


| Basic Information | |
|---|---|
| Family ID | F082972 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 113 |
| Average Sequence Length | 40 residues |
| Representative Sequence | EYHEVLTEDRPDLDVALEDWNAKEGLLAAIFIDFLRRAERRA |
| Number of Associated Samples | 103 |
| Number of Associated Scaffolds | 113 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.87 % |
| % of genes near scaffold ends (potentially truncated) | 90.27 % |
| % of genes from short scaffolds (< 2000 bps) | 90.27 % |
| Associated GOLD sequencing projects | 95 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (65.487 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (38.938 % of family members) |
| Environment Ontology (ENVO) | Unclassified (40.708 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (41.593 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.29% β-sheet: 0.00% Coil/Unstructured: 55.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 113 Family Scaffolds |
|---|---|---|
| PF00571 | CBS | 39.82 |
| PF07171 | MlrC_C | 8.85 |
| PF02515 | CoA_transf_3 | 7.96 |
| PF00903 | Glyoxalase | 5.31 |
| PF01042 | Ribonuc_L-PSP | 2.65 |
| PF07364 | DUF1485 | 2.65 |
| PF13669 | Glyoxalase_4 | 2.65 |
| PF00294 | PfkB | 1.77 |
| PF04964 | Flp_Fap | 1.77 |
| PF00296 | Bac_luciferase | 1.77 |
| PF07883 | Cupin_2 | 1.77 |
| PF00496 | SBP_bac_5 | 0.88 |
| PF00475 | IGPD | 0.88 |
| PF02371 | Transposase_20 | 0.88 |
| PF01842 | ACT | 0.88 |
| PF14579 | HHH_6 | 0.88 |
| PF00378 | ECH_1 | 0.88 |
| PF03235 | DUF262 | 0.88 |
| PF12681 | Glyoxalase_2 | 0.88 |
| PF13683 | rve_3 | 0.88 |
| PF00291 | PALP | 0.88 |
| PF00857 | Isochorismatase | 0.88 |
| PF03466 | LysR_substrate | 0.88 |
| PF12833 | HTH_18 | 0.88 |
| PF00561 | Abhydrolase_1 | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
|---|---|---|---|
| COG5476 | Microcystin degradation protein MlrC, contains DUF1485 domain | General function prediction only [R] | 11.50 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 7.96 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 2.65 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 1.77 |
| COG3847 | Flp pilus assembly protein, pilin Flp | Extracellular structures [W] | 1.77 |
| COG0131 | Imidazoleglycerol phosphate dehydratase HisB | Amino acid transport and metabolism [E] | 0.88 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.88 |
| COG1479 | DNAse/DNA nickase specific for phosphorothioated or glycosylated phage DNA, GmrSD/DndB/SspE family, contains DUF262 and HNH nuclease domains | Defense mechanisms [V] | 0.88 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.88 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 65.49 % |
| Unclassified | root | N/A | 34.51 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002245|JGIcombinedJ26739_100246285 | Not Available | 1676 | Open in IMG/M |
| 3300004080|Ga0062385_10599054 | Not Available | 696 | Open in IMG/M |
| 3300005181|Ga0066678_10837477 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 606 | Open in IMG/M |
| 3300005435|Ga0070714_101686899 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 619 | Open in IMG/M |
| 3300005439|Ga0070711_101687198 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium RIFCSPHIGHO2_12_FULL_66_14 | 555 | Open in IMG/M |
| 3300005445|Ga0070708_101314963 | Not Available | 675 | Open in IMG/M |
| 3300005467|Ga0070706_100776835 | Not Available | 887 | Open in IMG/M |
| 3300005556|Ga0066707_11007749 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 508 | Open in IMG/M |
| 3300005557|Ga0066704_10449281 | Not Available | 852 | Open in IMG/M |
| 3300005563|Ga0068855_102116890 | Not Available | 566 | Open in IMG/M |
| 3300006903|Ga0075426_11389712 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300006904|Ga0075424_100765809 | Not Available | 1030 | Open in IMG/M |
| 3300006954|Ga0079219_10846023 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 728 | Open in IMG/M |
| 3300009143|Ga0099792_10257175 | Not Available | 1019 | Open in IMG/M |
| 3300010048|Ga0126373_11668497 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300010358|Ga0126370_11504430 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300010359|Ga0126376_13171477 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 509 | Open in IMG/M |
| 3300010371|Ga0134125_12978508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium RIFCSPHIGHO2_12_FULL_66_14 | 514 | Open in IMG/M |
| 3300010376|Ga0126381_100384582 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1950 | Open in IMG/M |
| 3300011120|Ga0150983_12780905 | Not Available | 522 | Open in IMG/M |
| 3300012202|Ga0137363_11388183 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300012206|Ga0137380_10879151 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300012207|Ga0137381_10538754 | Not Available | 1018 | Open in IMG/M |
| 3300012285|Ga0137370_10394935 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 837 | Open in IMG/M |
| 3300012363|Ga0137390_10803768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium RIFCSPHIGHO2_12_FULL_66_14 | 898 | Open in IMG/M |
| 3300012922|Ga0137394_11215193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 617 | Open in IMG/M |
| 3300012929|Ga0137404_10681957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 928 | Open in IMG/M |
| 3300012972|Ga0134077_10571465 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 509 | Open in IMG/M |
| 3300015374|Ga0132255_105301709 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300016270|Ga0182036_11893100 | Not Available | 506 | Open in IMG/M |
| 3300016294|Ga0182041_11362091 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 650 | Open in IMG/M |
| 3300016319|Ga0182033_10988161 | Not Available | 748 | Open in IMG/M |
| 3300016387|Ga0182040_10674630 | Not Available | 843 | Open in IMG/M |
| 3300016404|Ga0182037_10556363 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
| 3300016445|Ga0182038_10024749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3676 | Open in IMG/M |
| 3300016445|Ga0182038_12145737 | Not Available | 507 | Open in IMG/M |
| 3300018482|Ga0066669_10596186 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 968 | Open in IMG/M |
| 3300020579|Ga0210407_11038337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 624 | Open in IMG/M |
| 3300021181|Ga0210388_11721380 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300021372|Ga0213877_10212751 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300021406|Ga0210386_10148148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 1961 | Open in IMG/M |
| 3300021441|Ga0213871_10056152 | All Organisms → cellular organisms → Bacteria | 1089 | Open in IMG/M |
| 3300021478|Ga0210402_10877743 | Not Available | 823 | Open in IMG/M |
| 3300021560|Ga0126371_10368925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia | 1573 | Open in IMG/M |
| 3300022533|Ga0242662_10146606 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300022713|Ga0242677_1005635 | Not Available | 1221 | Open in IMG/M |
| 3300022715|Ga0242678_1005139 | Not Available | 1231 | Open in IMG/M |
| 3300022726|Ga0242654_10196691 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300025910|Ga0207684_11100092 | Not Available | 661 | Open in IMG/M |
| 3300025916|Ga0207663_10782627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium RIFCSPHIGHO2_12_FULL_66_14 | 759 | Open in IMG/M |
| 3300026530|Ga0209807_1029311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2651 | Open in IMG/M |
| 3300026542|Ga0209805_1015933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 3988 | Open in IMG/M |
| 3300026552|Ga0209577_10055334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 3331 | Open in IMG/M |
| 3300027371|Ga0209418_1071679 | Not Available | 620 | Open in IMG/M |
| 3300027701|Ga0209447_10103857 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300027884|Ga0209275_10781849 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 550 | Open in IMG/M |
| 3300030967|Ga0075399_11390908 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 635 | Open in IMG/M |
| 3300030973|Ga0075395_11248392 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300031231|Ga0170824_120299205 | Not Available | 799 | Open in IMG/M |
| 3300031474|Ga0170818_102735128 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300031474|Ga0170818_102971536 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300031545|Ga0318541_10178613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 1171 | Open in IMG/M |
| 3300031545|Ga0318541_10777063 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300031546|Ga0318538_10479617 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300031561|Ga0318528_10068502 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1824 | Open in IMG/M |
| 3300031561|Ga0318528_10308244 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
| 3300031561|Ga0318528_10568654 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300031564|Ga0318573_10708040 | Not Available | 541 | Open in IMG/M |
| 3300031640|Ga0318555_10116446 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1417 | Open in IMG/M |
| 3300031713|Ga0318496_10287549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 907 | Open in IMG/M |
| 3300031736|Ga0318501_10734537 | Not Available | 545 | Open in IMG/M |
| 3300031744|Ga0306918_11293984 | Not Available | 561 | Open in IMG/M |
| 3300031754|Ga0307475_10614770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum | 870 | Open in IMG/M |
| 3300031763|Ga0318537_10049227 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1527 | Open in IMG/M |
| 3300031771|Ga0318546_10762985 | Not Available | 681 | Open in IMG/M |
| 3300031771|Ga0318546_11115202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Skermanella | 554 | Open in IMG/M |
| 3300031780|Ga0318508_1031322 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1349 | Open in IMG/M |
| 3300031781|Ga0318547_10371590 | Not Available | 875 | Open in IMG/M |
| 3300031793|Ga0318548_10233435 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
| 3300031796|Ga0318576_10157569 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
| 3300031910|Ga0306923_11858230 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300031912|Ga0306921_10336195 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1766 | Open in IMG/M |
| 3300031912|Ga0306921_11349454 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
| 3300031941|Ga0310912_10163040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1689 | Open in IMG/M |
| 3300031962|Ga0307479_11920059 | Not Available | 542 | Open in IMG/M |
| 3300031981|Ga0318531_10137089 | All Organisms → cellular organisms → Bacteria | 1092 | Open in IMG/M |
| 3300032001|Ga0306922_10532243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1250 | Open in IMG/M |
| 3300032035|Ga0310911_10479593 | Not Available | 721 | Open in IMG/M |
| 3300032039|Ga0318559_10151836 | Not Available | 1052 | Open in IMG/M |
| 3300032043|Ga0318556_10187094 | Not Available | 1075 | Open in IMG/M |
| 3300032051|Ga0318532_10156298 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 810 | Open in IMG/M |
| 3300032059|Ga0318533_10622739 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300032060|Ga0318505_10120625 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1200 | Open in IMG/M |
| 3300032060|Ga0318505_10547333 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300032063|Ga0318504_10245087 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300032063|Ga0318504_10377771 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300032065|Ga0318513_10459163 | Not Available | 623 | Open in IMG/M |
| 3300032065|Ga0318513_10686232 | Not Available | 502 | Open in IMG/M |
| 3300032068|Ga0318553_10457388 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300032090|Ga0318518_10696120 | Not Available | 517 | Open in IMG/M |
| 3300032094|Ga0318540_10183220 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
| 3300032180|Ga0307471_101025865 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 992 | Open in IMG/M |
| 3300032421|Ga0310812_10074982 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium RIFCSPHIGHO2_12_FULL_66_14 | 1352 | Open in IMG/M |
| 3300032896|Ga0335075_10693485 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 981 | Open in IMG/M |
| 3300033134|Ga0335073_11480016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 657 | Open in IMG/M |
| 3300033290|Ga0318519_10091357 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1621 | Open in IMG/M |
| 3300033486|Ga0316624_10103492 | Not Available | 2013 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 38.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.62% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.31% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.42% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.42% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.54% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.65% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.65% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.65% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.65% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.77% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.77% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.89% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.89% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.89% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.89% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.89% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.89% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.89% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014199 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaG | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021372 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R01 | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Host-Associated | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022713 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022715 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027371 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030967 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA11 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030973 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB6 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ26739_1002462854 | 3300002245 | Forest Soil | AEYHEVVTEDRPDLDVALEDWNAKEGLLAAIFIDFLRRAQRRA* |
| Ga0062385_105990541 | 3300004080 | Bog Forest Soil | EYHEVLTEDRPDLDAATEDWEPKEGLLAAIFIDFLRRQQHRA* |
| Ga0066678_108374771 | 3300005181 | Soil | EYHEVLAEDRMDLDIAFEDWEKKEGLLAAIFIDFLRRQQRR* |
| Ga0070714_1016868991 | 3300005435 | Agricultural Soil | HEVLTEDRPDLDVALEDWNAKEGLLAAIFIDFLRRTERRH* |
| Ga0070711_1016871982 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | EYHEVLSEDRMDLDIAFEDWEKKEGLLAAIFIDFLRRQQRR* |
| Ga0070708_1013149632 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | EYHEVLTEDRMDLDVAFEDWAKKEGLLAAIFIDFLRRQQRR* |
| Ga0070706_1007768352 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | EYHEVLTEDRPDLDVALEDWNAKEGLLAAIFIDFLRRAERRA* |
| Ga0066707_110077492 | 3300005556 | Soil | EDRMDLDVAFEDWEKKEGLLAAIFIDFLRRQQRR* |
| Ga0066704_104492813 | 3300005557 | Soil | VLTEDRPDLDVALEDWNAKEGLLAAIFINFLRRAQRRA* |
| Ga0068855_1021168902 | 3300005563 | Corn Rhizosphere | NGEYHEVLTEDRTDLEVALEDWNAKEGLLAAIFIDFLRRAEGRR* |
| Ga0070765_1009564272 | 3300006176 | Soil | QVVTDDHPDIEAAFADWDKKEGLLAAIFIDFLRRQQRR* |
| Ga0075426_113897121 | 3300006903 | Populus Rhizosphere | VLTEDRPDLDVALEEWNAKEGLLAAIFIDFLRRNERRA* |
| Ga0075424_1007658092 | 3300006904 | Populus Rhizosphere | EYHEVLTEDRTDLEVALEDWSAKEGLLAAIFIDFLRRAEGRR* |
| Ga0079219_108460231 | 3300006954 | Agricultural Soil | EDRPDLDVALEDWNAKEGRLAAIFIDFLRRTERRA* |
| Ga0099792_102571751 | 3300009143 | Vadose Zone Soil | LTEDRPDLDVALEEWSAKEGLLAAIFIDFLRRAERRS* |
| Ga0126373_116684971 | 3300010048 | Tropical Forest Soil | EYHEVLTEGRLDLDVALEDWNAKEGLLAAIFIDFLRRTERRT* |
| Ga0126370_115044302 | 3300010358 | Tropical Forest Soil | EYHEVLTEDRPDLDVALEDWNAKEGLLAAIFIDFLRRCERGR* |
| Ga0126376_131714772 | 3300010359 | Tropical Forest Soil | TEDRPDVDVALEDWNAKEGLLAATFIDFLRRTERRA* |
| Ga0134125_129785081 | 3300010371 | Terrestrial Soil | SEDRMDLDIAFEDLEKKEGLLAAIFIDFLRRQQRR* |
| Ga0126381_1003845823 | 3300010376 | Tropical Forest Soil | NSEYHEVLTEDRPELEVALEDWNAKEGLLAAIFIDFLRRAERRG* |
| Ga0150983_127809051 | 3300011120 | Forest Soil | RPDLDVALEDWEAKAGLLAAIFIDFLRRTERHDR* |
| Ga0137363_113881831 | 3300012202 | Vadose Zone Soil | LTEDRPDLDVALEDWEAKAGLLAAIFIDFLRRTERRDR* |
| Ga0137380_108791511 | 3300012206 | Vadose Zone Soil | SEYHEVLTEDRPDLDVALEDWNAKEGLLAAIFIDFLRRAERRA* |
| Ga0137381_105387542 | 3300012207 | Vadose Zone Soil | TEDRPDLDVAMEDWAAKEGLLAAIFIDFLRRAQRHA* |
| Ga0137370_103949353 | 3300012285 | Vadose Zone Soil | VLTEDRMDLDVAFEDWEKKEGLLAAVFIDFLRRRQRV* |
| Ga0137390_108037682 | 3300012363 | Vadose Zone Soil | LTEDREDLDIAFEDWEKKEGLLAAIFIDFLRRQGRR* |
| Ga0137358_110703121 | 3300012582 | Vadose Zone Soil | QVVSDDHPDIETAFADWDRKEGLLAATFTDFLRSQGR* |
| Ga0137394_112151932 | 3300012922 | Vadose Zone Soil | EYHEVVTEDRPDLDVALEDWNAKEGLLAAIFIDFLRRA* |
| Ga0137404_106819573 | 3300012929 | Vadose Zone Soil | NAEYREVLTDDREDLDIAFEDCEKKEGLLAAIFIDFLRRQGRR* |
| Ga0134077_105714652 | 3300012972 | Grasslands Soil | MPNSEYHEVLTEDRPDLDVALEEWNAKEGLLAAIFVDFLRRAERRS* |
| Ga0181535_101082552 | 3300014199 | Bog | TDDHPDIEAAFADWDRKEGLLAATFIDFLRRQGRR* |
| Ga0132255_1053017091 | 3300015374 | Arabidopsis Rhizosphere | HEVLTEDRPDLDVALEEWSAKEGLLAAVFIDFLRRAERRA* |
| Ga0182036_118931002 | 3300016270 | Soil | EVLTEDRPDLDVALEDWNAKEGLLAATFIDFLRRTQRRA |
| Ga0182041_113620913 | 3300016294 | Soil | TEDRPDLDVALEDWNAKEGLLAAIFIDFLRRAERRG |
| Ga0182033_109881612 | 3300016319 | Soil | EDRSDLDVALEDWDAKEGLLAAIFIDFRRRAQRPA |
| Ga0182040_106746302 | 3300016387 | Soil | MPNAEYHEVVTEDRPDLDVALEDWNAKEGLLAAILRRAQRRY |
| Ga0182037_105563632 | 3300016404 | Soil | EDRPDLDVALEDWNAKEGLLAAVFVDFLRRAQRRS |
| Ga0182038_100247495 | 3300016445 | Soil | EVLIEDRPDLDVALEDWSAKEGLLAAIFIDFLRRTERRL |
| Ga0182038_121457372 | 3300016445 | Soil | EDRPDLDVALEDWSAKEGLLAAIFIDFLRRTERHA |
| Ga0066669_105961861 | 3300018482 | Grasslands Soil | EYHEVMAEDRMDLDVALEDWEKKEGLLAAIFIDFLRRQQRR |
| Ga0210407_110383372 | 3300020579 | Soil | YHEVVTEDRPDLDVALEDWNAKEGLLAAIFIDFLRRAQRRA |
| Ga0210388_117213801 | 3300021181 | Soil | EYHEVLTEDRPDLDVALEEWNAKEGLLAAIFIDFLRRAERRGRMAVV |
| Ga0213877_102127512 | 3300021372 | Bulk Soil | EYHEMLTEDRPDQDVAIEDWNAKEGLLAAIFIDFLRRAQRRG |
| Ga0210386_101481481 | 3300021406 | Soil | SEYHEVLTEDRPDLDVALEEWNAKEGLLAAIFIDFLRRAERRGRMAVV |
| Ga0213871_100561523 | 3300021441 | Rhizosphere | NSEYHEVLPENRYDVDVALEDWEAKEGLLAAIFIDYLRRLQRRGG |
| Ga0210402_108777431 | 3300021478 | Soil | YHEVLTEDRPDLDVALEEWNAKEGLLAAIFIDFLRRAERRGRMAVV |
| Ga0126371_103689253 | 3300021560 | Tropical Forest Soil | MPSIEVLTEDRLDLDVALEDWNAKEGLLAAIFIDFLRRAQRSA |
| Ga0242662_101466062 | 3300022533 | Soil | EVLTEDRPDLDVALEDWEAKAGLLAAIFIDFLRRTERHDR |
| Ga0242677_10056352 | 3300022713 | Soil | SNAEYHEVLTEDRPDQDVATEDWAKKEGLLAAIFIDFLRRQQRG |
| Ga0242678_10051392 | 3300022715 | Soil | AEYHEVLTEDRPDQDVATEDWAKKEGLLAAIFIDFLRRQQRG |
| Ga0242654_101966911 | 3300022726 | Soil | EVVTEDRPDLDVALEDWNAKEGLLAAIFIDFLRRMQRRA |
| Ga0207684_111000922 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | SEYHEVLTEDRPDLDVALEDWNAKEGLLAAIFIDFLRRAERRA |
| Ga0207663_107826271 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | EYHEVLSEDRMDLDIAFEDWEKKEGLLAAIFIDFLRRQQRR |
| Ga0207683_113091761 | 3300026121 | Miscanthus Rhizosphere | HQVVTDDHPDIDAAFADWDKKEGLLAATFIDFIRRQRR |
| Ga0209807_10293112 | 3300026530 | Soil | MPNSEYHEVLTEDRPDLDVALEEWNAKEGLLAAIFVDFLRRAERRS |
| Ga0209805_10159331 | 3300026542 | Soil | HRLMANSEYHEVLTEDRPDLDVALEEWNAKEGLLAAIFVDFLRRAERRS |
| Ga0209577_100553341 | 3300026552 | Soil | YHEVLAEDRMDLDIAFEDWEKKEGLLAAIFIDFLRRQQRR |
| Ga0209418_10716792 | 3300027371 | Forest Soil | EVVTEDRPDLDVALEDWNAKEGLLAAVFIDFLRRAKRRS |
| Ga0209447_101038571 | 3300027701 | Bog Forest Soil | NSEYHEVLTEDRPDLDVALEEWNAKEGLLAAIFVDFLRRAERRS |
| Ga0209275_107818491 | 3300027884 | Soil | VLTEDRPDLDVALEDWHAKEGLLAAIFIDFLRRAERRG |
| Ga0308309_111442101 | 3300028906 | Soil | NAEYHQVVTDDHPDIEAAFADWDKKEGLLAAIFIDFLRRQQRR |
| Ga0075399_113909082 | 3300030967 | Soil | VVTEDRPDLDVALEDWNAKEGLLAAIFIDFLRRVQRRT |
| Ga0075395_112483922 | 3300030973 | Soil | HEVVTEDRPDLDVALEDWNAKEGLLAAIFIDFLRRVQRRA |
| Ga0170824_1202992051 | 3300031231 | Forest Soil | VLTEDRPDLDVALEEWNAKEGLLAAIFIDFLRRAERHGSMATV |
| Ga0170818_1027351282 | 3300031474 | Forest Soil | VLTEDRPDLDVALEEWNAKEGLLAAIFIDFLRRAERRA |
| Ga0170818_1029715361 | 3300031474 | Forest Soil | EYHEVVTEDRPDLDVALEDWNAKEGLLAAIFIDFLRRLQRRA |
| Ga0318541_101786131 | 3300031545 | Soil | HEVLTEDRPDLDVALEDWNAKEGLLAAIFIDFLRRVQRRA |
| Ga0318541_107770631 | 3300031545 | Soil | GDRRPPDLDVALEDWNAKEGLLAAIFIDFLRRALRRG |
| Ga0318538_104796172 | 3300031546 | Soil | TEDRPDLDVALEDWNAKEGLLAAIFIDFLRRTESRA |
| Ga0318528_100685023 | 3300031561 | Soil | VMTEERPDLDVALEDWNAKEGLLAAIFIDFLRRAQRRY |
| Ga0318528_103082442 | 3300031561 | Soil | EYHEVLSEDRLDQDVALEDWNAKEGLLAAIFIDFLRRAARGQ |
| Ga0318528_105686542 | 3300031561 | Soil | TEDRLDLDVALEDWNAKEGLLAAIFIDYLRRVQRRA |
| Ga0318573_107080401 | 3300031564 | Soil | EYHEVLTEDRPDLDVALEDWNAKEGLLAAIFIDFLRRAQRRY |
| Ga0318555_101164463 | 3300031640 | Soil | AEYHEVLTEERPDLDVALEDWNAKEGLLAAIFIDFLRRAQRRY |
| Ga0318496_102875493 | 3300031713 | Soil | TEDRPDLDVALEDWNAKEGLLAAIFIDFLRRAERRA |
| Ga0318501_107345371 | 3300031736 | Soil | VLTEDRPDLDVALEDWNAKEGLLAAIFIDYLRRVQRRA |
| Ga0306918_112939841 | 3300031744 | Soil | EVVTEDHPDLDVALEDWNAKEGLLAAIFIDFLRRVQRRT |
| Ga0307475_106147702 | 3300031754 | Hardwood Forest Soil | EYHEVLTEDRPDLDVALQEWNAKEGLLAAIFIDFLRRAERRS |
| Ga0318537_100492273 | 3300031763 | Soil | EYHEVLTEDRPDLDVALEDWNAKEGLLAAIFIDFLRRTERRA |
| Ga0318546_107629852 | 3300031771 | Soil | HRLMPSAEYHEVVTEDRPDLDVALEDWNAKEGLLAAILINFLRCAQRRY |
| Ga0318546_111152021 | 3300031771 | Soil | RLMPNAEYHEVLTEDRPDLDVALEDWNAKEGLLAAVFVDFLRRAQRRS |
| Ga0318508_10313223 | 3300031780 | Soil | AEYREVLTEDRPDLDVALEDWNAKEGLLAAIFIDFLRRAQRRY |
| Ga0318547_103715901 | 3300031781 | Soil | RLMPNAGYHEVGTEDRPDLDVALEDWNAKEGLLAAIIIDFLRRAQRRY |
| Ga0318548_102334352 | 3300031793 | Soil | EYHEVLTEDRPDLDVALEDWNAKEGLLAAIFIDFLRRVQRGV |
| Ga0318576_101575693 | 3300031796 | Soil | VVTEDRPDLDVALEDWNAKEGLLAAIFIDFLRRVQHRA |
| Ga0306923_118582301 | 3300031910 | Soil | YHEVLTEDRPDLDVALEDWNAKEGLLAAIFIDFLRRVQRRA |
| Ga0306921_103361952 | 3300031912 | Soil | LIEDRPDLDVALEDWNAKEGLLAAIFIDFLRRTERRA |
| Ga0306921_113494542 | 3300031912 | Soil | HEVLPDDRPDLDVALEDWQAKEGLLAAIFIDFLRRAERR |
| Ga0310912_101630403 | 3300031941 | Soil | EYHEVLTEDRPDLDVALEDWNVKEGLLAAIFIDFLRRTERRP |
| Ga0307479_119200591 | 3300031962 | Hardwood Forest Soil | HEVLTEDRMDLDVAFEDWEAKEGLLAAIFIDFLRRQR |
| Ga0318531_101370892 | 3300031981 | Soil | AEYHEVVTEDRPDLDVALEDWNAKEGLLAAILINFLRCAQRRY |
| Ga0306922_105322431 | 3300032001 | Soil | SEYHEVLTEDRPDLDVALEDWNAKEGLLAAIFIDFLRRTERRA |
| Ga0310911_104795931 | 3300032035 | Soil | MPNAEYHEVLTEDRLDLDVALEDWNAKEGLLAAIFVDFLRRAQRRA |
| Ga0318559_101518362 | 3300032039 | Soil | EVLTEDRPDLDVALEDWNAKEGLLAAIFIDFLRRAQRRY |
| Ga0318556_101870941 | 3300032043 | Soil | REVLTEDRPDLDVALEDWNAKEGLLAAIFIDFLRRAQRRY |
| Ga0318532_101562981 | 3300032051 | Soil | VLTEDRLDQDVALEDWEKKEGLLAAIFVDFLRRTQRHL |
| Ga0318533_106227392 | 3300032059 | Soil | LTEDRPDLDVALEDWNAKEGLLAAIFIDFLRRTESRA |
| Ga0318505_101206253 | 3300032060 | Soil | HEVLTEERPDLDVALEDWNAKEGLLAAIFIDFLRRAQRRY |
| Ga0318505_105473332 | 3300032060 | Soil | HEVVTEDRPDLDVALEDWNAKEGLLAAIFIDFLRRVQQRG |
| Ga0318504_102450871 | 3300032063 | Soil | PNSEYHEVLTEDRPDLDVALEDWNAKEGLLAAIFVDFLRRAQRRA |
| Ga0318504_103777711 | 3300032063 | Soil | NAEYHEVLTEDRPDLDVALEDWNAKEGLLAAIFIDFLRRAQRRY |
| Ga0318513_104591631 | 3300032065 | Soil | YHEVVTEDRPDLDVALEDWNAKEGLLAAIFIDFLRRVQHRA |
| Ga0318513_106862321 | 3300032065 | Soil | TEYHEVLTEGRLDLDVALEDWNAKEGLLAAIFIDFLRRTERRT |
| Ga0318553_104573882 | 3300032068 | Soil | AEYHEVVTEDRPDLDVALEDWNAKEGLLAAILRRAQRRY |
| Ga0318518_106961201 | 3300032090 | Soil | EDRPDLDLALEDWSAKEGLLAAIFIDFLRRAQRRS |
| Ga0318540_101832201 | 3300032094 | Soil | TEDRPDLDLALEDWSAKEGLLAAIFIDFLRRAQRRS |
| Ga0307471_1010258652 | 3300032180 | Hardwood Forest Soil | VTEDRPDLDVALEDWNAKEGLLAAIFIDFLRRVQRRA |
| Ga0310812_100749822 | 3300032421 | Soil | YHEVLSEDRMDLDIAFEDWEKKEGLLAAIFVDFLRRQQRR |
| Ga0335082_114476501 | 3300032782 | Soil | NAEYHQVVTATHFELEAAFADWDKKEGLLAATFIDFLRRRQR |
| Ga0335075_106934852 | 3300032896 | Soil | AHRLLSNAEYHEVLTEDRPDQDVATEDWEKKEGLLAAIFIDFIRRREHRT |
| Ga0335073_114800161 | 3300033134 | Soil | YHEVLTEDRLDLDVALEDWERKEGLLAAIFIDFLRRTQRHL |
| Ga0318519_100913571 | 3300033290 | Soil | EYHEVLTEERPDLDVALEDWNAKEGLLAAIFIDFLRRAQRRY |
| Ga0316624_101034922 | 3300033486 | Soil | HEVLTEDREDLDIAFEDWERKEGLLAAVFIDFLRRQGRR |
| ⦗Top⦘ |