


| Basic Information | |
|---|---|
| Family ID | F083015 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 113 |
| Average Sequence Length | 46 residues |
| Representative Sequence | RSFRGSWMGFAYCDFTRRMSVAGMSTRRHSSQPLSLEAAETSGAN |
| Number of Associated Samples | 89 |
| Number of Associated Scaffolds | 113 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.23 % |
| % of genes from short scaffolds (< 2000 bps) | 89.38 % |
| Associated GOLD sequencing projects | 85 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.460 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (26.549 % of family members) |
| Environment Ontology (ENVO) | Unclassified (37.168 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.327 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.67% β-sheet: 0.00% Coil/Unstructured: 53.33% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 113 Family Scaffolds |
|---|---|---|
| PF03401 | TctC | 46.90 |
| PF07813 | LTXXQ | 1.77 |
| PF04392 | ABC_sub_bind | 1.77 |
| PF03734 | YkuD | 1.77 |
| PF07731 | Cu-oxidase_2 | 0.88 |
| PF03572 | Peptidase_S41 | 0.88 |
| PF00881 | Nitroreductase | 0.88 |
| PF00497 | SBP_bac_3 | 0.88 |
| PF00196 | GerE | 0.88 |
| PF01494 | FAD_binding_3 | 0.88 |
| PF11391 | DUF2798 | 0.88 |
| PF00743 | FMO-like | 0.88 |
| PF04191 | PEMT | 0.88 |
| PF01068 | DNA_ligase_A_M | 0.88 |
| PF09539 | DUF2385 | 0.88 |
| PF01527 | HTH_Tnp_1 | 0.88 |
| PF04542 | Sigma70_r2 | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
|---|---|---|---|
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 46.90 |
| COG3678 | Periplasmic chaperone Spy, Spy/CpxP family | Posttranslational modification, protein turnover, chaperones [O] | 7.08 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.77 |
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 1.77 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 1.77 |
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 1.77 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.88 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.88 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.88 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.88 |
| COG0793 | C-terminal processing protease CtpA/Prc, contains a PDZ domain | Posttranslational modification, protein turnover, chaperones [O] | 0.88 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.88 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.88 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.88 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.88 |
| COG2072 | Predicted flavoprotein CzcO associated with the cation diffusion facilitator CzcD | Inorganic ion transport and metabolism [P] | 0.88 |
| COG2132 | Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) | Cell cycle control, cell division, chromosome partitioning [D] | 0.88 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.46 % |
| Unclassified | root | N/A | 3.54 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000363|ICChiseqgaiiFebDRAFT_11103844 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 720 | Open in IMG/M |
| 3300002917|JGI25616J43925_10043778 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1955 | Open in IMG/M |
| 3300002917|JGI25616J43925_10362906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 535 | Open in IMG/M |
| 3300004267|Ga0066396_10001229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2219 | Open in IMG/M |
| 3300004268|Ga0066398_10158357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 573 | Open in IMG/M |
| 3300005181|Ga0066678_10241451 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1166 | Open in IMG/M |
| 3300005332|Ga0066388_100409603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2000 | Open in IMG/M |
| 3300005332|Ga0066388_100702230 | All Organisms → cellular organisms → Bacteria | 1618 | Open in IMG/M |
| 3300005332|Ga0066388_103821489 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 768 | Open in IMG/M |
| 3300005332|Ga0066388_104770255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 690 | Open in IMG/M |
| 3300005363|Ga0008090_15495722 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 560 | Open in IMG/M |
| 3300005365|Ga0070688_101550601 | Not Available | 540 | Open in IMG/M |
| 3300005437|Ga0070710_11405370 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 522 | Open in IMG/M |
| 3300005440|Ga0070705_100610408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 845 | Open in IMG/M |
| 3300005471|Ga0070698_100234441 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia | 1768 | Open in IMG/M |
| 3300005518|Ga0070699_101944540 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 538 | Open in IMG/M |
| 3300005546|Ga0070696_101097352 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 669 | Open in IMG/M |
| 3300005561|Ga0066699_10621475 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 776 | Open in IMG/M |
| 3300005598|Ga0066706_10284303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1297 | Open in IMG/M |
| 3300005713|Ga0066905_100249786 | All Organisms → cellular organisms → Bacteria | 1362 | Open in IMG/M |
| 3300005764|Ga0066903_102928289 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 925 | Open in IMG/M |
| 3300005764|Ga0066903_104656212 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 730 | Open in IMG/M |
| 3300005764|Ga0066903_108717183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 515 | Open in IMG/M |
| 3300006046|Ga0066652_100002141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 10683 | Open in IMG/M |
| 3300006175|Ga0070712_101772682 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 540 | Open in IMG/M |
| 3300006845|Ga0075421_101635822 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 699 | Open in IMG/M |
| 3300006854|Ga0075425_100045158 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4923 | Open in IMG/M |
| 3300006881|Ga0068865_101350407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 635 | Open in IMG/M |
| 3300006914|Ga0075436_100484087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 904 | Open in IMG/M |
| 3300006969|Ga0075419_10393922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 948 | Open in IMG/M |
| 3300009137|Ga0066709_100127885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3192 | Open in IMG/M |
| 3300009143|Ga0099792_10120444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1408 | Open in IMG/M |
| 3300009143|Ga0099792_11000667 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 558 | Open in IMG/M |
| 3300009792|Ga0126374_10071377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1859 | Open in IMG/M |
| 3300009792|Ga0126374_11372523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 574 | Open in IMG/M |
| 3300010359|Ga0126376_11542397 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 694 | Open in IMG/M |
| 3300010366|Ga0126379_10763680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1064 | Open in IMG/M |
| 3300010366|Ga0126379_11666916 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 742 | Open in IMG/M |
| 3300010366|Ga0126379_11968256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 687 | Open in IMG/M |
| 3300010371|Ga0134125_13137047 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 500 | Open in IMG/M |
| 3300010376|Ga0126381_102871914 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales | 686 | Open in IMG/M |
| 3300010376|Ga0126381_103846427 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 586 | Open in IMG/M |
| 3300010376|Ga0126381_104780454 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 521 | Open in IMG/M |
| 3300010398|Ga0126383_11793260 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 702 | Open in IMG/M |
| 3300010398|Ga0126383_13436291 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 517 | Open in IMG/M |
| 3300012180|Ga0153974_1150699 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 546 | Open in IMG/M |
| 3300012208|Ga0137376_10455769 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1110 | Open in IMG/M |
| 3300012210|Ga0137378_10436885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1213 | Open in IMG/M |
| 3300012211|Ga0137377_10463057 | Not Available | 1206 | Open in IMG/M |
| 3300012211|Ga0137377_11063609 | Not Available | 739 | Open in IMG/M |
| 3300012212|Ga0150985_112207335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 641 | Open in IMG/M |
| 3300012350|Ga0137372_10077003 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2850 | Open in IMG/M |
| 3300012582|Ga0137358_10111973 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1851 | Open in IMG/M |
| 3300012582|Ga0137358_10153887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1566 | Open in IMG/M |
| 3300012917|Ga0137395_10608782 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 790 | Open in IMG/M |
| 3300012961|Ga0164302_11516557 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 553 | Open in IMG/M |
| 3300012976|Ga0134076_10268112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 732 | Open in IMG/M |
| 3300016270|Ga0182036_10497352 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 965 | Open in IMG/M |
| 3300016294|Ga0182041_11811528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 566 | Open in IMG/M |
| 3300016357|Ga0182032_10048993 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2727 | Open in IMG/M |
| 3300016357|Ga0182032_12035495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 504 | Open in IMG/M |
| 3300016387|Ga0182040_10147118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1674 | Open in IMG/M |
| 3300016387|Ga0182040_11109173 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 663 | Open in IMG/M |
| 3300016387|Ga0182040_11519547 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 569 | Open in IMG/M |
| 3300016404|Ga0182037_10687711 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 875 | Open in IMG/M |
| 3300018468|Ga0066662_11674708 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 665 | Open in IMG/M |
| 3300021178|Ga0210408_11049538 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 629 | Open in IMG/M |
| 3300021478|Ga0210402_10779342 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 881 | Open in IMG/M |
| 3300021560|Ga0126371_11737363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 747 | Open in IMG/M |
| 3300025915|Ga0207693_11334157 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 535 | Open in IMG/M |
| 3300025929|Ga0207664_11809999 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 533 | Open in IMG/M |
| 3300026310|Ga0209239_1174179 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 820 | Open in IMG/M |
| 3300026319|Ga0209647_1105904 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1329 | Open in IMG/M |
| 3300026508|Ga0257161_1088293 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 642 | Open in IMG/M |
| 3300026551|Ga0209648_10063099 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 3137 | Open in IMG/M |
| 3300026551|Ga0209648_10627873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 589 | Open in IMG/M |
| 3300027880|Ga0209481_10566812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 588 | Open in IMG/M |
| 3300028782|Ga0307306_10027885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1325 | Open in IMG/M |
| 3300031546|Ga0318538_10146411 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1246 | Open in IMG/M |
| 3300031573|Ga0310915_10344201 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1056 | Open in IMG/M |
| 3300031681|Ga0318572_10304964 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 941 | Open in IMG/M |
| 3300031682|Ga0318560_10498187 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 660 | Open in IMG/M |
| 3300031719|Ga0306917_10676299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 811 | Open in IMG/M |
| 3300031747|Ga0318502_10021784 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3120 | Open in IMG/M |
| 3300031769|Ga0318526_10404884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 558 | Open in IMG/M |
| 3300031771|Ga0318546_10147701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1582 | Open in IMG/M |
| 3300031777|Ga0318543_10198440 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 890 | Open in IMG/M |
| 3300031782|Ga0318552_10586113 | Not Available | 569 | Open in IMG/M |
| 3300031796|Ga0318576_10622034 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 509 | Open in IMG/M |
| 3300031799|Ga0318565_10252923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 857 | Open in IMG/M |
| 3300031833|Ga0310917_11216840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 500 | Open in IMG/M |
| 3300031846|Ga0318512_10445267 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 653 | Open in IMG/M |
| 3300031879|Ga0306919_10016529 | All Organisms → cellular organisms → Bacteria | 4347 | Open in IMG/M |
| 3300031879|Ga0306919_10435064 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1008 | Open in IMG/M |
| 3300031879|Ga0306919_10829731 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 710 | Open in IMG/M |
| 3300031896|Ga0318551_10387029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 794 | Open in IMG/M |
| 3300031897|Ga0318520_10406378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 833 | Open in IMG/M |
| 3300031912|Ga0306921_12414935 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 548 | Open in IMG/M |
| 3300031942|Ga0310916_11593464 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 530 | Open in IMG/M |
| 3300031946|Ga0310910_10042593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3161 | Open in IMG/M |
| 3300031946|Ga0310910_11181259 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 594 | Open in IMG/M |
| 3300031981|Ga0318531_10471576 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 568 | Open in IMG/M |
| 3300032010|Ga0318569_10618637 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 504 | Open in IMG/M |
| 3300032039|Ga0318559_10397438 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 642 | Open in IMG/M |
| 3300032059|Ga0318533_11136257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 572 | Open in IMG/M |
| 3300032060|Ga0318505_10149946 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1080 | Open in IMG/M |
| 3300032066|Ga0318514_10357106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 774 | Open in IMG/M |
| 3300032091|Ga0318577_10605544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 520 | Open in IMG/M |
| 3300032094|Ga0318540_10255828 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 845 | Open in IMG/M |
| 3300032094|Ga0318540_10594065 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 533 | Open in IMG/M |
| 3300032174|Ga0307470_10864839 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 707 | Open in IMG/M |
| 3300032261|Ga0306920_100066800 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5262 | Open in IMG/M |
| 3300032261|Ga0306920_103901397 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 543 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 26.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.27% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 10.62% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.85% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 8.85% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 7.08% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.19% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.42% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.77% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.89% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.89% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.89% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.89% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.89% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.89% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300004267 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio | Environmental | Open in IMG/M |
| 3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012180 | Attine ant fungus gardens microbial communities from Georgia, USA - TSGA058 MetaG | Host-Associated | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026508 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-A | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028782 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICChiseqgaiiFebDRAFT_111038442 | 3300000363 | Soil | KLNERSFRGSWMGFAYCDFTRRMSVAGVSPHRHSSEPLPLEARDGEGSN* |
| JGI25616J43925_100437781 | 3300002917 | Grasslands Soil | SWMGFAYCDFTRRMSVAGVSTRRHSSQPLSLEAAEASDAN* |
| JGI25616J43925_103629061 | 3300002917 | Grasslands Soil | FRVEKIDERSFRGSWMGFAYCDFTRRMNVAGMSPRRHSPAPLSLDAADAAGAN* |
| Ga0066396_100012291 | 3300004267 | Tropical Forest Soil | DDRSFRGSWMGFAYCDFTRRMSVAGMSPRRHSSEPLEATEGAGPN* |
| Ga0066398_101583571 | 3300004268 | Tropical Forest Soil | LDERSFRGSWMGFAYCDFTRRMSIAGISPRRHSSQPLSLEAAETSGAD* |
| Ga0066678_102414511 | 3300005181 | Soil | DERSFRGSWMGFAYCDFTRRMSVAGMSTRRHSSQPLSLEAAEASDAN* |
| Ga0066388_1004096031 | 3300005332 | Tropical Forest Soil | GFAYCDFTRRTNIAAMSPRRHSSEPLSLESTDGADPNWPPAAK* |
| Ga0066388_1007022302 | 3300005332 | Tropical Forest Soil | EPCFRLEKLDARSFRGSWMGFAYCDFTRRMSVAGISPHRHSSEPLPLEAREGEGPN* |
| Ga0066388_1038214891 | 3300005332 | Tropical Forest Soil | EKLDERSFRGSWMGFAYCDFTRRMSVAGMSTHRHSSQPLSLEAADTSGAN* |
| Ga0066388_1047702551 | 3300005332 | Tropical Forest Soil | EKIDERSFRGSWMGFAYCNFTRRMNVAGLSPRRHAPLALEAAEAGAN* |
| Ga0008090_154957221 | 3300005363 | Tropical Rainforest Soil | KLDERSFRGSWMGFAYCDFTRRMSIAGISPRRHSSQPLSLEAAETSGAD* |
| Ga0070688_1015506012 | 3300005365 | Switchgrass Rhizosphere | CFALEKTTERSFRGSWMGFAYCDFTQRMSVAGMSPRRNSSEPLSLEAAAEPAGPN* |
| Ga0070710_114053702 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | ERSFRGSWMGFAYCDFTRRMSVAGVSTRRHSSQPLSLEAAEASDAN* |
| Ga0070705_1006104082 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | CFALEKTTERSFRGSWMGFAYCDFTQRMSVAGMNLRRNSSEPLSLEAAASSPSPSRGR* |
| Ga0070698_1002344413 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | WMGFAYCDFTRRMSVAGVSTRRHSSQPLSLEAAEETGAN* |
| Ga0070699_1019445401 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | WMGFAYCDFTRRMNVAGMSPRRHSPAPLSLDAADAAGAN* |
| Ga0070696_1010973521 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | ERSFRGSWMGFAYCDFTRRMSVAGVSTRRHSSQPLSLEAAEETGAN* |
| Ga0066699_106214751 | 3300005561 | Soil | RSFRGSWMGFAYCDFTRRMSVAGMSTRRHSSQPLSLEAAEASDAN* |
| Ga0066706_102843031 | 3300005598 | Soil | RVEKIDERSFRGSWMGFAYCDFTRRMNVAGMSPRRHSHGPLSLEASEAGAN* |
| Ga0066905_1002497861 | 3300005713 | Tropical Forest Soil | KTDDRSFRGSWMGFAYCDFTRRMSVAGMSPRRHSSEPLEATEGAGPN* |
| Ga0066903_1029282892 | 3300005764 | Tropical Forest Soil | RSFRGSWMGFAYCDFTRRMSVAGMSTHRHSSQPLSLEAAETSGAN* |
| Ga0066903_1046562123 | 3300005764 | Tropical Forest Soil | GFAYCDFTRRTNIAAMSPRRHSSEPLSLESTDGADPNWPPPAK* |
| Ga0066903_1087171831 | 3300005764 | Tropical Forest Soil | RSFRGSWMGFAYCDFTRRMSVAGMSTHRHSSQPLSLEAADTSGAN* |
| Ga0066652_10000214114 | 3300006046 | Soil | MGFAYCDFTRRMSVAGVSPHRHSSEPLPLEAREGNGPN* |
| Ga0070712_1017726821 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | LEKLNERSFRGSWMGFAYCDFTRRMSVAGVSQHRHLSEPLPLEAREGEGSN* |
| Ga0075421_1016358221 | 3300006845 | Populus Rhizosphere | ERSFRGSWMGFAYCDFTRRMSIASMSPRRHSSQPLSLEAAETSGAD* |
| Ga0075425_1000451581 | 3300006854 | Populus Rhizosphere | FRGSWMGFAYCDFTHRVSVAGMSPRRPLEAIEGAGPN* |
| Ga0068865_1013504072 | 3300006881 | Miscanthus Rhizosphere | ERSFRGSWMGFAYCDFTQRMSVAGMNSRQPLSLDAAASSPSPSRAR* |
| Ga0075436_1004840872 | 3300006914 | Populus Rhizosphere | KLDERSFRGSWMGFAYCDFTRRMSVAGMSTHRHSSQPLSLEAAEASGAN* |
| Ga0075419_103939221 | 3300006969 | Populus Rhizosphere | RSFRGSWLGFAYCDFTRRMSVAGIGPRRHSSEPLSLEATDAAGDN* |
| Ga0066709_1001278854 | 3300009137 | Grasslands Soil | MGFAYCDFTRRMSVAGMSTRRHSSQPLSLEAAEASDAN* |
| Ga0099792_101204441 | 3300009143 | Vadose Zone Soil | PCFYLEKTTERSFRGSWMGFAYCDFTQRMSVAGISPRRHSSEPLSLEAAAEPAGRN* |
| Ga0099792_110006672 | 3300009143 | Vadose Zone Soil | TTERSFRGSWMGFAYCDFTQRMSVAGMSPRRHSSEPLSLEAAAEPAGPN* |
| Ga0126374_100713771 | 3300009792 | Tropical Forest Soil | RGSWMGFAYCDVTRRVSVAGMSTHRHSSQPLSLEAAEAGGAN* |
| Ga0126374_113725231 | 3300009792 | Tropical Forest Soil | MGFAYCDFTRRTNIADMSPRRHSSEPMSLESTDGAAPN* |
| Ga0126376_115423971 | 3300010359 | Tropical Forest Soil | ERSFRGSWMGFAYCDFTRRMSVAGVSTRRHSSQPLSLEAAETSGAN* |
| Ga0126379_107636803 | 3300010366 | Tropical Forest Soil | ERSFRGSWMGFAYCDFTRRMSIAGISPRRHSSQPLSLEAAETSGAD* |
| Ga0126379_116669163 | 3300010366 | Tropical Forest Soil | HLEKLDERSFRGSWMGFAYCDFTRRVSIAGMSPRRHSSQPLSLDAAEATGAD* |
| Ga0126379_119682561 | 3300010366 | Tropical Forest Soil | SFRGSWMGFAYCDFTRRTNIADMSPRRYSSEPLSFESTDGAAPN* |
| Ga0134125_131370471 | 3300010371 | Terrestrial Soil | NERSFRGSWMGFAYCDFTRRMSVAGVSPHRYSSEPLPLEARDGEGSN* |
| Ga0126381_1028719141 | 3300010376 | Tropical Forest Soil | SFRGSWMGFAYCDFTRRTNIADMSPRRHSSEPLSLESTDGAAPN* |
| Ga0126381_1038464271 | 3300010376 | Tropical Forest Soil | MGFAYCDFTRRMSVAGMSPRWHSSEPLEATEAAGPN* |
| Ga0126381_1047804541 | 3300010376 | Tropical Forest Soil | ERSFRGSWMGFAYCDFTRRMSVAGMSTHRHSSQPLSLEAADTSGAN* |
| Ga0126383_117932602 | 3300010398 | Tropical Forest Soil | DERSFRGSWMGFAYCDFTRRVSIAGMSPRRHSSHPLSLDAAEATGAD* |
| Ga0126383_134362912 | 3300010398 | Tropical Forest Soil | DERSFRGSWMGFAYCDFTRRVSIAGMSPRRHSSQPLSLDAAEATGAD* |
| Ga0153974_11506992 | 3300012180 | Attine Ant Fungus Gardens | LDERSFRGSWMGFAYCDFTRRMSVAGMSTRRHSSQPLSLEAAEETGAN* |
| Ga0137376_104557692 | 3300012208 | Vadose Zone Soil | MGFAYCDFTQRMSVAGMSPRRHSSEPLSLEAAAEPAGPN* |
| Ga0137378_104368853 | 3300012210 | Vadose Zone Soil | FAYCDFTRRTNIADMSPRRHSSEPLSLESTDGAGPN* |
| Ga0137377_104630573 | 3300012211 | Vadose Zone Soil | EKTTERSFRGSWMGFAYCDFTQRMSVAGMSPRRHSSEPLSREAASEPAGPN* |
| Ga0137377_110636091 | 3300012211 | Vadose Zone Soil | EKTTERSFRGSWMGFAYCDFTQRMSVAGMSPRRHSSEPLSLDAAAEPAGPN* |
| Ga0150985_1122073351 | 3300012212 | Avena Fatua Rhizosphere | ALEKTTERSFRGSWMGFAYCDFTQHMSVAGMSSRRNSSEPLSLEAAAPSPSRAR* |
| Ga0137372_100770034 | 3300012350 | Vadose Zone Soil | YLEKTTERSFRGSWMGFAYCDFTQRMSVAGMSPCRHSSEPLSLDAAAEPAGPN* |
| Ga0137358_101119734 | 3300012582 | Vadose Zone Soil | EPCFYLEKTTERGFRGSWMGFAYCDFTQRMSVAGMSPRRHSSEPLSLEAAAEPAGPN* |
| Ga0137358_101538872 | 3300012582 | Vadose Zone Soil | FRGSWMGFAYCDFTQRMSVAGMSPRRHSSEPLSLEAAAEPAGRN* |
| Ga0137395_106087821 | 3300012917 | Vadose Zone Soil | ERGFRGSWMGFAYCDFTQRMSVAGMSPRRHSSEPLSLEAAAEPAGPN* |
| Ga0164302_115165571 | 3300012961 | Soil | ERSFRGSWMGFAYCDFTRRMSVAGVSPHRHSSEPLPLEARDGEGSN* |
| Ga0134076_102681122 | 3300012976 | Grasslands Soil | FRGSWMGFAYCDFTRRMNVAGMSPRRHSHGPLSLEASEAGAN* |
| Ga0182036_104973522 | 3300016270 | Soil | KLDERSFRGSWMGFAYCDFTRRMSVAGMSTHGHPSRPLSLEAAETSGAN |
| Ga0182041_118115282 | 3300016294 | Soil | FHLEKLDERSFRGSWMGFAYCDFTRRMSVAGMSTHRHSSQPLSLEAAEASGAN |
| Ga0182032_100489931 | 3300016357 | Soil | SFRGSWMGFAYCDFTRRVSIAGMSPRRHSSQPLSLDAAEATGAAD |
| Ga0182032_120354952 | 3300016357 | Soil | SFRGSWMGFAYCDFTRRVSIAGMSPRRHSSQPLSLDAAEATGAD |
| Ga0182040_101471181 | 3300016387 | Soil | SWMGFAYCDFTRRVSIAGMSPRRHSSQPLSLDAAEATGAD |
| Ga0182040_111091731 | 3300016387 | Soil | EKLDERSFRGSWMGFAYCDFTRRMSVAGMSTHRHSSQPLSLEAAETSGAN |
| Ga0182040_115195471 | 3300016387 | Soil | FHLEKLDERSFRGSWMGFAYCDFTRRMSVAGMSTHRHPSRPLSLEAAETSGAN |
| Ga0182037_106877113 | 3300016404 | Soil | GFAYCDFTRRMSVAGMSTHRRSSQPLSLEAAETSGAN |
| Ga0066662_116747081 | 3300018468 | Grasslands Soil | GSWMGFAYCDFTQRMSVAGMSPRRHSSEPLSLEAAAEPAGRN |
| Ga0210408_110495382 | 3300021178 | Soil | DERSFRGSWMGFAYCDFTRRMSVAGVSTRRHSSQPLSLEAAEETGAN |
| Ga0210402_107793421 | 3300021478 | Soil | MPFEPCFRIEKTDDLSFRGSWMGDFTRRTNIAVMSPRRHSSEPLTLESDGAGPN |
| Ga0126371_117373632 | 3300021560 | Tropical Forest Soil | ERSFRGSWMGFAYCDFTRRMNVAGVSTRRHSSQPLSLEAEEASGAN |
| Ga0207693_113341571 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | RLEKLNERSFRGSWMGFAYCDFTRRMSVAGVSQHRHLSEPLPLEAREGEGSN |
| Ga0207664_118099991 | 3300025929 | Agricultural Soil | LEKLDERSFRGSWMGFAYCDFTRRMSVAGMSTRRHSSQPLSLEAAEASDAN |
| Ga0209239_11741791 | 3300026310 | Grasslands Soil | TTERSFRGSWMGFAYCDFTQRMSVAGMSPRRHSSEPLSLEAAAEPAGPN |
| Ga0209647_11059041 | 3300026319 | Grasslands Soil | LEKTTERSFRGSWMGFAYCDFTQRMSVAGMSPRRHSSEPLSLEAAAEPAGPN |
| Ga0257161_10882931 | 3300026508 | Soil | MGFAYCDFTRRMSVAGVSTRRHSSQPLSLEAAEASDAN |
| Ga0209648_100630991 | 3300026551 | Grasslands Soil | MGFAYCDFTQRMSVAGMSPRRHSSEPLSLEAAAEPAGPN |
| Ga0209648_106278732 | 3300026551 | Grasslands Soil | CFYLEKTTERSFRGSWMGFAYCDFTQRMSVAGMSPRRHSSEPLSLEAAAEPAGPN |
| Ga0209481_105668122 | 3300027880 | Populus Rhizosphere | WLGFAYCDFTRRMSVAGIGPRRHSSEPLSLEATDAAGDN |
| Ga0307306_100278851 | 3300028782 | Soil | AERSFRGSWMGFAYCDFTQRMSVAGMSSRRNSSEPLSLEAAAPSPSRAR |
| Ga0318538_101464111 | 3300031546 | Soil | RGSWMGFAYCDFTRRMSIAGISPRRHSSQPLSLEAAETSGAD |
| Ga0310915_103442011 | 3300031573 | Soil | AYCDFTRRMSIAGISPRRHSSQPLSLEAAETSGAD |
| Ga0318572_103049642 | 3300031681 | Soil | SWMGFAYCDFTRRMSVAGMSTRRHSSQPLSLEAAETSGAN |
| Ga0318560_104981872 | 3300031682 | Soil | GFAYCDFTRRMSVAGMSTHRHSSQPLSLEAAEASGAN |
| Ga0306917_106762991 | 3300031719 | Soil | HLEKLDERSFRGSWMGFAYCDFTRRMSIAGISPRRHSSQPLSLEAAETSGAD |
| Ga0318502_100217843 | 3300031747 | Soil | FAYCDFTRRMSVAGVSTRRHSSQPLSLEAAETSGAN |
| Ga0318526_104048841 | 3300031769 | Soil | ERSFRGSWMGFAYCDFTRRMSIAGISPRRHSSQPLSLEAAETSGAD |
| Ga0318546_101477011 | 3300031771 | Soil | WMGFAYCDFTRRMSVAGMSTRRHSSQPLSLEAAETSGAN |
| Ga0318543_101984401 | 3300031777 | Soil | GFAYCDFTRRMSVAGVSTRRHSSQPLSLEAAETSGAN |
| Ga0318552_105861131 | 3300031782 | Soil | DERSFRGSWMGFAYCDFTRRMSVAGMSTRRHSSQPLSLEAAETSGAN |
| Ga0318576_106220341 | 3300031796 | Soil | LQKLDERSFRGSWMGFAYCDFTRRMSVAGMSTRRHSSQPLSLEAAETSGAN |
| Ga0318565_102529232 | 3300031799 | Soil | AYCDFTRRMSVAGMSTRRHSSQPLSLEAAEAGGAN |
| Ga0310917_112168401 | 3300031833 | Soil | GFAYCDFTRRMSIAGISPRRHSSQPLSLEAAETSGAD |
| Ga0318512_104452671 | 3300031846 | Soil | DERSFRGSWMGFAYCDFTRRMSVAGVSTRRHSSQPLSLEAAETSGAN |
| Ga0306919_100165295 | 3300031879 | Soil | ERSFRGSWMGFAYCDFTRRMSIAGISPRRHSSQPLSLEAAETWGAD |
| Ga0306919_104350641 | 3300031879 | Soil | HLEKLDERSFRGSWMGFAYCDFTRRMSVAGMSTHRHPSRPLSLEAAETSGAN |
| Ga0306919_108297311 | 3300031879 | Soil | FRGSWMGFAYCDFTRRTNIAAMSPRRHSSEPLSLESTDGADPNWPPAAK |
| Ga0318551_103870291 | 3300031896 | Soil | MGFAYCDFTRRMSIAGISPRRHSSQPLSLEAAETSGAD |
| Ga0318520_104063782 | 3300031897 | Soil | LEKLDERSFRGSWMGFAYCDFTRRMSVAGMSTHRHSSQPLSLEAAEASGAN |
| Ga0306921_124149352 | 3300031912 | Soil | GSWMGFAYCDFTRRMSVAGMSTRRHSSRPLSLEAAETSGAN |
| Ga0310916_115934641 | 3300031942 | Soil | DERSFRGSWMGFAYCDFTRRMSVAGMSTHRHSSQPLSLEAAEASGAN |
| Ga0310910_100425931 | 3300031946 | Soil | RSFRGSWMGFAYCDFTRRMSVAGMSTRRHSSQPLSLEAAETSGAN |
| Ga0310910_111812591 | 3300031946 | Soil | RSFRGSWMGFAYCDFTRRVSIAGMSPRRHSSQPLSLDAAEATGAAD |
| Ga0318531_104715762 | 3300031981 | Soil | GFAYCDFTRRMSVAGMSTRRHSSQPLSLEAAETSGAN |
| Ga0318569_106186372 | 3300032010 | Soil | FRGSWMGFAYCDFTRRMSIAGISPRRHSSQPLSLEAAETSGAD |
| Ga0318559_103974382 | 3300032039 | Soil | AYCDFTRRMSVAGVSTRRHSSQPLSLEAAETSGAN |
| Ga0318533_111362571 | 3300032059 | Soil | RSFRGSWMGFAYCDFTRRVSIAGMSPRRHSSQPLSLDAAEATGAD |
| Ga0318505_101499462 | 3300032060 | Soil | GSWMGFAYCDFTRRMSVAGMSTRRHSSQPLSLEAAETSGAN |
| Ga0318514_103571061 | 3300032066 | Soil | KLDERSFRGSWMGFAYCDFTRRMSVAGMSTHRHPSRPLSLEAAETSGAN |
| Ga0318577_106055442 | 3300032091 | Soil | KLDERSFRGSWMGFAYCDFTRRMSVAGMSTHRHSSQPLSLEAAEASGAN |
| Ga0318540_102558281 | 3300032094 | Soil | FRGSWMGFAYCDFTRRMSVAGMSTHGHPSRPLSLEAAETSGDN |
| Ga0318540_105940651 | 3300032094 | Soil | GFAYCDFTRRMSVAGMSTHRHSSQPLSLEAAETSGAN |
| Ga0307470_108648392 | 3300032174 | Hardwood Forest Soil | LDERSFRGSWMGFAYCDFTRRMSVAGVSTRRHSSQPLSLEAEEASGAN |
| Ga0306920_1000668005 | 3300032261 | Soil | EKLDERSFRGSWMGFAYCDFTRRMSVAGMSTRRHSSQPLSLEAAETSGAN |
| Ga0306920_1039013972 | 3300032261 | Soil | LEKLDERSFRGSWMGFAYCDFTRRMSVAGMSTRRHSSQPLSLEAAETSGAN |
| ⦗Top⦘ |