


| Basic Information | |
|---|---|
| Family ID | F083045 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 113 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MKTKTFAGALVGSLLMATALTPVRAADMTNERALNPQREP |
| Number of Associated Samples | 92 |
| Number of Associated Scaffolds | 113 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 98.23 % |
| % of genes near scaffold ends (potentially truncated) | 98.23 % |
| % of genes from short scaffolds (< 2000 bps) | 94.69 % |
| Associated GOLD sequencing projects | 88 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (65.487 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (18.584 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.088 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (58.407 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 44.12% β-sheet: 0.00% Coil/Unstructured: 55.88% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 113 Family Scaffolds |
|---|---|---|
| PF13570 | PQQ_3 | 30.09 |
| PF13360 | PQQ_2 | 11.50 |
| PF01011 | PQQ | 7.96 |
| PF01618 | MotA_ExbB | 2.65 |
| PF03328 | HpcH_HpaI | 1.77 |
| PF00890 | FAD_binding_2 | 1.77 |
| PF14659 | Phage_int_SAM_3 | 0.88 |
| PF09084 | NMT1 | 0.88 |
| PF14294 | DUF4372 | 0.88 |
| PF04392 | ABC_sub_bind | 0.88 |
| PF01904 | DUF72 | 0.88 |
| PF03150 | CCP_MauG | 0.88 |
| PF01810 | LysE | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
|---|---|---|---|
| COG0469 | Pyruvate kinase | Carbohydrate transport and metabolism [G] | 1.77 |
| COG2301 | Citrate lyase beta subunit | Carbohydrate transport and metabolism [G] | 1.77 |
| COG3836 | 2-keto-3-deoxy-L-rhamnonate aldolase RhmA | Carbohydrate transport and metabolism [G] | 1.77 |
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.88 |
| COG1801 | Sugar isomerase-related protein YecE, UPF0759/DUF72 family | General function prediction only [R] | 0.88 |
| COG1858 | Cytochrome c peroxidase | Posttranslational modification, protein turnover, chaperones [O] | 0.88 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.88 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 65.49 % |
| Unclassified | root | N/A | 34.51 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002245|JGIcombinedJ26739_101527348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → unclassified Sneathiellales → Sneathiellales bacterium | 563 | Open in IMG/M |
| 3300004091|Ga0062387_100978029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 647 | Open in IMG/M |
| 3300004092|Ga0062389_102611594 | Not Available | 672 | Open in IMG/M |
| 3300004092|Ga0062389_103016803 | Not Available | 630 | Open in IMG/M |
| 3300004635|Ga0062388_101802931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 628 | Open in IMG/M |
| 3300005332|Ga0066388_100278233 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2316 | Open in IMG/M |
| 3300005332|Ga0066388_100880323 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1477 | Open in IMG/M |
| 3300005332|Ga0066388_108545405 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300005436|Ga0070713_101323653 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 698 | Open in IMG/M |
| 3300005439|Ga0070711_101407209 | Not Available | 607 | Open in IMG/M |
| 3300005555|Ga0066692_10509581 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Chelativorans → unclassified Chelativorans → Chelativorans sp. J32 | 765 | Open in IMG/M |
| 3300005764|Ga0066903_103028249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 910 | Open in IMG/M |
| 3300005764|Ga0066903_106816204 | Not Available | 593 | Open in IMG/M |
| 3300006057|Ga0075026_100965798 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 528 | Open in IMG/M |
| 3300006175|Ga0070712_100826508 | Not Available | 796 | Open in IMG/M |
| 3300006176|Ga0070765_100618281 | All Organisms → cellular organisms → Bacteria | 1022 | Open in IMG/M |
| 3300006176|Ga0070765_101709716 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → unclassified Sneathiellales → Sneathiellales bacterium | 591 | Open in IMG/M |
| 3300007265|Ga0099794_10431778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 690 | Open in IMG/M |
| 3300007788|Ga0099795_10070417 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae | 1318 | Open in IMG/M |
| 3300007788|Ga0099795_10290086 | Not Available | 717 | Open in IMG/M |
| 3300007788|Ga0099795_10399975 | Not Available | 624 | Open in IMG/M |
| 3300009143|Ga0099792_11136190 | Not Available | 528 | Open in IMG/M |
| 3300009521|Ga0116222_1217109 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 824 | Open in IMG/M |
| 3300009522|Ga0116218_1510403 | Not Available | 536 | Open in IMG/M |
| 3300009672|Ga0116215_1271753 | Not Available | 739 | Open in IMG/M |
| 3300009792|Ga0126374_11702718 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 524 | Open in IMG/M |
| 3300009826|Ga0123355_12198547 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila | 504 | Open in IMG/M |
| 3300010043|Ga0126380_11213844 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 651 | Open in IMG/M |
| 3300010147|Ga0126319_1603306 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Alsobacteraceae → Alsobacter → unclassified Alsobacter → Alsobacter sp. SYSU M60028 | 626 | Open in IMG/M |
| 3300010154|Ga0127503_11158385 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → unclassified Sneathiellales → Sneathiellales bacterium | 532 | Open in IMG/M |
| 3300010358|Ga0126370_10148635 | Not Available | 1704 | Open in IMG/M |
| 3300010358|Ga0126370_10323941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 1233 | Open in IMG/M |
| 3300010358|Ga0126370_11208229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 703 | Open in IMG/M |
| 3300010359|Ga0126376_10010573 | All Organisms → cellular organisms → Bacteria | 5735 | Open in IMG/M |
| 3300010359|Ga0126376_10852109 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 896 | Open in IMG/M |
| 3300010359|Ga0126376_13033478 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 519 | Open in IMG/M |
| 3300010360|Ga0126372_11882346 | Not Available | 643 | Open in IMG/M |
| 3300010361|Ga0126378_13349553 | Not Available | 509 | Open in IMG/M |
| 3300010362|Ga0126377_10596623 | Not Available | 1148 | Open in IMG/M |
| 3300010362|Ga0126377_12215899 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → unclassified Sneathiellales → Sneathiellales bacterium | 626 | Open in IMG/M |
| 3300010366|Ga0126379_10290618 | All Organisms → cellular organisms → Bacteria | 1634 | Open in IMG/M |
| 3300010379|Ga0136449_100226321 | All Organisms → cellular organisms → Bacteria | 3510 | Open in IMG/M |
| 3300010379|Ga0136449_101052839 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1302 | Open in IMG/M |
| 3300011269|Ga0137392_11160395 | Not Available | 630 | Open in IMG/M |
| 3300011269|Ga0137392_11326454 | Not Available | 579 | Open in IMG/M |
| 3300012096|Ga0137389_11056824 | Not Available | 696 | Open in IMG/M |
| 3300012203|Ga0137399_10681790 | Not Available | 865 | Open in IMG/M |
| 3300012210|Ga0137378_11394526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 614 | Open in IMG/M |
| 3300012361|Ga0137360_11690383 | Not Available | 538 | Open in IMG/M |
| 3300012923|Ga0137359_11067617 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 691 | Open in IMG/M |
| 3300012925|Ga0137419_11908149 | Not Available | 510 | Open in IMG/M |
| 3300012927|Ga0137416_10279819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1375 | Open in IMG/M |
| 3300012944|Ga0137410_10915533 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300012948|Ga0126375_12029299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → unclassified Sneathiellales → Sneathiellales bacterium | 509 | Open in IMG/M |
| 3300012971|Ga0126369_10120547 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes | 2415 | Open in IMG/M |
| 3300014164|Ga0181532_10321232 | Not Available | 873 | Open in IMG/M |
| 3300014657|Ga0181522_10683690 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 626 | Open in IMG/M |
| 3300016294|Ga0182041_11941556 | Not Available | 547 | Open in IMG/M |
| 3300016357|Ga0182032_11789492 | Not Available | 537 | Open in IMG/M |
| 3300016387|Ga0182040_10528657 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 946 | Open in IMG/M |
| 3300016404|Ga0182037_11529233 | Not Available | 592 | Open in IMG/M |
| 3300017970|Ga0187783_10907326 | Not Available | 635 | Open in IMG/M |
| 3300018060|Ga0187765_11093348 | Not Available | 553 | Open in IMG/M |
| 3300018088|Ga0187771_10600907 | Not Available | 932 | Open in IMG/M |
| 3300018088|Ga0187771_10908506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Alsobacteraceae → Alsobacter → unclassified Alsobacter → Alsobacter sp. SYSU M60028 | 747 | Open in IMG/M |
| 3300018090|Ga0187770_10254791 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1360 | Open in IMG/M |
| 3300018090|Ga0187770_10677877 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300020170|Ga0179594_10161757 | Not Available | 831 | Open in IMG/M |
| 3300021086|Ga0179596_10479160 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 630 | Open in IMG/M |
| 3300021374|Ga0213881_10105240 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1223 | Open in IMG/M |
| 3300021401|Ga0210393_11484816 | Not Available | 540 | Open in IMG/M |
| 3300021402|Ga0210385_10584723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 851 | Open in IMG/M |
| 3300021403|Ga0210397_10558083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 872 | Open in IMG/M |
| 3300021474|Ga0210390_10449238 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1088 | Open in IMG/M |
| 3300021477|Ga0210398_10677559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 835 | Open in IMG/M |
| 3300021560|Ga0126371_13938290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 500 | Open in IMG/M |
| 3300021861|Ga0213853_10243606 | Not Available | 743 | Open in IMG/M |
| 3300021861|Ga0213853_10680001 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300022527|Ga0242664_1038379 | Not Available | 835 | Open in IMG/M |
| 3300022557|Ga0212123_10406271 | Not Available | 911 | Open in IMG/M |
| 3300022722|Ga0242657_1039310 | All Organisms → cellular organisms → Bacteria | 994 | Open in IMG/M |
| 3300024288|Ga0179589_10246733 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 792 | Open in IMG/M |
| 3300025320|Ga0209171_10328445 | Not Available | 806 | Open in IMG/M |
| 3300025915|Ga0207693_10272925 | All Organisms → cellular organisms → Bacteria | 1325 | Open in IMG/M |
| 3300026320|Ga0209131_1009984 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 5901 | Open in IMG/M |
| 3300026515|Ga0257158_1006415 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1682 | Open in IMG/M |
| 3300027512|Ga0209179_1006790 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1862 | Open in IMG/M |
| 3300027671|Ga0209588_1214054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 597 | Open in IMG/M |
| 3300027846|Ga0209180_10633116 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 588 | Open in IMG/M |
| 3300027854|Ga0209517_10529278 | Not Available | 637 | Open in IMG/M |
| 3300027884|Ga0209275_10420359 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 756 | Open in IMG/M |
| 3300027905|Ga0209415_10234634 | All Organisms → cellular organisms → Bacteria | 1675 | Open in IMG/M |
| 3300027908|Ga0209006_10196900 | All Organisms → cellular organisms → Bacteria | 1751 | Open in IMG/M |
| 3300027910|Ga0209583_10734168 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → unclassified Sneathiellales → Sneathiellales bacterium | 518 | Open in IMG/M |
| 3300027911|Ga0209698_10456208 | Not Available | 994 | Open in IMG/M |
| 3300027911|Ga0209698_10894355 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 666 | Open in IMG/M |
| 3300029701|Ga0222748_1075252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 621 | Open in IMG/M |
| 3300030617|Ga0311356_11920781 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300031093|Ga0308197_10413555 | Not Available | 531 | Open in IMG/M |
| 3300031521|Ga0311364_12505270 | Not Available | 502 | Open in IMG/M |
| 3300031708|Ga0310686_106346608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 534 | Open in IMG/M |
| 3300031708|Ga0310686_113924031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 554 | Open in IMG/M |
| 3300031751|Ga0318494_10834908 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → unclassified Sneathiellales → Sneathiellales bacterium | 540 | Open in IMG/M |
| 3300031782|Ga0318552_10324399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 784 | Open in IMG/M |
| 3300031823|Ga0307478_10444798 | Not Available | 1077 | Open in IMG/M |
| 3300031893|Ga0318536_10239229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 923 | Open in IMG/M |
| 3300031897|Ga0318520_10933027 | Not Available | 547 | Open in IMG/M |
| 3300031910|Ga0306923_11717312 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Alsobacteraceae → Alsobacter → unclassified Alsobacter → Alsobacter sp. SYSU M60028 | 648 | Open in IMG/M |
| 3300031910|Ga0306923_12197463 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300031912|Ga0306921_10339495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1757 | Open in IMG/M |
| 3300032205|Ga0307472_100078765 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 2182 | Open in IMG/M |
| 3300032205|Ga0307472_100172396 | All Organisms → cellular organisms → Bacteria | 1610 | Open in IMG/M |
| 3300033289|Ga0310914_10826940 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 18.58% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 14.16% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.39% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 6.19% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.19% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.31% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.42% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.54% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.54% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.65% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.65% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.65% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 1.77% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.77% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 1.77% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.77% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.89% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.89% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.89% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.89% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.89% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010147 | Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022527 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025320 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026515 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-A | Environmental | Open in IMG/M |
| 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300029701 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031521 | III_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ26739_1015273482 | 3300002245 | Forest Soil | MTTKSFAGAWVVSLLMATALTPAGAADMSNERALNPQREPQNWIL |
| Ga0062387_1009780292 | 3300004091 | Bog Forest Soil | MRTASIAGAFAGSLLVATALTPLRAADMTTERQLNPQREPQNWIL |
| Ga0062389_1026115941 | 3300004092 | Bog Forest Soil | MTTKALAIAFTSSLLLTTALTPVGAADMTNERALNPQREP |
| Ga0062389_1030168031 | 3300004092 | Bog Forest Soil | MKTSSLAGTFISSLLVATVLTPVGAADMTNERALNPQREPQN |
| Ga0062388_1018029311 | 3300004635 | Bog Forest Soil | MRTASIAGACAGSLLMATALTPLRAADMTTERLLNPQREP |
| Ga0066388_1002782335 | 3300005332 | Tropical Forest Soil | MKTTTFAGALVGSFLMCTALTPARAADVTNERLLNPQREPQNW |
| Ga0066388_1008803231 | 3300005332 | Tropical Forest Soil | MVAKSFAGALAGSLLIATALTPVRAADMTNERALNPQREP |
| Ga0066388_1085454052 | 3300005332 | Tropical Forest Soil | MSAKSVMGTIAGVLLMATALSPARGADVTNERLLNPQREPQN |
| Ga0070713_1013236531 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MMTAKSLAAAFAGSLMMATALTPASAADMTNERLLNPQRE |
| Ga0070711_1014072091 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MRTETFAGALVGSFLMCTALTPARAADVTNERLLNPQREPQNWILH |
| Ga0066692_105095812 | 3300005555 | Soil | MNTKSVMGNVIGALLMATALTPARAADMTNERLLNPQREPQNWIL |
| Ga0066903_1030282491 | 3300005764 | Tropical Forest Soil | MRTSGAFIISLLVASALTPVRAADMTNERALNPQREPQNW |
| Ga0066903_1068162042 | 3300005764 | Tropical Forest Soil | MIAKCLTGAFVGSLLMATALTPARAADVTNERLVN |
| Ga0075026_1009657982 | 3300006057 | Watersheds | MNVKSVIGALVGSLLMATALTPVRAADMTNERLLN |
| Ga0070712_1008265081 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MTTKLPAVALTSSLLMATALASACAADMTQERALN |
| Ga0070765_1006182811 | 3300006176 | Soil | MTTVTFPRLLTGALLMATALTPVPMTAFAADMTMERALNPQREPQNW |
| Ga0070765_1017097161 | 3300006176 | Soil | MNTKTFVGAFIASLLVATALTPARAAEMTNDRALNPQREPQ |
| Ga0099794_104317781 | 3300007265 | Vadose Zone Soil | MGNAVGALLIATALTPVRAADVTNDRLLNPQREPQNWILHH |
| Ga0099795_100704171 | 3300007788 | Vadose Zone Soil | MMAKSFTGAFVGSLLMTTALTSARAADMTNERALNPQREPQNW |
| Ga0099795_102900862 | 3300007788 | Vadose Zone Soil | MTRTSVTGTFIGVLLMATALTPARAADMTNERALN |
| Ga0099795_103999752 | 3300007788 | Vadose Zone Soil | MTRISVTGTFIGALLMATALTPARAADMTNERALNPQ |
| Ga0099792_111361902 | 3300009143 | Vadose Zone Soil | MTRISVTGTFIGVLLMATALTPARAADMTNERALNPQREPQNWI |
| Ga0116222_12171092 | 3300009521 | Peatlands Soil | MRTKSILGALAGAFFVATALTPVRAADMTADRALNPQREPQNW |
| Ga0116218_15104031 | 3300009522 | Peatlands Soil | MTRTSVTCTFVGVLLMATALTPARAADMTNDRALNPQR* |
| Ga0116215_12717532 | 3300009672 | Peatlands Soil | MPTKSLFAAFIGSLLLATALTPVGAADVTNERLLNPQREPQNW |
| Ga0126374_117027182 | 3300009792 | Tropical Forest Soil | MTRVSVTGTLIGALLMATALTPARAADMTNERALNPQREP |
| Ga0123355_121985471 | 3300009826 | Termite Gut | MNAKSVIGTIAGALLIATALSPARAADVTNERLLNPQREPQNWI |
| Ga0126380_112138442 | 3300010043 | Tropical Forest Soil | MNTKCMIGAFAGSLLFTTALIPARAADMTNERALNPQREP |
| Ga0126319_16033061 | 3300010147 | Soil | MNAKTLGGAFVASLLVATALTPARAADMTNDRALN |
| Ga0127503_111583852 | 3300010154 | Soil | VKEKAMTIRSLARAFAGSLMMATALTPAVAADMTNERAL |
| Ga0126370_101486351 | 3300010358 | Tropical Forest Soil | MKTMFIIGPLMGSLLLATALSPARAADVTNERLLNP |
| Ga0126370_103239412 | 3300010358 | Tropical Forest Soil | MRTNFFAGAATGALLVATALMPVHAADMTNERALNPQREP |
| Ga0126370_112082292 | 3300010358 | Tropical Forest Soil | MAIKSFSGALFGSLLVATALTPGRAADMTNERALNPQREPQNWI |
| Ga0126376_100105737 | 3300010359 | Tropical Forest Soil | MTRISVAGTFIGALLMATALTPARAADMTDDRALNPQREPQNWI |
| Ga0126376_108521091 | 3300010359 | Tropical Forest Soil | MKTKLLAVAFTGSLLIATALTPVRAADMTNERALNPQR |
| Ga0126376_130334781 | 3300010359 | Tropical Forest Soil | MTTQSLVGTFFGSVLLATALTPVRAADMTNDRALNPQR |
| Ga0126372_118823462 | 3300010360 | Tropical Forest Soil | MSAKSFAGVLTGSLLMATALTPVRAADMSNERALNPQRE |
| Ga0126378_133495531 | 3300010361 | Tropical Forest Soil | MASISVRSTFIGALLMASALTPVRAADMSYERALNP |
| Ga0126377_105966231 | 3300010362 | Tropical Forest Soil | MIAKSLTGALVGSLLVATALTPARAADMTNERALNPQREPQNWI |
| Ga0126377_122158992 | 3300010362 | Tropical Forest Soil | MVAKSFAGALAGSLLIATALTPVRAADMTNERALNPQR |
| Ga0126379_102906182 | 3300010366 | Tropical Forest Soil | MKTKAFAGALVGSFLLSTTLTPLRAADVTNDRLDP* |
| Ga0136449_1002263214 | 3300010379 | Peatlands Soil | MNSKSVAGAMAGALLMATALTPARAADMTNDRALN |
| Ga0136449_1010528391 | 3300010379 | Peatlands Soil | MRTSSVAGAFIASLLVATTLKPVNAADMTTERALNPQREPQNW |
| Ga0137392_111603951 | 3300011269 | Vadose Zone Soil | MTTKLIAGAFTSLLLMATALTPAGAADMTQERALNPQ |
| Ga0137392_113264541 | 3300011269 | Vadose Zone Soil | MMAKSLTGAFVGSLLITTALTSARAADMTNERALNPQ |
| Ga0137389_110568242 | 3300012096 | Vadose Zone Soil | MKTKTFAGALVGSLLMATALTPVRAADMTNERALNPQREP |
| Ga0137399_106817902 | 3300012203 | Vadose Zone Soil | MAMKSFTSALFGSLLMATALTPARAADMTNERALN |
| Ga0137378_113945262 | 3300012210 | Vadose Zone Soil | MTTKSVACTFIGVLLMATALTPVRAADMTNDRALNPQREPQNWI |
| Ga0137360_116903832 | 3300012361 | Vadose Zone Soil | MMAKSFTGAFVGSLLITTALTSARAADMTNERALNPQR |
| Ga0137359_110676172 | 3300012923 | Vadose Zone Soil | MTTRVLSIAFASSLMMATALSPARAADMTFERALN |
| Ga0137419_119081491 | 3300012925 | Vadose Zone Soil | MTRISVTGVFIGMLLMATALTPARAADMTNERALNPQREPQ |
| Ga0137416_102798192 | 3300012927 | Vadose Zone Soil | MKTKAFAGALVGSLLMATALTPARAADMTNERALNPQ |
| Ga0137410_109155332 | 3300012944 | Vadose Zone Soil | MKTKTLAGALVGSFLLSTALTPSRAADVTNERLLNPQREPQN |
| Ga0126375_120292992 | 3300012948 | Tropical Forest Soil | MSAKSFAGVFVGSLLIATALTPVRAADMSNDRALNPQ |
| Ga0126369_101205474 | 3300012971 | Tropical Forest Soil | MTKLTVTGAFFGSLLMATALTPARAADMTNERALNPQR |
| Ga0181532_103212321 | 3300014164 | Bog | MTPNTFAAAIATSLLMATALTPASAADMTAERALNPQ |
| Ga0181522_106836901 | 3300014657 | Bog | MNASARAGALLGSLLLATALTPLRAADMSFDRALNTGKEPQNWI |
| Ga0182041_119415562 | 3300016294 | Soil | MRMSFATAFIGSLMAASAFAPAGAADMTNERALNPQREPQ |
| Ga0182032_117894921 | 3300016357 | Soil | MTIKSVAGAFIGTLMAATALSPAGAADMTNERALN |
| Ga0182040_105286571 | 3300016387 | Soil | MTRISVAGTFIGALLMATALTPARAADMTDDRALNPQREPQNW |
| Ga0182037_115292332 | 3300016404 | Soil | MTIKSVAAGVGAFIGSLMAATALTPAGAADMTNERTLNPQREP |
| Ga0187783_109073262 | 3300017970 | Tropical Peatland | MRTKFFAGAVTAALLTATALTPVDAGDMTNDRALNPQRE |
| Ga0187765_110933481 | 3300018060 | Tropical Peatland | MRTETFAGALVGSFLMCTALTPARAADVTNERLLNPQREPQ |
| Ga0187771_106009071 | 3300018088 | Tropical Peatland | MAAKSFAGAVAGTLLMAAALTLLPVSWAGAADVTNERLLNPQRE |
| Ga0187771_109085062 | 3300018088 | Tropical Peatland | MAAKPFAGAIAGSLLMATALTSLPVSWAGAADVTNERLLNPQREPQNWIL |
| Ga0187770_102547911 | 3300018090 | Tropical Peatland | MRTETFAGALVGSFLMCTALTPARAADVTNERLLNPQREPQNWI |
| Ga0187770_106778771 | 3300018090 | Tropical Peatland | REIMTVKSLAAALAGSLLTATALTSAYAADVTNDRLLNPQREPQNWILTTATTRATASRC |
| Ga0179594_101617571 | 3300020170 | Vadose Zone Soil | MKTKTFGGALVGSLLMATALTPARAADMTNERALNPQREPQNWI |
| Ga0179596_104791601 | 3300021086 | Vadose Zone Soil | MAMKSFTSTLFGSLLMATALTPARAADMTNDRALN |
| Ga0213881_101052403 | 3300021374 | Exposed Rock | MKTATAVGALMSSLLVATALTPANAADMTNERMLN |
| Ga0210393_114848162 | 3300021401 | Soil | MNSKSVAGVMACALLAATAMTPARAADMTNERALNPQRE |
| Ga0210385_105847232 | 3300021402 | Soil | MRPRTYAFIGSLLLATALTSVQAADMTTERALNPQREPQNWL |
| Ga0210397_105580831 | 3300021403 | Soil | MRTSSLAGAFIISLFVASALTPVRAADMTNERALN |
| Ga0210390_104492383 | 3300021474 | Soil | MRNTAIAVASAASLLIATALTPARGADMTPERALNPQREPQ |
| Ga0210398_106775591 | 3300021477 | Soil | MTTRSVTGTVLGALLIATALTPACAADMTNDRALNPQREPQ |
| Ga0126371_139382902 | 3300021560 | Tropical Forest Soil | MTKLSVTGTFFGALLMATALTPAYAADMTNERALNPQR |
| Ga0213853_102436062 | 3300021861 | Watersheds | MSTKLFAGALAGSLLMATALTPVGAADMNTERALNPQREPQNWIL |
| Ga0213853_106800012 | 3300021861 | Watersheds | MRRLSLTGTLMGALLAATAITPTRAADMTDERALNPQREPQNWIL |
| Ga0242664_10383792 | 3300022527 | Soil | MIARSVSGAFVGSLLITSVLTPACGADITNERLLNPQRE |
| Ga0212123_104062711 | 3300022557 | Iron-Sulfur Acid Spring | MSRQSFVGALAGSLLMATSLTPVGAADVTNERMLNPQREPQNWILHH |
| Ga0242657_10393102 | 3300022722 | Soil | MKARTFAGALVSSFLMSTALTPARAADMTDERTLNSQREPQNWI |
| Ga0179589_102467331 | 3300024288 | Vadose Zone Soil | MTRISVTGTFIGALLMATALTPARAADMTNERALNPQREPQNW |
| Ga0209171_103284452 | 3300025320 | Iron-Sulfur Acid Spring | MSRQSFVGALAGSLLMATSLTPVGAADVTNERMLNPQREPQN |
| Ga0207693_102729252 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MTTKLPAVALTSSLLMATALASACAADMTQERALNPQR |
| Ga0209131_10099847 | 3300026320 | Grasslands Soil | MTRISVTGTFIGALLMATALTPARAADMTNERALN |
| Ga0257158_10064153 | 3300026515 | Soil | MTRISVTGTFIGALLIASALTPVRGADMTNERALN |
| Ga0209179_10067903 | 3300027512 | Vadose Zone Soil | MTRTSVTGTFIGVLLMATALTPARAADMTNERALNPQR |
| Ga0209588_12140541 | 3300027671 | Vadose Zone Soil | MNTKSVMGNAVGALLIATALTPVRAADVTNDRLLNPQREPQNWILHH |
| Ga0209180_106331161 | 3300027846 | Vadose Zone Soil | MNAKSFMGTIAGALLMATALTPVRAADVTNDRLLNPQRE |
| Ga0209517_105292781 | 3300027854 | Peatlands Soil | MTKSFVGILIGSLMVATALTPVVAADMTNDRALNPQREPQ |
| Ga0209275_104203592 | 3300027884 | Soil | MRNTAIAVASAASLLIATALTPARGADMTPERALNPQREPQNW |
| Ga0209415_102346342 | 3300027905 | Peatlands Soil | MTTKSFAGAFIGSLMMATALTPVGAADMTNERALNP |
| Ga0209006_101969001 | 3300027908 | Forest Soil | MTTKLVAVAFTSSLLMATALTPLRAADMTNERALN |
| Ga0209583_107341682 | 3300027910 | Watersheds | MTRKSLAGAFVGSLLTATALTPAGAADVTNERLLN |
| Ga0209698_104562082 | 3300027911 | Watersheds | MTTKSLAGAFVGSLLMASALTPVRAADMTNERALN |
| Ga0209698_108943551 | 3300027911 | Watersheds | MTTKLIAGAFTSALLVATALTPVGAADMTQERALNPQREPQN |
| Ga0222748_10752521 | 3300029701 | Soil | MTTKCFTGAFVGSLLMATALTPARAADVTNERLLN |
| Ga0311356_119207812 | 3300030617 | Palsa | MRTKSLAGAIAGSLLVATSLTPARAADMTNERLLNPQ |
| Ga0308197_104135552 | 3300031093 | Soil | MSTKLSLAGAMGALLMATALTPAGAADMTFERSLN |
| Ga0311364_125052701 | 3300031521 | Fen | MTTKLLAVAFTSSLLIATALTPVRAADMTNERALN |
| Ga0310686_1063466082 | 3300031708 | Soil | MTTKFFSGAIVCLLAATALTPVMAADMTPERALNPQREPQNWILH |
| Ga0310686_1139240311 | 3300031708 | Soil | MTKTLAGAFVGSLLMATALTPVGAADMTNERLLNPQREPQNWI |
| Ga0318494_108349081 | 3300031751 | Soil | MSTKSLAGAFAGSLLMATALMPLRAADMTPERALNPQREPQNW |
| Ga0318552_103243992 | 3300031782 | Soil | MRSASIAGAFAGSLLVTTALTPLHAADVTTDRLLNPQREPQNWI |
| Ga0307478_104447982 | 3300031823 | Hardwood Forest Soil | MTAKSLGSFAGALLMATVLTPARAADMTNDRLLNPQREPQNWI |
| Ga0318536_102392292 | 3300031893 | Soil | MRTASIAGAFAGSLLVTTALTPLHAADVTTERLLN |
| Ga0318520_109330272 | 3300031897 | Soil | MTISRRSSFIGTTITMLLVASALTPVRAADMTYER |
| Ga0306923_117173122 | 3300031910 | Soil | MTISRRSSFIGTTITMLLVASALTPVRAADMTYERALNV |
| Ga0306923_121974631 | 3300031910 | Soil | MKTKTFAGALVSSFLMAKAFTSAHAADVTNERLLNPQREPQNWI |
| Ga0306921_103394951 | 3300031912 | Soil | MNIKSMIGAFAGSLLIATALTPVRAADVTNDRLLNP |
| Ga0307472_1000787651 | 3300032205 | Hardwood Forest Soil | MKTMFIIGTLMGSLLLATALSPARAADVTNERLLN |
| Ga0307472_1001723961 | 3300032205 | Hardwood Forest Soil | MKTKTFAGALVGSLLIVTALTPVGAADMSNDRALN |
| Ga0310914_108269401 | 3300033289 | Soil | MTTRMHRLVFTTGLLITTALTPASAADMTTERALNPQREPQ |
| ⦗Top⦘ |