFGDLMFLC |
| Ga0066700_111609393 | 3300005559 | Soil | MSDGGRERASLGVEVSKSSQKWSVQRSAVRSIAWLD |
| Ga0066670_106281331 | 3300005560 | Soil | MSDGGRERALLGVGVWKSSQKWSAQRSAVRSIAWL |
| Ga0066670_108455301 | 3300005560 | Soil | LLIIATPNENKMSDGGRDRASLGVEVWKSSQKWSAQRSAVRSIA |
| Ga0066693_102484061 | 3300005566 | Soil | MSDGGRERASLEIEVWKSCQKWSAQRSAVRSIAWLG |
| Ga0066705_105922133 | 3300005569 | Soil | MSDGGRDRASLGVEAWKSSQKLSVQRSAVRSIAWL |
| Ga0066705_106550762 | 3300005569 | Soil | MSDGGRERASLGVRVWKSFQKWSVQRSAVRSIAWLG |
| Ga0066694_105727872 | 3300005574 | Soil | MSDGGRDRGSLGVKVWKSSQKWGVQRSAVRSIAWLDLISRATCSLAAEDD |
| Ga0066702_107580191 | 3300005575 | Soil | MSDGGRGRALLSVGVWESSQKWSVQRSAVRSIAWLD |
| Ga0066654_108686292 | 3300005587 | Soil | MSDGGRESASIGVEVGKSSQESSVQPSAVRSIAWL |
| Ga0066706_113118922 | 3300005598 | Soil | TSNENKMSDGGRDRASLGVNGWKSSQKWSVRRSAVRSIAWLDE* |
| Ga0066706_114455542 | 3300005598 | Soil | MSDGGRERGSLGVKVWKSSQEWSVQRSTIRSIAWLGRFHISIEPVE |
| Ga0068864_1027255162 | 3300005618 | Switchgrass Rhizosphere | MSDGGRGRASLGVEMGKSSQKWSAQRSDVRSIAWLG |
| Ga0068861_1001261751 | 3300005719 | Switchgrass Rhizosphere | SNENKMSDGGRHRASLGVKRWKSSRKWSVQQSVVRSIAWLGPSAERA* |
| Ga0068863_1014657232 | 3300005841 | Switchgrass Rhizosphere | MSDGGRGRAPLGVKVWKSFQKWSVQRSAVRSIAWL |
| Ga0081455_101945261 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MSDGGRDRESLGVKVWTSSQKWSVQRSAVRSIAWLGLLL* |
| Ga0081455_103257141 | 3300005937 | Tabebuia Heterophylla Rhizosphere | KMSDGGRDRALLGAGLWKSSQMWSAQRSAVRSIAWLDDFGGITQPML* |
| Ga0066696_105495822 | 3300006032 | Soil | MSDGGRGRALLGVEGWKTSQKWSIQRPAVRSIAWLDA |
| Ga0066696_109800772 | 3300006032 | Soil | MSDRGRHRALIGVKVWKSSQKWSVQRSAVRSIAWLGL |
| Ga0066656_103555931 | 3300006034 | Soil | MSDGGRGRASLGVEIEVISNVNAERSAVRSIAWLD |
| Ga0066656_105349813 | 3300006034 | Soil | MSDGGRDRASLGVEAWKSSQKLSVQRSAVRSIAWLGLCGFIGGR |
| Ga0066652_1009965962 | 3300006046 | Soil | MSDGGRGRALLGVKVRKSSQKWSVRRSAVRSIAWL |
| Ga0066652_1012173312 | 3300006046 | Soil | MSDGGRERASLAVEVVKSSQKWSVRRSAVRSIAWLD |
| Ga0066652_1016016832 | 3300006046 | Soil | MFATFRPNENKMSDGGRGRVSIGVEMWKSSQKWSVRRSAVRSIAWLGL |
| Ga0070716_1004102862 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDGGRERASLGMEVRKSSQKWSVQRSAVRSIAWLGCNKQNRS |
| Ga0097621_1006402763 | 3300006237 | Miscanthus Rhizosphere | MSDGGRERASVGVKMWKSSQKWSVQRSAVRSIAWLGLS |
| Ga0066659_110280302 | 3300006797 | Soil | MSDGGRERASFGVDVWKSSQEWSVQRSAVRSIAWLDPIARSKT |
| Ga0066660_101409171 | 3300006800 | Soil | MSDGGRDRVSVGVNGWKSSQMWSVQRSAVRSIAWLG |
| Ga0075428_1005804683 | 3300006844 | Populus Rhizosphere | SNENKMSDGGRERASFGVEVWKSSQRSTVRRSAVRSIAWLDR* |
| Ga0079218_123903921 | 3300007004 | Agricultural Soil | MSDGGRSRASLEVEVWKSSQKLIAKRSAVRSIAWL |
| Ga0105245_113404372 | 3300009098 | Miscanthus Rhizosphere | DYIYETKMSDGGRGRALIGVKVWKLSQKWSVQRSALRSIA* |
| Ga0066709_1020665652 | 3300009137 | Grasslands Soil | MSDGGRRRASVGVGVLKSSQKWSVQRSAVRSIAWLD |
| Ga0134082_104709801 | 3300010303 | Grasslands Soil | PNENKMSDGGRGRALLGVKVWKSSQKGSAQRSAVRSIAWLDVLVAMQ* |
| Ga0134063_100372091 | 3300010335 | Grasslands Soil | MSDGGRQRASLGVELWKPSQKRSVQRSAVRSIAWLGLDAALL |
| Ga0134125_118361151 | 3300010371 | Terrestrial Soil | MMTSNENKMSDGGREHASLAWKAWKPSQKWSTQRSAVRSIAWLDL |
| Ga0134126_113103972 | 3300010396 | Terrestrial Soil | SFRSSGDYIYETKMSDGGRGRALIGVKVWKLSQKWSVQRSALRSIA* |
| Ga0153922_10832311 | 3300012181 | Attine Ant Fungus Gardens | MSDGGRNRALIGEGVLKSSQKGSVQRSAVRSIAWLGGGIG |
| Ga0137364_108197442 | 3300012198 | Vadose Zone Soil | MSDGGRGRAPLGVGVWKSSQEWSVRRSAVCSIAWLDVTLAMVIHVLPML |
| Ga0137365_107613631 | 3300012201 | Vadose Zone Soil | MIVTSNENKMSDGGRERASLGVKEWKSFQKWSVQRSAVRSIA |
| Ga0137399_115634351 | 3300012203 | Vadose Zone Soil | MMDSSSNETKMSDGGRNRALLAVEVWKSSQNWSVQRSAVRSIAWLDDF |
| Ga0137362_116942883 | 3300012205 | Vadose Zone Soil | MGKCNISSNENKMSDGGRERAALGLNVWKPSQKWDAERSAVR |
| Ga0137381_102013963 | 3300012207 | Vadose Zone Soil | MSDGGLDRALLGVEVWKSSQKLSVQRSALRSIVWLDVWS |
| Ga0137372_104174214 | 3300012350 | Vadose Zone Soil | MRSNENKMSDGGRERASLGVKEWKSFQKWSVQRSAVRSIAWLG |
| Ga0137386_110085221 | 3300012351 | Vadose Zone Soil | MSDGGRERALLGVELWKSSQKCSAQRSGVRSIALLVIQ* |
| Ga0137366_100941401 | 3300012354 | Vadose Zone Soil | MSDGGRGRALLGVKVRKSSQKWSVRRSAVRSIAWLG |
| Ga0137368_104530481 | 3300012358 | Vadose Zone Soil | MRSNENKMSDGGRERASLGVKEWKSFQKWSVQRSAVRSIAWL |
| Ga0137360_118553212 | 3300012361 | Vadose Zone Soil | MQPNENKMSDGGRDRASLGVKVWKSSQDWSVQRSAVRSIAWLGLCCNE |
| Ga0137358_102296331 | 3300012582 | Vadose Zone Soil | APNETKLSDGGRKRASLEVKEWKSFEKRSVQRSAVRSIAWLGVFLLWRR* |
| Ga0137397_101653331 | 3300012685 | Vadose Zone Soil | MSDGGRERASLGVEVWKSSQEWSVQRSAVRSSAWLGERVSTRGPLI |
| Ga0137419_116923551 | 3300012925 | Vadose Zone Soil | ENKMSGGGQERASPGVEVVKSSRKWSAQRSAVRSIAWLDEIIFLV* |
| Ga0164302_114511691 | 3300012961 | Soil | MCITSNENKMSDGERGRALLGVEVAKSSQKWSARRSDVRSIA |
| Ga0164309_119048152 | 3300012984 | Soil | IYETKMSDGGRGRALIGVKVWKLSQKWSVQRSALRSIA* |
| Ga0120132_10111834 | 3300013832 | Permafrost | MSDGGRKRVPLAVKVWKSSQKWSAQRSAVRSIAWLGLFAITNVGESLA |
| Ga0157377_116964892 | 3300014745 | Miscanthus Rhizosphere | GWNSFRSSGDYIYETKMSDGGRGRALIGVKVWKLSQKWSVQRSALRSIA* |
| Ga0137405_11079653 | 3300015053 | Vadose Zone Soil | MSDGGRGRASIGVGVWELSQKWSVQRSAVRSIALLAIQQLFMA |
| Ga0167632_10013085 | 3300015085 | Glacier Forefield Soil | MSDGGRGRALLGVGVWKSCQTVDAGRSAVRSIAWLDAFVLMVNASCQP |
| Ga0137418_104694653 | 3300015241 | Vadose Zone Soil | MSDGGRDRASIGVGIWMSSQKWSVQRSAVRSIAWLGLIVDDQVQD |
| Ga0132256_1030351872 | 3300015372 | Arabidopsis Rhizosphere | MPNENKLSDGGQERVSIGARVLKSSQKWSVQRSAVRSIAWLDL |
| Ga0132257_1004890081 | 3300015373 | Arabidopsis Rhizosphere | MSDGVRERVSLGVELWKSFQKWSVQRSAVRSIAWLDACGEFTLSRA |
| Ga0182034_104823083 | 3300016371 | Soil | MLTTSNEPKMSDSGRGRALLGVDVVKSSQKRSVRRSAVRSIAWLGQFVIA |
| Ga0184604_101263712 | 3300018000 | Groundwater Sediment | MSDGGRGRASLGVEVWKSSQKWSVQRSAVRSIAWLDLLEYIV |
| Ga0184619_105263801 | 3300018061 | Groundwater Sediment | SNENKMSDGGRDRASIGVEVWKSSQEWNVQRSAVRSIAWLDV |
| Ga0190272_127771202 | 3300018429 | Soil | MSDGGRERALIGVEGLKSSQKWRAERSAVRSIAWLDLLIEKSERDIN |
| Ga0066669_115694311 | 3300018482 | Grasslands Soil | MSDGGRERVTLGVKVWKSSQKLSVQRSAVRSIAWLDAVVATTTKV |
| Ga0173482_101201842 | 3300019361 | Soil | FRSSGDYIYETKMSDGGRGRALIGVKVWKLSQKWSVQRSALRSIA |
| Ga0193748_10197471 | 3300019865 | Soil | MESNENKMSDGGRERASLAVKVWKSCQKWSRQRSDVRSIAWLGN |
| Ga0193751_11213572 | 3300019888 | Soil | MSDGGRGRASLGVKVWKSSQKWNERRSAVRSVAWLGLCGFIGGR |
| Ga0193733_11801041 | 3300020022 | Soil | MSDGGRDRASLGVGVWKSSQKWSVQRSAVRSIAWLDGW |
| Ga0222622_107778713 | 3300022756 | Groundwater Sediment | MSDGGRERASIGVEVWKSSQKWSVRRSAVRSIAWLGLCGFIGG |
| Ga0222622_113578451 | 3300022756 | Groundwater Sediment | MSDGGRERALLGVEVWKSSQKWSVQRSAVRSIAWLGLTAGYRPRRLPLPQR |
| Ga0207638_10058351 | 3300025227 | Corn, Switchgrass And Miscanthus Rhizosphere | MSSNENKMSDGGQDRALLGVEVWKSSQKWSARRSAVRSIAWLGLYARLHDE |
| Ga0207693_107300441 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEDGQKRASLGVGVWKSSQEWSVQRSAVRSIAWLDVGLMVAA |
| Ga0207681_112770271 | 3300025923 | Switchgrass Rhizosphere | LRDIATLPSNEDKMSDGGRERTLLALEVWKSSQKWSVQRSAVRSIAW |
| Ga0209266_12829661 | 3300026327 | Soil | MSDGGRGRVLLGVGVWKSSQKWIVQRSAVRSIAWL |
| Ga0209577_103574143 | 3300026552 | Soil | MSDGGRGRALLGVEGWKTSQKWSIQRPAVRSIAWLDALVV |
| Ga0207439_1005421 | 3300026740 | Soil | MSDGGRERASLGVEVWNSSQKWSVQRSAVRSIAWLDVL |
| Ga0209811_103304731 | 3300027821 | Surface Soil | MSDGGRGRTPLAVKVWKSSQNVDAQRSAVRSIAWLGLFGFFT |
| Ga0307282_104098341 | 3300028784 | Soil | MEDRVTRSNENKMSDGGRERGSLGVKVSKSSQNWSVQRSAVRS |
| Ga0307304_102932661 | 3300028885 | Soil | MSDGGRERASLGVKEWKSFQKWSVQRSAVRSIAWLGRSTFIAPD |
| Ga0170824_1252584652 | 3300031231 | Forest Soil | LASNENKMSDGGLGRVSLGVEVWKSSQKWIVRRFAVRSIAWLDLIGHKAL |
| Ga0307477_106328481 | 3300031753 | Hardwood Forest Soil | GPNENKMSDGGRERASLGVKVWKSPQKWSVQRSAVRSIAWLDLLLASPDAA |
| Ga0335076_102653481 | 3300032955 | Soil | MSDGGRERLLLGVKGRKSYQMGSVQRSAVRSIAWLD |
| ⦗Top⦘ |