


| Basic Information | |
|---|---|
| Family ID | F083094 |
| Family Type | Metagenome |
| Number of Sequences | 113 |
| Average Sequence Length | 39 residues |
| Representative Sequence | RNHASTADRRARQKPAAMSMLQCSNRSTVAAQKFVTQ |
| Number of Associated Samples | 76 |
| Number of Associated Scaffolds | 113 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 75.22 % |
| Associated GOLD sequencing projects | 67 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.24 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (70.796 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil (23.009 % of family members) |
| Environment Ontology (ENVO) | Unclassified (61.947 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (58.407 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.92% β-sheet: 0.00% Coil/Unstructured: 63.08% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.24 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 113 Family Scaffolds |
|---|---|---|
| PF05598 | DUF772 | 5.31 |
| PF13751 | DDE_Tnp_1_6 | 4.42 |
| PF03401 | TctC | 3.54 |
| PF01144 | CoA_trans | 3.54 |
| PF00005 | ABC_tran | 3.54 |
| PF00067 | p450 | 3.54 |
| PF13340 | DUF4096 | 2.65 |
| PF00536 | SAM_1 | 2.65 |
| PF00501 | AMP-binding | 1.77 |
| PF00583 | Acetyltransf_1 | 1.77 |
| PF13586 | DDE_Tnp_1_2 | 1.77 |
| PF00589 | Phage_integrase | 1.77 |
| PF13683 | rve_3 | 1.77 |
| PF13193 | AMP-binding_C | 1.77 |
| PF00072 | Response_reg | 0.88 |
| PF00989 | PAS | 0.88 |
| PF13458 | Peripla_BP_6 | 0.88 |
| PF11752 | DUF3309 | 0.88 |
| PF04055 | Radical_SAM | 0.88 |
| PF03461 | TRCF | 0.88 |
| PF02737 | 3HCDH_N | 0.88 |
| PF03734 | YkuD | 0.88 |
| PF00107 | ADH_zinc_N | 0.88 |
| PF06147 | DUF968 | 0.88 |
| PF04860 | Phage_portal | 0.88 |
| PF01609 | DDE_Tnp_1 | 0.88 |
| PF09335 | SNARE_assoc | 0.88 |
| PF08327 | AHSA1 | 0.88 |
| PF13714 | PEP_mutase | 0.88 |
| PF01717 | Meth_synt_2 | 0.88 |
| PF02661 | Fic | 0.88 |
| PF13770 | DUF4169 | 0.88 |
| PF03471 | CorC_HlyC | 0.88 |
| PF01921 | tRNA-synt_1f | 0.88 |
| PF13361 | UvrD_C | 0.88 |
| PF03354 | TerL_ATPase | 0.88 |
| PF01161 | PBP | 0.88 |
| PF05013 | FGase | 0.88 |
| PF00239 | Resolvase | 0.88 |
| PF00593 | TonB_dep_Rec | 0.88 |
| PF10108 | DNA_pol_B_exo2 | 0.88 |
| PF02896 | PEP-utilizers_C | 0.88 |
| PF06689 | zf-C4_ClpX | 0.88 |
| PF00484 | Pro_CA | 0.88 |
| PF05128 | DUF697 | 0.88 |
| PF02786 | CPSase_L_D2 | 0.88 |
| PF00753 | Lactamase_B | 0.88 |
| PF13502 | AsmA_2 | 0.88 |
| PF08241 | Methyltransf_11 | 0.88 |
| PF12893 | Lumazine_bd_2 | 0.88 |
| PF13676 | TIR_2 | 0.88 |
| PF07886 | BA14K | 0.88 |
| PF13231 | PMT_2 | 0.88 |
| PF00015 | MCPsignal | 0.88 |
| PF01039 | Carboxyl_trans | 0.88 |
| PF04002 | RadC | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
|---|---|---|---|
| COG1788 | Acyl CoA:acetate/3-ketoacid CoA transferase, alpha subunit | Lipid transport and metabolism [I] | 3.54 |
| COG2057 | Acyl-CoA:acetate/3-ketoacid CoA transferase, beta subunit | Lipid transport and metabolism [I] | 3.54 |
| COG2124 | Cytochrome P450 | Defense mechanisms [V] | 3.54 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 3.54 |
| COG4670 | Acyl CoA:acetate/3-ketoacid CoA transferase | Lipid transport and metabolism [I] | 3.54 |
| COG0840 | Methyl-accepting chemotaxis protein (MCP) | Signal transduction mechanisms [T] | 1.77 |
| COG1197 | Transcription-repair coupling factor (superfamily II helicase) | Transcription [K] | 1.77 |
| COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.88 |
| COG0287 | Prephenate dehydrogenase | Amino acid transport and metabolism [E] | 0.88 |
| COG0288 | Carbonic anhydrase | Inorganic ion transport and metabolism [P] | 0.88 |
| COG0398 | Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family | Function unknown [S] | 0.88 |
| COG0586 | Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family | Cell wall/membrane/envelope biogenesis [M] | 0.88 |
| COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 0.88 |
| COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.88 |
| COG0777 | Acetyl-CoA carboxylase beta subunit | Lipid transport and metabolism [I] | 0.88 |
| COG0825 | Acetyl-CoA carboxylase alpha subunit | Lipid transport and metabolism [I] | 0.88 |
| COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.88 |
| COG1238 | Uncharacterized membrane protein YqaA, VTT domain | Function unknown [S] | 0.88 |
| COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 0.88 |
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 0.88 |
| COG1384 | Lysyl-tRNA synthetase, class I | Translation, ribosomal structure and biogenesis [J] | 0.88 |
| COG1748 | Saccharopine dehydrogenase, NADP-dependent | Amino acid transport and metabolism [E] | 0.88 |
| COG1881 | Uncharacterized conserved protein, phosphatidylethanolamine-binding protein (PEBP) family | General function prediction only [R] | 0.88 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.88 |
| COG2003 | DNA repair protein RadC, contains a helix-hairpin-helix DNA-binding motif | Replication, recombination and repair [L] | 0.88 |
| COG2084 | 3-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenase | Lipid transport and metabolism [I] | 0.88 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.88 |
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 0.88 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.88 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.88 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.88 |
| COG3741 | N-formylglutamate amidohydrolase | Amino acid transport and metabolism [E] | 0.88 |
| COG3768 | Uncharacterized membrane protein YcjF, UPF0283 family | Function unknown [S] | 0.88 |
| COG3931 | Predicted N-formylglutamate amidohydrolase | Amino acid transport and metabolism [E] | 0.88 |
| COG4626 | Phage terminase-like protein, large subunit, contains N-terminal HTH domain | Mobilome: prophages, transposons [X] | 0.88 |
| COG4799 | Acetyl-CoA carboxylase, carboxyltransferase component | Lipid transport and metabolism [I] | 0.88 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.88 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.88 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 70.80 % |
| Unclassified | root | N/A | 29.20 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001385|JGI20193J14888_1000793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 9069 | Open in IMG/M |
| 3300001385|JGI20193J14888_1002318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4944 | Open in IMG/M |
| 3300001385|JGI20193J14888_1021730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1021 | Open in IMG/M |
| 3300001394|JGI20191J14862_1000382 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 15245 | Open in IMG/M |
| 3300001394|JGI20191J14862_1000413 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 14628 | Open in IMG/M |
| 3300001394|JGI20191J14862_1005266 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3236 | Open in IMG/M |
| 3300001397|JGI20177J14857_1011886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1507 | Open in IMG/M |
| 3300001402|JGI20195J14853_1000676 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 11422 | Open in IMG/M |
| 3300004080|Ga0062385_10158893 | All Organisms → cellular organisms → Bacteria | 1177 | Open in IMG/M |
| 3300004092|Ga0062389_102206180 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 724 | Open in IMG/M |
| 3300005163|Ga0066823_10108344 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 577 | Open in IMG/M |
| 3300005938|Ga0066795_10153969 | Not Available | 685 | Open in IMG/M |
| 3300005938|Ga0066795_10172489 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 644 | Open in IMG/M |
| 3300005947|Ga0066794_10162347 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 671 | Open in IMG/M |
| 3300005980|Ga0066798_10018237 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2420 | Open in IMG/M |
| 3300005980|Ga0066798_10085484 | Not Available | 935 | Open in IMG/M |
| 3300005980|Ga0066798_10191565 | Not Available | 557 | Open in IMG/M |
| 3300006055|Ga0097691_1044214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1603 | Open in IMG/M |
| 3300006059|Ga0075017_100822793 | Not Available | 718 | Open in IMG/M |
| 3300006174|Ga0075014_100328057 | Not Available | 814 | Open in IMG/M |
| 3300006640|Ga0075527_10041254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1239 | Open in IMG/M |
| 3300006950|Ga0075524_10213341 | Not Available | 841 | Open in IMG/M |
| 3300006950|Ga0075524_10342949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 656 | Open in IMG/M |
| 3300009029|Ga0066793_10167104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1282 | Open in IMG/M |
| 3300009519|Ga0116108_1007811 | All Organisms → cellular organisms → Bacteria | 4255 | Open in IMG/M |
| 3300009522|Ga0116218_1518448 | Not Available | 531 | Open in IMG/M |
| 3300009523|Ga0116221_1316318 | Not Available | 676 | Open in IMG/M |
| 3300009547|Ga0116136_1041096 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1346 | Open in IMG/M |
| 3300009552|Ga0116138_1033427 | Not Available | 1529 | Open in IMG/M |
| 3300009629|Ga0116119_1025825 | Not Available | 1593 | Open in IMG/M |
| 3300009629|Ga0116119_1026169 | Not Available | 1582 | Open in IMG/M |
| 3300009632|Ga0116102_1113038 | Not Available | 772 | Open in IMG/M |
| 3300009639|Ga0116122_1069534 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1167 | Open in IMG/M |
| 3300009698|Ga0116216_10348405 | Not Available | 901 | Open in IMG/M |
| 3300009698|Ga0116216_10605873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 660 | Open in IMG/M |
| 3300009700|Ga0116217_10210105 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1276 | Open in IMG/M |
| 3300009764|Ga0116134_1060835 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1421 | Open in IMG/M |
| 3300009824|Ga0116219_10608302 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium archetypum | 600 | Open in IMG/M |
| 3300009839|Ga0116223_10377730 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300009839|Ga0116223_10525072 | Not Available | 687 | Open in IMG/M |
| 3300010343|Ga0074044_10054053 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2749 | Open in IMG/M |
| 3300010343|Ga0074044_10628381 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → unclassified Microvirga → Microvirga sp. HBU67692 | 701 | Open in IMG/M |
| 3300010379|Ga0136449_100126016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 5121 | Open in IMG/M |
| 3300010379|Ga0136449_100243098 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3355 | Open in IMG/M |
| 3300010379|Ga0136449_100379674 | Not Available | 2521 | Open in IMG/M |
| 3300010379|Ga0136449_100482168 | Not Available | 2162 | Open in IMG/M |
| 3300010379|Ga0136449_100508406 | All Organisms → cellular organisms → Bacteria | 2089 | Open in IMG/M |
| 3300010379|Ga0136449_100811955 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1543 | Open in IMG/M |
| 3300010379|Ga0136449_101060809 | Not Available | 1295 | Open in IMG/M |
| 3300010379|Ga0136449_101154542 | Not Available | 1226 | Open in IMG/M |
| 3300010379|Ga0136449_101762254 | Not Available | 929 | Open in IMG/M |
| 3300010379|Ga0136449_103009247 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300014153|Ga0181527_1431650 | Not Available | 500 | Open in IMG/M |
| 3300014158|Ga0181521_10439309 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300014165|Ga0181523_10533229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 647 | Open in IMG/M |
| 3300014326|Ga0157380_12935710 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylocaldum | 543 | Open in IMG/M |
| 3300014638|Ga0181536_10007992 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 10295 | Open in IMG/M |
| 3300014638|Ga0181536_10129656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocella → Methylocella tundrae | 1364 | Open in IMG/M |
| 3300014638|Ga0181536_10404034 | Not Available | 610 | Open in IMG/M |
| 3300014638|Ga0181536_10426638 | Not Available | 588 | Open in IMG/M |
| 3300017823|Ga0187818_10453360 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 573 | Open in IMG/M |
| 3300017823|Ga0187818_10466528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 565 | Open in IMG/M |
| 3300017925|Ga0187856_1144894 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 900 | Open in IMG/M |
| 3300017929|Ga0187849_1214060 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 747 | Open in IMG/M |
| 3300017938|Ga0187854_10043817 | All Organisms → cellular organisms → Bacteria | 2271 | Open in IMG/M |
| 3300017938|Ga0187854_10244672 | Not Available | 780 | Open in IMG/M |
| 3300017941|Ga0187850_10524990 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 511 | Open in IMG/M |
| 3300017946|Ga0187879_10229660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga | 1037 | Open in IMG/M |
| 3300017995|Ga0187816_10167850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 951 | Open in IMG/M |
| 3300017996|Ga0187891_1000792 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 30078 | Open in IMG/M |
| 3300017996|Ga0187891_1004129 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 9646 | Open in IMG/M |
| 3300018008|Ga0187888_1084740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 1374 | Open in IMG/M |
| 3300018008|Ga0187888_1337532 | Not Available | 574 | Open in IMG/M |
| 3300018014|Ga0187860_1017472 | All Organisms → cellular organisms → Bacteria | 4252 | Open in IMG/M |
| 3300018017|Ga0187872_10246880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 801 | Open in IMG/M |
| 3300018025|Ga0187885_10204979 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 913 | Open in IMG/M |
| 3300018030|Ga0187869_10334446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium 35-68-8 | 726 | Open in IMG/M |
| 3300018040|Ga0187862_10339587 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 936 | Open in IMG/M |
| 3300018042|Ga0187871_10211877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1081 | Open in IMG/M |
| 3300018042|Ga0187871_10435973 | Not Available | 724 | Open in IMG/M |
| 3300018072|Ga0184635_10335651 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Nitrobacter → unclassified Nitrobacter → Nitrobacter sp. Nb-311A | 584 | Open in IMG/M |
| 3300020583|Ga0210401_10883869 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas rhenobacensis | 753 | Open in IMG/M |
| 3300023088|Ga0224555_1047296 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1613 | Open in IMG/M |
| 3300024227|Ga0228598_1010851 | Not Available | 1814 | Open in IMG/M |
| 3300025322|Ga0209641_10346150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → unclassified Methylocystis → Methylocystis sp. ATCC 49242 | 1083 | Open in IMG/M |
| 3300025453|Ga0208455_1013549 | Not Available | 2016 | Open in IMG/M |
| 3300025453|Ga0208455_1061206 | Not Available | 777 | Open in IMG/M |
| 3300025457|Ga0208850_1007130 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 2252 | Open in IMG/M |
| 3300025457|Ga0208850_1034544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 864 | Open in IMG/M |
| 3300025480|Ga0208688_1034349 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1185 | Open in IMG/M |
| 3300025481|Ga0208079_1000199 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 34314 | Open in IMG/M |
| 3300025481|Ga0208079_1000986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 15417 | Open in IMG/M |
| 3300025481|Ga0208079_1031901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1400 | Open in IMG/M |
| 3300025482|Ga0208715_1009062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium archetypum | 2011 | Open in IMG/M |
| 3300025484|Ga0208587_1016839 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2408 | Open in IMG/M |
| 3300025496|Ga0208191_1083694 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 661 | Open in IMG/M |
| 3300025506|Ga0208937_1013296 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2117 | Open in IMG/M |
| 3300025852|Ga0209124_10200473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium SM23_61 | 788 | Open in IMG/M |
| 3300025857|Ga0209014_10066783 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1504 | Open in IMG/M |
| 3300025923|Ga0207681_11808749 | Not Available | 510 | Open in IMG/M |
| 3300026272|Ga0209913_1042845 | Not Available | 1095 | Open in IMG/M |
| 3300027502|Ga0209622_1018983 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1196 | Open in IMG/M |
| 3300027641|Ga0208827_1154784 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300027854|Ga0209517_10358105 | Not Available | 833 | Open in IMG/M |
| 3300027889|Ga0209380_10843099 | Not Available | 517 | Open in IMG/M |
| 3300027898|Ga0209067_10188854 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1105 | Open in IMG/M |
| 3300030659|Ga0316363_10165505 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium archetypum | 940 | Open in IMG/M |
| 3300031708|Ga0310686_103879356 | All Organisms → cellular organisms → Bacteria | 1624 | Open in IMG/M |
| 3300032160|Ga0311301_10164551 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3946 | Open in IMG/M |
| 3300032160|Ga0311301_10194852 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3493 | Open in IMG/M |
| 3300032160|Ga0311301_10687015 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1443 | Open in IMG/M |
| 3300032160|Ga0311301_11037984 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1077 | Open in IMG/M |
| 3300032160|Ga0311301_11434565 | Not Available | 857 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 23.01% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 18.58% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 15.04% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 11.50% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 6.19% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 6.19% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.65% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.65% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.77% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.77% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.89% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.89% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.89% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.89% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001385 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 deep-092012 | Environmental | Open in IMG/M |
| 3300001394 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210 deep-092012 | Environmental | Open in IMG/M |
| 3300001397 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 deep-072012 | Environmental | Open in IMG/M |
| 3300001402 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 deep-092012 | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005163 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMB | Environmental | Open in IMG/M |
| 3300005938 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 | Environmental | Open in IMG/M |
| 3300005947 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190 | Environmental | Open in IMG/M |
| 3300005980 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil leachate replicate DNA2013-203 | Environmental | Open in IMG/M |
| 3300006055 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006640 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11B | Environmental | Open in IMG/M |
| 3300006950 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-one | Environmental | Open in IMG/M |
| 3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
| 3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009547 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40 | Environmental | Open in IMG/M |
| 3300009552 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 | Environmental | Open in IMG/M |
| 3300009629 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100 | Environmental | Open in IMG/M |
| 3300009632 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 | Environmental | Open in IMG/M |
| 3300009639 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40 | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300014153 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaG | Environmental | Open in IMG/M |
| 3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017925 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40 | Environmental | Open in IMG/M |
| 3300017929 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100 | Environmental | Open in IMG/M |
| 3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
| 3300017941 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300017996 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_40 | Environmental | Open in IMG/M |
| 3300018008 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40 | Environmental | Open in IMG/M |
| 3300018014 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40 | Environmental | Open in IMG/M |
| 3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
| 3300018025 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100 | Environmental | Open in IMG/M |
| 3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300023088 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 30-34 | Environmental | Open in IMG/M |
| 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Host-Associated | Open in IMG/M |
| 3300025322 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025453 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025457 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025480 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025481 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025482 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025484 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025496 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025506 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025852 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-22A (SPAdes) | Environmental | Open in IMG/M |
| 3300025857 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-212 (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026272 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil leachate replicate DNA2013-203 (SPAdes) | Environmental | Open in IMG/M |
| 3300027502 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI20193J14888_10007931 | 3300001385 | Arctic Peat Soil | HTSTADRRARQKPAAMSTLQRSNRRTVAAQQFMTQ* |
| JGI20193J14888_10023181 | 3300001385 | Arctic Peat Soil | NHASTADRRARQKPAAMSMLQCSNRSTVAAQQYVTQ* |
| JGI20193J14888_10217301 | 3300001385 | Arctic Peat Soil | RNHASTADRRARQKPAAMSMLQCSNRSTVAAQKFVTQ* |
| JGI20191J14862_100038226 | 3300001394 | Arctic Peat Soil | NHTSTADRRARQKPAAMSTLQRSNRRTVAAQQFMTQ* |
| JGI20191J14862_10004131 | 3300001394 | Arctic Peat Soil | KLNRNHASTADRRARQKPAAMSMLQRSNRRTVAAQQFVTQ* |
| JGI20191J14862_10052665 | 3300001394 | Arctic Peat Soil | RNHASTADRRARQKPAAMSMLQCSNRSTVAAQQYVTQ* |
| JGI20177J14857_10118861 | 3300001397 | Arctic Peat Soil | ASTADRRARQKPAAMSMLQCSNRSTVAAQQYVTQ* |
| JGI20195J14853_10006761 | 3300001402 | Arctic Peat Soil | KLNRNHASTADRRARQKPAAMSXLQRSNRRTVAAQQFVTQ* |
| Ga0062385_101588931 | 3300004080 | Bog Forest Soil | LDRNHASTIDRRARQKPATMSVLQLCNRKTVTAHKFMTQ* |
| Ga0062389_1022061801 | 3300004092 | Bog Forest Soil | TARASHPKLDRNHASTADRRSHQNPAAMSLLQCPNRGTVTAQKFMTQ* |
| Ga0066823_101083441 | 3300005163 | Soil | ARASHPKLDRNHASTIDRRARQKPATMSVLQLCDRKALTAQKFMTQ* |
| Ga0066795_101539691 | 3300005938 | Soil | ARASHPKLNRNHASAADRRARQKPAAMPMLQRHNRRTVAAQKYVTQ* |
| Ga0066795_101724892 | 3300005938 | Soil | NSNHASTADRRARQKPAAMSMLQCSNRSTVAAQKFVTQ* |
| Ga0066794_101623472 | 3300005947 | Soil | SHPKLNRNHASTADRRARQKPAAMSMLQCSNRSTVAAQQYVTQ* |
| Ga0066798_100182371 | 3300005980 | Soil | HASTADRRARQKPAAMSMLQCSNRSTVAAQQFVTQ* |
| Ga0066798_100854841 | 3300005980 | Soil | NHTSTADRRARQKPAAMSTLQRSNRRTVAPQQFVTQ* |
| Ga0066798_101915651 | 3300005980 | Soil | LNRNHASTADRRARQKPAAMSMLQCSNRSTVAAQQYVTQ* |
| Ga0097691_10442141 | 3300006055 | Arctic Peat Soil | LNRNHASTADRRARQKPAAMSMLQCSNRSTVAAQKFVTQ* |
| Ga0075017_1008227931 | 3300006059 | Watersheds | DRNHASTADRRSHQNPAAMSLLQCPNRGTVTAQKFMTQ* |
| Ga0075014_1003280571 | 3300006174 | Watersheds | NHASTADRRSHQNPAAMSLLQCPNRGTVTAQKFMTQ* |
| Ga0075527_100412544 | 3300006640 | Arctic Peat Soil | TSTADRRARQKPAAMSMLQRSNRRTVAPQKYVTQ* |
| Ga0075524_102133412 | 3300006950 | Arctic Peat Soil | NRNHASTADRRARQKPAAMSMLQCSNRSTVAAQKFVTQ* |
| Ga0075524_103429491 | 3300006950 | Arctic Peat Soil | ASTADRRARQKPAAMSMLQCSNRSTVAAQKFVTQ* |
| Ga0066793_101671041 | 3300009029 | Prmafrost Soil | RNHTSTADRRARQKPAAMSTLQRSNRRTVAAQQFVTQ* |
| Ga0116108_10078111 | 3300009519 | Peatland | DRNHASTIDRRSRKKPAAMSLLQCSNLRTIAAQKFMTQ* |
| Ga0116218_15184481 | 3300009522 | Peatlands Soil | NHASTADRRSRKNPVAMSLLQCANRRTVAAQKFMTQ* |
| Ga0116221_13163182 | 3300009523 | Peatlands Soil | RNHASTADRRSRKKPAAMSLLQCSNLRTVAAQKFMTQ* |
| Ga0116136_10410961 | 3300009547 | Peatland | PELDRNHASTIDRRSRKKPAAMSLLQRSNLRTVAAQKFMTQ* |
| Ga0116138_10334271 | 3300009552 | Peatland | ELDRNHASTIDRRSRKKPAAMSLLQLCNRKTVTTQKFMTQ* |
| Ga0116119_10258251 | 3300009629 | Peatland | HPELDRNHASTADRRSRKKPAAMSLLQLCNRKTVTAQKFMTQ* |
| Ga0116119_10261692 | 3300009629 | Peatland | ASTIDRRSRKKPAAMSLLQCSNLRTIAAQKFMTQ* |
| Ga0116102_11130381 | 3300009632 | Peatland | LDRNHASTADRRSRKKPAAMSLLQCSNLRTVAAQKFMTQ* |
| Ga0116122_10695341 | 3300009639 | Peatland | AATARASHPELDRNHASTADRRSRKKPAAMSLLQLCNRKTVTAQKFMTQ* |
| Ga0116216_103484053 | 3300009698 | Peatlands Soil | DRNHASTADRRSRKNPVAMSLLQCANRRTVAAQKLMTQ* |
| Ga0116216_106058731 | 3300009698 | Peatlands Soil | HASTADRRSRKNPVAMSLLQCANRRTVAAQKFMTQ* |
| Ga0116217_102101051 | 3300009700 | Peatlands Soil | LDRNHASTIDRRARQKPATMPMLQLCNRKAVTAQKFMTQ* |
| Ga0116134_10608351 | 3300009764 | Peatland | LNCNHASTADRRARQKPAAMSMLQRSNHRTVATQKYVTQ* |
| Ga0116219_106083022 | 3300009824 | Peatlands Soil | AATARATHPKLDRNHASTIDRRARQKPTTMPMLQLCNRKAVMAQKFMTQ* |
| Ga0116223_103777303 | 3300009839 | Peatlands Soil | DRNHASTADRCSRKKPAAMSLLQLCNRKTVTAQKFMTQ* |
| Ga0116223_105250721 | 3300009839 | Peatlands Soil | LDRNHASTADRRARQKPAAMSMLQRCNRKTVTAQKFMTQ* |
| Ga0074044_100540531 | 3300010343 | Bog Forest Soil | KLDRNHASTIDRRARQKPTTMPMLQLCNRKAVMAQKFMTQ* |
| Ga0074044_106283811 | 3300010343 | Bog Forest Soil | LDRNHASTIDRRSRKKPAAMSLLQCSNLRTIAAQKFMTQ* |
| Ga0136449_1001260161 | 3300010379 | Peatlands Soil | HASTADRRSRKKPAAMSLLQCSNLRTVAAQKFMTQ* |
| Ga0136449_1002430981 | 3300010379 | Peatlands Soil | RASHPELDRNHASTADRRSRKNPVAMSLLQCANRRTVAAQKLMTQ* |
| Ga0136449_1003796741 | 3300010379 | Peatlands Soil | ATTRAAHPKLDRNHASTADRRARQKPAAMSMLQRCNRKTVPAQKFMTQ* |
| Ga0136449_1004821681 | 3300010379 | Peatlands Soil | LDRNHASTIDRRARQKPAAMSVLQLCNCKIVTAQKFMTQ* |
| Ga0136449_1005084061 | 3300010379 | Peatlands Soil | ASTADRRSRKNPVAMSLLQCANRRTVAAQKFMTQ* |
| Ga0136449_1008119554 | 3300010379 | Peatlands Soil | RNHASTADRRSRKNPVAMSLLQCANRRTVAAQKFMTQ* |
| Ga0136449_1010608092 | 3300010379 | Peatlands Soil | ASTADRRSRKKPAAMSLLQLCNRKTVTAQKFMTQ* |
| Ga0136449_1011545422 | 3300010379 | Peatlands Soil | ASTIDRRARQKPATMPMLQLCNRKAVTAQKFMTQ* |
| Ga0136449_1017622541 | 3300010379 | Peatlands Soil | DRNHASTADRRSRKKPAAMSLLQCSNLRTVAAQKFMTQ* |
| Ga0136449_1030092472 | 3300010379 | Peatlands Soil | DRNHASTIDRRAGQKPAAMSMLQLCNRKATTAQKFMTQ* |
| Ga0181527_14316502 | 3300014153 | Bog | ASTADRRARQKSAAMSMLQRSNHTTVATQKYVTQ* |
| Ga0181521_104393091 | 3300014158 | Bog | RNHASTADRRSRKKPAAMSLLQLCNRKTVTAQKFMTQ* |
| Ga0181523_105332291 | 3300014165 | Bog | NCNHASTADRRARQKPAAMSMLQRSNHRTVATQKYVTQ* |
| Ga0157380_129357102 | 3300014326 | Switchgrass Rhizosphere | ASTIDRRTRQKPATMSMLQFCNRKTVTARKFMTQ* |
| Ga0181536_100079921 | 3300014638 | Bog | NRNHASTADRRARQKSAAMSMLQRSNRKAAAAQKYVTQ* |
| Ga0181536_101296561 | 3300014638 | Bog | LNRNHASTADRRARQKSAAMSMLQRSNRKAAAAQKYVTQ* |
| Ga0181536_104040341 | 3300014638 | Bog | NCNHASTADRRARQKSAAMSMLQRSNHTTVATQKYVTQ* |
| Ga0181536_104266381 | 3300014638 | Bog | ASTADRRARQKSAAMSMLQRSNRKAAAAQKYVTQ* |
| Ga0187818_104533601 | 3300017823 | Freshwater Sediment | NHASTIDRRARQKPATMPMLQLCNRKAVTAQKFMTQ |
| Ga0187818_104665282 | 3300017823 | Freshwater Sediment | AATARASHPKLDRNHASTIDRRARQKPATMSVLQLCNRKTVTAQKLMTQ |
| Ga0187856_11448941 | 3300017925 | Peatland | AATARASHPELDRNHASTADRRSRKKPAAMSLLQLCNRKTVTTQKFMTQ |
| Ga0187849_12140601 | 3300017929 | Peatland | NHASTIDRRSRKKPAAMSLLQCSNLRTIAAQKFMTQ |
| Ga0187854_100438172 | 3300017938 | Peatland | DRNHASTIDRRSRKKPAAMSLLQCSNLRTIAAQKFMTQ |
| Ga0187854_102446721 | 3300017938 | Peatland | LDRNHASTADRRSRKKPAAMSLLQCSNLRTVAAQKFMTQ |
| Ga0187850_105249902 | 3300017941 | Peatland | SHPELDRNHASTADRRSRKKPAAMSLLQLCNRKTVTAQKFMTQ |
| Ga0187879_102296604 | 3300017946 | Peatland | GSAATARASHPELDRNHASTIDRRSRKKPAAMSLLQLCNRKTVTTQKFMTQ |
| Ga0187816_101678501 | 3300017995 | Freshwater Sediment | SAATARASHPKLDRNHASTIDRRARQKPATMPMLQLCNRKAVTAQKFMTQ |
| Ga0187891_10007921 | 3300017996 | Peatland | RNHASTADRRARQKPAAMSMLQRSNRKAAAAQKYVTQ |
| Ga0187891_10041291 | 3300017996 | Peatland | NRNHASTADRRARQKPAAMSMLQRSNRKAAAAQKYVTQ |
| Ga0187888_10847403 | 3300018008 | Peatland | RNHASTADRRARQKSAAMSMLQRSNRKAAAAQKYVTQ |
| Ga0187888_13375321 | 3300018008 | Peatland | PELDRYHASTIDRRSRKKPAAMSLMQRSNLRTVAAQKLMTQ |
| Ga0187860_10174725 | 3300018014 | Peatland | RNHASTIDRRSRKKPAAMSLLQCSNLRTIAAQKFMTQ |
| Ga0187872_102468801 | 3300018017 | Peatland | HASTADRRARQKPAAMSMLQRSNRKAAAAQKYVTQ |
| Ga0187885_102049791 | 3300018025 | Peatland | ATARTSYPELNRNHASTADRRARQKPAAMSMLQRSNRKAAAAQKYVTQ |
| Ga0187869_103344461 | 3300018030 | Peatland | RNHASTADRRSRKKPAAMSLLQLCNRKTVTAQKFMTQ |
| Ga0187862_103395871 | 3300018040 | Peatland | LNCNHASTADRRARQKPAAMSMLQRSNHRTVATQKYVTQ |
| Ga0187871_102118771 | 3300018042 | Peatland | NCNHASTADRRARQKPAAMSMLQRSNHRTVATQKYVTQ |
| Ga0187871_104359731 | 3300018042 | Peatland | NHASTADRRARQKPAAMSMLQRSNHRTVATQKYVTQ |
| Ga0184635_103356512 | 3300018072 | Groundwater Sediment | PKLDRNHAPTADRRARQKPAAMSMLQCSKRRTLAAHKFVTQ |
| Ga0210401_108838692 | 3300020583 | Soil | LDRNHASTADRRSRKNPVAMSLLQCANRRTVAAQKFMTQ |
| Ga0224555_10472961 | 3300023088 | Soil | KLNRNHASTTDRRARQKPAAMSMLQRSNRKAAAAQKYVTQ |
| Ga0228598_10108511 | 3300024227 | Rhizosphere | CTASHPELDRNHASTADRRSRKNPVAMSLLQCANRRTVAAQKFMTQ |
| Ga0209641_103461503 | 3300025322 | Soil | KLNRNHASTADRRARQKPAAMSMLQCSDRRTVAAQKFVTQ |
| Ga0208455_10135491 | 3300025453 | Peatland | LDRNHASTIDRRSRKKPAAMSLLQCSNLRTIAAQKFMTQ |
| Ga0208455_10612061 | 3300025453 | Peatland | RNHASTADRRSRKKPAAMSLLQCSNLRTVAAQKFMTQ |
| Ga0208850_10071301 | 3300025457 | Arctic Peat Soil | RNHASTADRRARQKPAAMSMLQCSNRSTVAAQIFVTQ |
| Ga0208850_10345441 | 3300025457 | Arctic Peat Soil | RNHASTADRRARQKPAAMSMLQCSNRSTVAAQKFVTQ |
| Ga0208688_10343492 | 3300025480 | Peatland | HASTIDRRSRKKPAAMSLLQCSNLRTIAAQKFMTQ |
| Ga0208079_100019934 | 3300025481 | Arctic Peat Soil | KLNRNHASTADRRARQKPAAMSMLQRSNRRTVAAQQFVTQ |
| Ga0208079_10009861 | 3300025481 | Arctic Peat Soil | NHASTADRRARQKPAAMSMLQCSNRSTVAAQQYVTQ |
| Ga0208079_10319011 | 3300025481 | Arctic Peat Soil | HASTADRRARQKPAAMSMLQCSNRSTVAAQQFMTQ |
| Ga0208715_10090621 | 3300025482 | Arctic Peat Soil | ATARASHPKLNRNHASTADRRARQKPAAMSMLQCSNRSTVAAQQFVTQ |
| Ga0208587_10168394 | 3300025484 | Arctic Peat Soil | NHTSTADRRARQKPAAMSTLQRSNRRTVAAQQFMTQ |
| Ga0208191_10836941 | 3300025496 | Peatland | ATARASHPELDRNHASTADRRSRKKPAAMSLLQLCNRKTVTAQKFMTQ |
| Ga0208937_10132964 | 3300025506 | Peatland | ELDRNHASTADRRSRKKPAAMSLLQCSNLRTVAAQKFMTQ |
| Ga0209124_102004733 | 3300025852 | Arctic Peat Soil | LNRNHASTADRRARQKPAAMSMLQRSNRRTVAAQNYVTQ |
| Ga0209014_100667831 | 3300025857 | Arctic Peat Soil | NRNHTSTADRRARQKPAAMSTLQRSNRRTVAAQQFVTQ |
| Ga0207681_118087492 | 3300025923 | Switchgrass Rhizosphere | LDRDHASTIDRRTRQKPATMSMLQFCNRKTVTARKFMTQ |
| Ga0209913_10428452 | 3300026272 | Soil | RNHASTADRRARQKPAAMSMLQRSNRRTVAPQKYVTQ |
| Ga0209622_10189831 | 3300027502 | Forest Soil | KLDRNHASTIDRRARQKLATMSMLQLRNRKTVTAQKFMTQ |
| Ga0208827_11547841 | 3300027641 | Peatlands Soil | PELDRNHASTADRRSRKKPAAMSLLQLCNRKTVTAQKFMTQ |
| Ga0209517_103581053 | 3300027854 | Peatlands Soil | RTSHPELDRNHASTADRRSRKKPAAMSLLQLCNRKTVTAQKFMTQ |
| Ga0209380_108430991 | 3300027889 | Soil | AATARASHPNSIATMSAIDRRARQKPTTVPMLQLCDRKAITAQKLMTQ |
| Ga0209067_101888542 | 3300027898 | Watersheds | LDRNHASTIDRRARQKPATMSVLQLCNRKTVTAQKLMTQ |
| Ga0316363_101655053 | 3300030659 | Peatlands Soil | GSAATARTSHPELDRNHASTADRRSRKKPAAMSLLQLCNRKTVTAQKFMTQ |
| Ga0310686_1038793561 | 3300031708 | Soil | DRNHASTADRRARQKPATMSVLQLCNRKAATPQKFMTQ |
| Ga0311301_101645517 | 3300032160 | Peatlands Soil | ARASHPELDRNHASTADRRSRKNPVAMSLLQCANRRTVAAQKLMTQ |
| Ga0311301_101948525 | 3300032160 | Peatlands Soil | HASTADRRSRKNPVAMSLLQCANRRTVAAQKFMTQ |
| Ga0311301_106870152 | 3300032160 | Peatlands Soil | HASTADRRSRKKPAAMSLLQLCNRKTVTAQKFMTQ |
| Ga0311301_110379842 | 3300032160 | Peatlands Soil | DRNHASTADRRSRKNPVAMSLLQCANRRTVAAQKFMTQ |
| Ga0311301_114345651 | 3300032160 | Peatlands Soil | DRNHASTADRRSRKKPAAMSLLQLCNRKTVTAQKFMTQ |
| ⦗Top⦘ |