


| Basic Information | |
|---|---|
| Family ID | F083152 |
| Family Type | Metagenome |
| Number of Sequences | 113 |
| Average Sequence Length | 43 residues |
| Representative Sequence | FGGREGFRLVKIPGAWKHGELPDCFEPIEFGSFFVSYATD |
| Number of Associated Samples | 103 |
| Number of Associated Scaffolds | 113 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.88 % |
| % of genes near scaffold ends (potentially truncated) | 98.23 % |
| % of genes from short scaffolds (< 2000 bps) | 85.84 % |
| Associated GOLD sequencing projects | 97 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.24 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (66.372 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (18.584 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.664 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.248 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 11.76% Coil/Unstructured: 88.24% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.24 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 113 Family Scaffolds |
|---|---|---|
| PF00890 | FAD_binding_2 | 33.63 |
| PF00990 | GGDEF | 8.85 |
| PF13487 | HD_5 | 5.31 |
| PF13189 | Cytidylate_kin2 | 2.65 |
| PF01590 | GAF | 2.65 |
| PF02518 | HATPase_c | 2.65 |
| PF01266 | DAO | 1.77 |
| PF13185 | GAF_2 | 1.77 |
| PF05598 | DUF772 | 0.88 |
| PF00578 | AhpC-TSA | 0.88 |
| PF00027 | cNMP_binding | 0.88 |
| PF16158 | N_BRCA1_IG | 0.88 |
| PF02720 | DUF222 | 0.88 |
| PF00520 | Ion_trans | 0.88 |
| PF00589 | Phage_integrase | 0.88 |
| PF01467 | CTP_transf_like | 0.88 |
| PF02694 | UPF0060 | 0.88 |
| PF13633 | Obsolete Pfam Family | 0.88 |
| PF00881 | Nitroreductase | 0.88 |
| PF13492 | GAF_3 | 0.88 |
| PF13365 | Trypsin_2 | 0.88 |
| PF00226 | DnaJ | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
|---|---|---|---|
| COG1742 | Uncharacterized inner membrane protein YnfA, drug/metabolite transporter superfamily | General function prediction only [R] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 66.37 % |
| Unclassified | root | N/A | 33.63 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2189573000|GPBTN7E01EXWTU | Not Available | 517 | Open in IMG/M |
| 3300000891|JGI10214J12806_10586680 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1761 | Open in IMG/M |
| 3300002121|C687J26615_10088993 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300002123|C687J26634_10313590 | Not Available | 525 | Open in IMG/M |
| 3300002916|JGI25389J43894_1030117 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
| 3300004114|Ga0062593_103368238 | Not Available | 513 | Open in IMG/M |
| 3300005174|Ga0066680_10875546 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300005181|Ga0066678_10098157 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1768 | Open in IMG/M |
| 3300005332|Ga0066388_100517338 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1827 | Open in IMG/M |
| 3300005444|Ga0070694_101046476 | Not Available | 679 | Open in IMG/M |
| 3300005467|Ga0070706_100729601 | Not Available | 918 | Open in IMG/M |
| 3300005518|Ga0070699_101060194 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 743 | Open in IMG/M |
| 3300005540|Ga0066697_10679040 | Not Available | 565 | Open in IMG/M |
| 3300005552|Ga0066701_10047323 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2343 | Open in IMG/M |
| 3300005552|Ga0066701_10873737 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300005557|Ga0066704_10613837 | Not Available | 697 | Open in IMG/M |
| 3300005568|Ga0066703_10214614 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1169 | Open in IMG/M |
| 3300005598|Ga0066706_11522076 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300005615|Ga0070702_100275690 | Not Available | 1152 | Open in IMG/M |
| 3300005618|Ga0068864_100017872 | All Organisms → cellular organisms → Bacteria | 5915 | Open in IMG/M |
| 3300005764|Ga0066903_108584269 | Not Available | 520 | Open in IMG/M |
| 3300006173|Ga0070716_100462496 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 927 | Open in IMG/M |
| 3300006796|Ga0066665_10067169 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2533 | Open in IMG/M |
| 3300006845|Ga0075421_100418959 | All Organisms → cellular organisms → Bacteria | 1605 | Open in IMG/M |
| 3300006854|Ga0075425_100354648 | Not Available | 1689 | Open in IMG/M |
| 3300006854|Ga0075425_102566181 | Not Available | 563 | Open in IMG/M |
| 3300007265|Ga0099794_10007020 | All Organisms → cellular organisms → Bacteria | 4597 | Open in IMG/M |
| 3300009089|Ga0099828_11027475 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 734 | Open in IMG/M |
| 3300009137|Ga0066709_100561226 | All Organisms → cellular organisms → Bacteria | 1619 | Open in IMG/M |
| 3300009147|Ga0114129_10498100 | All Organisms → cellular organisms → Bacteria | 1592 | Open in IMG/M |
| 3300009147|Ga0114129_10610982 | All Organisms → cellular organisms → Bacteria | 1412 | Open in IMG/M |
| 3300009157|Ga0105092_10402266 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300009444|Ga0114945_10653317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium japonicum → Mesorhizobium japonicum MAFF 303099 | 639 | Open in IMG/M |
| 3300009815|Ga0105070_1132672 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 506 | Open in IMG/M |
| 3300010359|Ga0126376_11409641 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 722 | Open in IMG/M |
| 3300010362|Ga0126377_13582188 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300010366|Ga0126379_12606654 | Not Available | 603 | Open in IMG/M |
| 3300010375|Ga0105239_11732719 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 723 | Open in IMG/M |
| 3300010397|Ga0134124_10647867 | Not Available | 1040 | Open in IMG/M |
| 3300010398|Ga0126383_11925947 | Not Available | 679 | Open in IMG/M |
| 3300011269|Ga0137392_10003019 | All Organisms → cellular organisms → Bacteria | 10288 | Open in IMG/M |
| 3300011419|Ga0137446_1104613 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 675 | Open in IMG/M |
| 3300012198|Ga0137364_10151558 | All Organisms → cellular organisms → Bacteria | 1676 | Open in IMG/M |
| 3300012204|Ga0137374_10662634 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 788 | Open in IMG/M |
| 3300012209|Ga0137379_10962885 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 758 | Open in IMG/M |
| 3300012211|Ga0137377_11695786 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300012351|Ga0137386_10237948 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1309 | Open in IMG/M |
| 3300012357|Ga0137384_10866722 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 728 | Open in IMG/M |
| 3300012685|Ga0137397_10100026 | All Organisms → cellular organisms → Bacteria | 2125 | Open in IMG/M |
| 3300012685|Ga0137397_11048759 | Not Available | 597 | Open in IMG/M |
| 3300012907|Ga0157283_10189961 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 639 | Open in IMG/M |
| 3300012923|Ga0137359_11277946 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300012929|Ga0137404_10076183 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2648 | Open in IMG/M |
| 3300012930|Ga0137407_11021056 | Not Available | 783 | Open in IMG/M |
| 3300012948|Ga0126375_11042330 | Not Available | 669 | Open in IMG/M |
| 3300012977|Ga0134087_10170267 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
| 3300014157|Ga0134078_10221955 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
| 3300014321|Ga0075353_1183521 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium RIFCSPHIGHO2_02_FULL_69_13 | 549 | Open in IMG/M |
| 3300014883|Ga0180086_1173374 | Not Available | 561 | Open in IMG/M |
| 3300015053|Ga0137405_1041128 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1081 | Open in IMG/M |
| 3300015357|Ga0134072_10197109 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300016319|Ga0182033_10401079 | All Organisms → cellular organisms → Bacteria | 1159 | Open in IMG/M |
| 3300018031|Ga0184634_10125998 | All Organisms → cellular organisms → Bacteria | 1136 | Open in IMG/M |
| 3300018061|Ga0184619_10332675 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 694 | Open in IMG/M |
| 3300018433|Ga0066667_10145707 | All Organisms → cellular organisms → Bacteria | 1662 | Open in IMG/M |
| 3300021081|Ga0210379_10248449 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 772 | Open in IMG/M |
| 3300021170|Ga0210400_10107774 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2212 | Open in IMG/M |
| 3300021178|Ga0210408_10903019 | Not Available | 687 | Open in IMG/M |
| 3300025899|Ga0207642_10961696 | Not Available | 549 | Open in IMG/M |
| 3300025910|Ga0207684_10538619 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 999 | Open in IMG/M |
| 3300025910|Ga0207684_10993941 | Not Available | 702 | Open in IMG/M |
| 3300025922|Ga0207646_10106427 | All Organisms → cellular organisms → Bacteria | 2516 | Open in IMG/M |
| 3300025945|Ga0207679_11218400 | Not Available | 691 | Open in IMG/M |
| 3300025961|Ga0207712_11352414 | Not Available | 637 | Open in IMG/M |
| 3300026023|Ga0207677_12316477 | Not Available | 500 | Open in IMG/M |
| 3300026329|Ga0209375_1092710 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1373 | Open in IMG/M |
| 3300026334|Ga0209377_1214213 | Not Available | 637 | Open in IMG/M |
| 3300026342|Ga0209057_1018915 | All Organisms → cellular organisms → Bacteria | 3937 | Open in IMG/M |
| 3300026369|Ga0257152_1013397 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300026507|Ga0257165_1002012 | All Organisms → cellular organisms → Bacteria | 2561 | Open in IMG/M |
| 3300026528|Ga0209378_1207527 | Not Available | 640 | Open in IMG/M |
| 3300026529|Ga0209806_1011254 | All Organisms → cellular organisms → Bacteria | 4809 | Open in IMG/M |
| 3300026529|Ga0209806_1019280 | All Organisms → cellular organisms → Bacteria | 3522 | Open in IMG/M |
| 3300026532|Ga0209160_1332939 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300026540|Ga0209376_1050055 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2413 | Open in IMG/M |
| 3300026548|Ga0209161_10218918 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1031 | Open in IMG/M |
| 3300026548|Ga0209161_10257273 | Not Available | 900 | Open in IMG/M |
| 3300026550|Ga0209474_10544392 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300026759|Ga0207527_102018 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 691 | Open in IMG/M |
| 3300027646|Ga0209466_1065498 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 733 | Open in IMG/M |
| 3300027655|Ga0209388_1045675 | All Organisms → cellular organisms → Bacteria | 1264 | Open in IMG/M |
| 3300027835|Ga0209515_10115140 | All Organisms → cellular organisms → Bacteria | 1761 | Open in IMG/M |
| 3300027874|Ga0209465_10054680 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1915 | Open in IMG/M |
| 3300028792|Ga0307504_10357202 | Not Available | 564 | Open in IMG/M |
| 3300028828|Ga0307312_10996105 | Not Available | 555 | Open in IMG/M |
| (restricted) 3300031197|Ga0255310_10144781 | Not Available | 651 | Open in IMG/M |
| 3300031198|Ga0307500_10200509 | Not Available | 595 | Open in IMG/M |
| 3300031562|Ga0310886_10436296 | Not Available | 779 | Open in IMG/M |
| 3300031719|Ga0306917_10125002 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1879 | Open in IMG/M |
| 3300031723|Ga0318493_10440128 | Not Available | 716 | Open in IMG/M |
| 3300031770|Ga0318521_10009985 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 4026 | Open in IMG/M |
| 3300031781|Ga0318547_10816670 | Not Available | 581 | Open in IMG/M |
| 3300031805|Ga0318497_10090830 | All Organisms → cellular organisms → Bacteria | 1629 | Open in IMG/M |
| 3300031820|Ga0307473_10957365 | Not Available | 622 | Open in IMG/M |
| 3300031820|Ga0307473_11089043 | Not Available | 588 | Open in IMG/M |
| 3300031910|Ga0306923_10571448 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1272 | Open in IMG/M |
| 3300032180|Ga0307471_102593584 | Not Available | 642 | Open in IMG/M |
| 3300032180|Ga0307471_103882382 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 528 | Open in IMG/M |
| 3300032205|Ga0307472_100094433 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2036 | Open in IMG/M |
| 3300032205|Ga0307472_102568006 | Not Available | 519 | Open in IMG/M |
| 3300033433|Ga0326726_11105240 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 771 | Open in IMG/M |
| 3300034114|Ga0364938_134778 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira defluvii | 502 | Open in IMG/M |
| 3300034165|Ga0364942_0040332 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1497 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 18.58% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 14.16% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.08% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.08% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.31% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.42% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.54% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.54% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.65% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.65% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.77% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.77% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 1.77% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.77% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.77% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.89% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.89% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.89% |
| Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 0.89% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.89% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.89% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.89% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.89% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.89% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2189573000 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis 0-21cm (T0 for microcosms) | Environmental | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300002121 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 | Environmental | Open in IMG/M |
| 3300002123 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_3 | Environmental | Open in IMG/M |
| 3300002916 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009444 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 | Environmental | Open in IMG/M |
| 3300009815 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011419 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT357_2 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014321 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D1 | Environmental | Open in IMG/M |
| 3300014883 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT760_16_10D | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300026369 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-A | Environmental | Open in IMG/M |
| 3300026507 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-B | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026759 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G10A3w-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027835 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW60B uncontaminated upgradient, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300031197 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1 | Environmental | Open in IMG/M |
| 3300031198 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300034114 | Sediment microbial communities from East River floodplain, Colorado, United States - 9_s17 | Environmental | Open in IMG/M |
| 3300034165 | Sediment microbial communities from East River floodplain, Colorado, United States - 19_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| N55_10571540 | 2189573000 | Grass Soil | AAAAGVAEPGFRVVKIPGAWKHGEIPDCFEPVEFGSFFVSFAKP |
| JGI10214J12806_105866801 | 3300000891 | Soil | HCRVFSEGELYQRFGHEKNFHLQKIPGAWKHGELPACFEPIEFGSFFVSYTK* |
| C687J26615_100889931 | 3300002121 | Soil | RRPGFRLVKLPGEWKHGELPDCFEAIEFGAFFVAYAKEG* |
| C687J26634_103135903 | 3300002123 | Soil | QTDFRLVKIPGAWKHGELPDCFEPIEFGSFFVSYSKG* |
| JGI25389J43894_10301172 | 3300002916 | Grasslands Soil | ELRARFGGRKGFRLVKIPGAWKHGELPDCFEPIEFGSFFVSYATD* |
| Ga0062593_1033682381 | 3300004114 | Soil | HCRVFSEGELYQRFGHEQNFQVQKIPGEWGHGKLPDCFEPIEFGSFFVSYSKA* |
| Ga0066680_108755462 | 3300005174 | Soil | EAELRARFGGRKGFRLVKIPGAWKHGELPDCFEPIEFGSFFVSYATD* |
| Ga0066678_100981571 | 3300005181 | Soil | GNEPGFHLAKIPGAWKHGEIPACFEPVEFGSFFVSFSKP* |
| Ga0066388_1005173381 | 3300005332 | Tropical Forest Soil | QTFGPRKDFRLVKVPGAWKHGELPACFEPIEFGSFFVSYAKDGG* |
| Ga0070694_1010464762 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | KELRQTFGPRKDFRLVKVPGAWKHGELPSCFEPIEFGSFFVSYAKDGG* |
| Ga0070706_1007296011 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | ELYQRFGHQPNFRLQKIPGAWKHGELPACFEPIEFGSFFVSYSK* |
| Ga0070699_1010601943 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | RFGHQPNFRLQKIPGAWKHGELPACFEPIEFGSFFVSYSK* |
| Ga0066697_106790401 | 3300005540 | Soil | LVKVPGAWKHGELPNCFEPIEFGSFFVSYAKDGG* |
| Ga0066701_100473231 | 3300005552 | Soil | FGNEPGFHLAKIPGAWKHGEIPACFEPVEFGSFFVSFSKP* |
| Ga0066701_108737371 | 3300005552 | Soil | RLVKVPGAWKHGELPNCFEPIEFGSFFVSYAKDGG* |
| Ga0066704_106138371 | 3300005557 | Soil | LRQTFGHRKDFRLVKVPGAWKHGELPDCFEPIEFGSFFVSYAKDGG* |
| Ga0066703_102146142 | 3300005568 | Soil | GNEPGFHLAKIPGAWKHGEIPACFEPVEFGSFFVSFAKP* |
| Ga0066706_115220762 | 3300005598 | Soil | EAELRARFGGREGFRLVKIPGAWKHGELPDCFEPIEFGSFFVSYATD* |
| Ga0070702_1002756902 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | GELYQRFGHRPNFRLQKIPGAWKHGELPACFEPIEFGSFFVAFAK* |
| Ga0068864_1000178721 | 3300005618 | Switchgrass Rhizosphere | ELYQRFGHLPNFRLQKIPGAWKHGELPACFEPIEFGSFFVAFAK* |
| Ga0066903_1085842691 | 3300005764 | Tropical Forest Soil | RWGNAPGFRVVKIPGAWKHGEIPDCFEPVEFGSFFVSFAKA* |
| Ga0070716_1004624962 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | GGEPGFRVVKIPGAWKHGEIPDCFEPVEFGSFFVSFAKP* |
| Ga0066665_100671694 | 3300006796 | Soil | REGFRLVKIPGAWKHGELPDCFEPIEFGSFFVSYATD* |
| Ga0075421_1004189591 | 3300006845 | Populus Rhizosphere | GELYQRFGHLPNFRLQKIPGAWKHGELPACFEPIAFGSFFVAFAK* |
| Ga0075425_1003546481 | 3300006854 | Populus Rhizosphere | PNFRLQKIPGAWKHGELPACFEPIEFGSFFVAFAK* |
| Ga0075425_1025661811 | 3300006854 | Populus Rhizosphere | RRWGGEPGFRLAKIPGAWKHGEIPDCFEPVEFGSFFVSFAKA* |
| Ga0099794_100070201 | 3300007265 | Vadose Zone Soil | SEGELYQRFGHQPNFRLQKIPGAWKHGELPACFEPIEFGSFFVSYAK* |
| Ga0099828_110274752 | 3300009089 | Vadose Zone Soil | RWGGEPGFRLAKIPGAWKHGEIPDCFEPVEFGSFFVSFAKA* |
| Ga0066709_1005612261 | 3300009137 | Grasslands Soil | RKDFRLVKVPGAWKHGELPNCFEPIEFGSFFVSYAKDGG* |
| Ga0114129_104981001 | 3300009147 | Populus Rhizosphere | FTEKELRQTFGHRKDFRLVKVPGAWKHGELPDCFEPIEFGSFFVSYTKDGS* |
| Ga0114129_106109821 | 3300009147 | Populus Rhizosphere | FTEKELRQTFGHRKDFRLVKVPGAWKHGELPDCFEPIEFGSFFVSYTKDGG* |
| Ga0105092_104022661 | 3300009157 | Freshwater Sediment | SEGELYQRVGHELNFHVQKIPGTWGHGKLPDCFEPIEFGSFFVSYSKP* |
| Ga0114945_106533172 | 3300009444 | Thermal Springs | ELRERFGRYAGFRVVKIPGAWKHGELPDCFEPIEFGSFFVAFGRP* |
| Ga0105070_11326722 | 3300009815 | Groundwater Sand | VFTEGELHRRFGQRKNFRLVKIPGAWKHGELPDCFEPIEFGSFFVSYAKS* |
| Ga0126376_114096411 | 3300010359 | Tropical Forest Soil | ADLHKRWGNAPGFRVVNIPGAWKHGEIPDCFEPVEFGSFFVSFAKA* |
| Ga0126377_135821881 | 3300010362 | Tropical Forest Soil | RRWGGQIGFRLVKIPGVIKADEHGEFPSCLEPIEFGSFFVALTK* |
| Ga0126379_126066541 | 3300010366 | Tropical Forest Soil | RVFSEADLHKRWGHAPGFRVVKIPGAWKHGEIPDCFEPVEFGSFFVSFAKA* |
| Ga0105239_117327192 | 3300010375 | Corn Rhizosphere | WGGEPGFRVVKIPGAWKHGEIPDCFEPVEFGSFFVSFAKP* |
| Ga0134124_106478674 | 3300010397 | Terrestrial Soil | GHEQNFQVQKIPGEWGHGKLPDCFEPIEFGSFFVSYSKA* |
| Ga0126383_119259471 | 3300010398 | Tropical Forest Soil | PEFRVVKIPGAWKHGEIPDCFEPVEFGSFFVSFTKA* |
| Ga0137392_100030191 | 3300011269 | Vadose Zone Soil | RFGNEPGFHLSKIPGAWKHGEIPACFEPVEFGSFFVSFSKP* |
| Ga0137446_11046131 | 3300011419 | Soil | DLRRRWSGEPGFRVVKIPGAWKHGEIPDCFEPDEFGSFFVSFAKA* |
| Ga0137364_101515583 | 3300012198 | Vadose Zone Soil | ARFGERPGFRLAKIPGAWKHGELPDCFEPIEFGSFFVSYATER* |
| Ga0137374_106626342 | 3300012204 | Vadose Zone Soil | VFSEADLRRRWGGEPGFRVVKIPGAWKHGEIPDCFEPVEFGSFFVSFARP* |
| Ga0137379_109628851 | 3300012209 | Vadose Zone Soil | QRFGHQPNFRLQKIPGAWKHGELPACFEPIEFGSFFVSYAK* |
| Ga0137377_116957861 | 3300012211 | Vadose Zone Soil | TFGPRKDFRLVKVPGAWKHGELPSCFEPIEFGSFFVSYAKDGG* |
| Ga0137386_102379481 | 3300012351 | Vadose Zone Soil | DLRRRWGGEPGFRVVKIPGAWKHGEIPDCFEPVEFGSFFVSFARP* |
| Ga0137384_108667221 | 3300012357 | Vadose Zone Soil | GFRVAKISGAWKHGEIPDCFEPVEFGSFFVSFAKP* |
| Ga0137397_101000263 | 3300012685 | Vadose Zone Soil | ELYQRFGHERNFQVQKIPGAWGHGKLPDCFEPIEFGSFFVSYSK* |
| Ga0137397_110487591 | 3300012685 | Vadose Zone Soil | PGFRVVKIPGAWKHGEIPDCFEPVEFGSFFVSFAKA* |
| Ga0157283_101899611 | 3300012907 | Soil | EKNFHLQKIPGAWKHGELPACFEPIEFGSFFVSYTK* |
| Ga0137359_112779462 | 3300012923 | Vadose Zone Soil | ELYQRFGHEKNFQVQKIPGAWGHGKLPDCFEPIEFGSFFVSYSK* |
| Ga0137404_100761831 | 3300012929 | Vadose Zone Soil | ELRERFGGRPDFRLVKIPGAWKHGELPDCFEPVEFGSFFVSYSKA* |
| Ga0137407_110210562 | 3300012930 | Vadose Zone Soil | ELYQRFGHEENFHVQKIPGAWGHGKLPDCFEPIEFGSFFVSYSKA* |
| Ga0126375_110423302 | 3300012948 | Tropical Forest Soil | GFRVVKIPGAWKHGEIPDCFEAVEFGSFFVSFTKA* |
| Ga0134087_101702671 | 3300012977 | Grasslands Soil | ELRQTFGHRKDFRLVKVPGAWKHGELPNCFEPIEFGSFFVSYAKDGG* |
| Ga0134078_102219551 | 3300014157 | Grasslands Soil | FGGREGFRLVKIPGAWKHGELPDCFEPIEFGSFFVSYATD* |
| Ga0075353_11835213 | 3300014321 | Natural And Restored Wetlands | PGFRIVKIPGAWKHGEIPDCFEPVEFGSFFVSFAKA* |
| Ga0180086_11733741 | 3300014883 | Soil | PGFLVVKISGAWKHGEIPDCFEPVEFGSFFVSFAKA* |
| Ga0137405_10411282 | 3300015053 | Vadose Zone Soil | LRKRWGGEPGFRVVKIPGAWKHGEIPECFEPVEFGSFFVSFARP* |
| Ga0134072_101971091 | 3300015357 | Grasslands Soil | TEAELRARFGGREGFRLVKIPGAWKHGELPDCFEPIEFGSFFVSYATD* |
| Ga0182033_104010791 | 3300016319 | Soil | TFGPRKDFRLVKVPGAWKHGELPACFEPIEFGSFFVSYAKDGG |
| Ga0184634_101259981 | 3300018031 | Groundwater Sediment | SELRQRFGHRKDFRLVKVPGAWKHGELPNCFEPIEFGSFFVSYAKDGG |
| Ga0184619_103326752 | 3300018061 | Groundwater Sediment | DLRRRWGGEPEFRLVKIPGAWKHGEIPDCFEPVEFGSFFVSFAKA |
| Ga0066667_101457072 | 3300018433 | Grasslands Soil | GFRLVKIPGAWKHGELPDCFEPIEFGSFFVSYATSG |
| Ga0210379_102484493 | 3300021081 | Groundwater Sediment | EPGFRVVKIPGAWKHGEIPDCFEPVEFGSFFVSFDKA |
| Ga0210400_101077741 | 3300021170 | Soil | PNFRLQKIPGAWKHGELPACFEPIEFGSFFVSYSK |
| Ga0210408_109030192 | 3300021178 | Soil | QPNFRLQKIPGAWKHGELPACFEPIEFGSFFVSYSK |
| Ga0207642_109616962 | 3300025899 | Miscanthus Rhizosphere | EKELRQTFGPRKDFRLVKVPGAWKHGELPSCFEPIEFGSFFVSYAKDGG |
| Ga0207684_105386192 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | CRVFSEGELYQRFGHQPNFRLQKIPGAWKHGELPACFEPIEFGSFFVAYSK |
| Ga0207684_109939412 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | YQRFGHEKNFRMEKIPGAWKHGELPDCFEPIEFGSFFVSYSK |
| Ga0207646_101064273 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | GNEPGFHLTKIPGAWKHGEIPACFEPVEFGSFFVSLKKP |
| Ga0207679_112184002 | 3300025945 | Corn Rhizosphere | QTFGPRKDFRLVKVPGAWKHGELPACFEPIEFGSFFVSYAKDGG |
| Ga0207712_113524141 | 3300025961 | Switchgrass Rhizosphere | ELRQTFGPRKDFRLVKVPGAWKHGELPSCFEPIEFGSFFVSYAKDGG |
| Ga0207677_123164771 | 3300026023 | Miscanthus Rhizosphere | RWGGEPGFRVVKIPGAWKHGEIPDCFEPVEFGSFFVSFAKP |
| Ga0209375_10927101 | 3300026329 | Soil | FSETELRRRFGNEPGFHLAKIPGAWKHGEIPACFEPVEFGSFFVSFAKP |
| Ga0209377_12142132 | 3300026334 | Soil | TGKELWQTFGHRKDFRLVKVPGAWKHGELPNCFEPIEFGSFFVSYAKDGG |
| Ga0209057_10189155 | 3300026342 | Soil | EAELRARFGGRAGFRLVKIPGAWKHGELPDCFEPIEFGSFFVAYATSG |
| Ga0257152_10133971 | 3300026369 | Soil | GELYQRFGHQPNFRLQKIPGAWKHGELPACFEPIEFGSFFVSYSK |
| Ga0257165_10020123 | 3300026507 | Soil | ETELRRRFASEPGFHLAKIPGAWKHGEIPACFEPVEFGSFFVSFSKP |
| Ga0209378_12075271 | 3300026528 | Soil | KELRQTFGHRKDFRLVKVPGAWKHGELPDCFEPIEFGSFFVSYAKDGG |
| Ga0209806_10112541 | 3300026529 | Soil | HRRDFRLVKVPGAWKHGELPDCFEPIEFGSFFVSYAKDGG |
| Ga0209806_10192803 | 3300026529 | Soil | ETELRRRFGNEPGFHLAKIPGAWKHGEIPACFEPVEFGSFFVSFAKP |
| Ga0209160_13329391 | 3300026532 | Soil | FGGREGFRLVKIPGAWKHGELPDCFEPIEFGSFFVSYATD |
| Ga0209376_10500552 | 3300026540 | Soil | VFTEKELRQTFGHRKDFRLVKVPGAWKHGELPNCFEPIEFGSFFVSYAKDGG |
| Ga0209161_102189182 | 3300026548 | Soil | FSETELRRRFGNEPGFHLAKIPGAWKHGEIPACFEPVEFGSFFVSFSKP |
| Ga0209161_102572732 | 3300026548 | Soil | DFRLVKVPGAWKHGELPNCFEPIEFGSFFVSYAKDGG |
| Ga0209474_105443922 | 3300026550 | Soil | GGRAGFRLVKIPGAWKHGELPDCFEPIEFGSFFVSYATSG |
| Ga0207527_1020182 | 3300026759 | Soil | HEKNFHLQKIPGAWKHGELPACFEPIEFGSFFVSYTK |
| Ga0209466_10654981 | 3300027646 | Tropical Forest Soil | EADLHTRWGRALGFRVVKIPGAWKHGEIPDCFEAVEFGSFFVSFTKA |
| Ga0209388_10456755 | 3300027655 | Vadose Zone Soil | VFSEGELYQRFGHQPNFRLQKIPGAWKHGELPACFEPIEFGSFFVSYSK |
| Ga0209515_101151404 | 3300027835 | Groundwater | GFRLVKIPGEWKHGELPDCFEPIEFGSFFVAYGKP |
| Ga0209465_100546801 | 3300027874 | Tropical Forest Soil | DLHKRWGHAPGFRVVKIPGAWKHGEIPDCFEPVEFGSFFVSFAKA |
| Ga0307504_103572021 | 3300028792 | Soil | HRKDFRLVKVPGAWKHGELPDCFEPIEFGSFFVSYAKDGG |
| Ga0307312_109961051 | 3300028828 | Soil | WGGEPGFRLVKIPGAWKHGEIPDCFEPVEFGSFFVSFAKA |
| (restricted) Ga0255310_101447813 | 3300031197 | Sandy Soil | VFSETELERRFGGEKGFSLVKIPGAWKHGELPDCFEPIEFGSFFVSYSKS |
| Ga0307500_102005091 | 3300031198 | Soil | TEKELRQTFGPRKDFRLVKVPGAWKHGELPSCFEPIEFGSFFVSYAKDGG |
| Ga0310886_104362962 | 3300031562 | Soil | GHRKDFRLVKVPGAWKHGELPDCFEPIEFGSFFVSYTKDGS |
| Ga0306917_101250023 | 3300031719 | Soil | PRKDFRLVKVPGASKHGELPACFEPIEFGSFFVSYAKDGG |
| Ga0318493_104401281 | 3300031723 | Soil | GHRKDFRLVKVPGAWKHGELPACFEPIEFGSFFVSYAKDGG |
| Ga0318521_100099855 | 3300031770 | Soil | RVFSEAELHTRWGSAPEFRVVKIPGAWKHGEIPDCFEPVEFGSFFVSFTKA |
| Ga0318547_108166702 | 3300031781 | Soil | VFTEKELRAAFGHRKDFRLVKVPGAWKHGELPACFEPIEFGSFFVSYAKDGG |
| Ga0318497_100908301 | 3300031805 | Soil | EKELRGAFGHRKDFRLVKVPGAWKHGELPACFEPIEFGSFFVSYAKDGG |
| Ga0307473_109573651 | 3300031820 | Hardwood Forest Soil | FRLVKVPGAWKHGELPACFEPIEFGSFFVSYAKDGG |
| Ga0307473_110890431 | 3300031820 | Hardwood Forest Soil | GFRVVKIPGAWKHGEIPDCFEPVEFGSFFVSFAKP |
| Ga0306923_105714482 | 3300031910 | Soil | HTRWGSAPEFRVVKIPGAWKHGEIPDCFEPVEFGSFFVSFTKA |
| Ga0307471_1025935841 | 3300032180 | Hardwood Forest Soil | TEAELHERFGRRPAFRLAKLPGEWKHGKLPDCFEPVEFGAFFVSYAKEG |
| Ga0307471_1038823821 | 3300032180 | Hardwood Forest Soil | RVFSQDELYQRFGHEKNFRLEKIPGAWKHGELPDCFEPIEFGSFFVSYSK |
| Ga0307472_1000944331 | 3300032205 | Hardwood Forest Soil | GEPGFRVVKIPGAWKHGEIPDCFEPVEFGSFFVSFAKP |
| Ga0307472_1025680061 | 3300032205 | Hardwood Forest Soil | HQPNFRLQKIPGAWKHGELPACFEPIEFGSFFVSYSK |
| Ga0326726_111052401 | 3300033433 | Peat Soil | PGFRVVKIPGAWKHGEIPDCFEPVEFGSFFVSFAKA |
| Ga0364938_134778_373_501 | 3300034114 | Sediment | ARFGGEPDFRLVKIPGRFKPGEFPAALEPVEFGSFFVAFAKR |
| Ga0364942_0040332_3_155 | 3300034165 | Sediment | VFSAAELDRRFGGQTDFRLVKIPGAWKHGELPDCFEPIEFGSFFVSYSKG |
| ⦗Top⦘ |