


| Basic Information | |
|---|---|
| Family ID | F082967 |
| Family Type | Metagenome |
| Number of Sequences | 113 |
| Average Sequence Length | 38 residues |
| Representative Sequence | GQKIRVLVDRIDPVEKKIQFAVLEEEPVRARGKRKKM |
| Number of Associated Samples | 100 |
| Number of Associated Scaffolds | 113 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 96.46 % |
| % of genes from short scaffolds (< 2000 bps) | 85.84 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.23 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (83.186 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (14.159 % of family members) |
| Environment Ontology (ENVO) | Unclassified (21.239 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.442 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 23.08% Coil/Unstructured: 76.92% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.23 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 113 Family Scaffolds |
|---|---|---|
| PF02880 | PGM_PMM_III | 15.93 |
| PF01979 | Amidohydro_1 | 5.31 |
| PF12900 | Pyridox_ox_2 | 4.42 |
| PF00408 | PGM_PMM_IV | 3.54 |
| PF03551 | PadR | 2.65 |
| PF02457 | DAC | 2.65 |
| PF13602 | ADH_zinc_N_2 | 1.77 |
| PF01266 | DAO | 1.77 |
| PF01663 | Phosphodiest | 1.77 |
| PF02894 | GFO_IDH_MocA_C | 1.77 |
| PF00072 | Response_reg | 0.88 |
| PF00496 | SBP_bac_5 | 0.88 |
| PF13432 | TPR_16 | 0.88 |
| PF07949 | YbbR | 0.88 |
| PF11645 | PDDEXK_5 | 0.88 |
| PF01641 | SelR | 0.88 |
| PF02492 | cobW | 0.88 |
| PF06071 | YchF-GTPase_C | 0.88 |
| PF07992 | Pyr_redox_2 | 0.88 |
| PF00535 | Glycos_transf_2 | 0.88 |
| PF03544 | TonB_C | 0.88 |
| PF15780 | ASH | 0.88 |
| PF04191 | PEMT | 0.88 |
| PF08388 | GIIM | 0.88 |
| PF01883 | FeS_assembly_P | 0.88 |
| PF04978 | DUF664 | 0.88 |
| PF01381 | HTH_3 | 0.88 |
| PF00990 | GGDEF | 0.88 |
| PF14534 | DUF4440 | 0.88 |
| PF08206 | OB_RNB | 0.88 |
| PF14329 | DUF4386 | 0.88 |
| PF00069 | Pkinase | 0.88 |
| PF13669 | Glyoxalase_4 | 0.88 |
| PF01797 | Y1_Tnp | 0.88 |
| PF12867 | DinB_2 | 0.88 |
| PF13924 | Lipocalin_5 | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
|---|---|---|---|
| COG0033 | Phosphoglucomutase/phosphomannomutase | Carbohydrate transport and metabolism [G] | 19.47 |
| COG1109 | Phosphomannomutase | Carbohydrate transport and metabolism [G] | 19.47 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.54 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 2.65 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 2.65 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 2.65 |
| COG0673 | Predicted dehydrogenase | General function prediction only [R] | 1.77 |
| COG0012 | Ribosome-binding ATPase YchF, GTP1/OBG family | Translation, ribosomal structure and biogenesis [J] | 0.88 |
| COG0229 | Peptide methionine sulfoxide reductase MsrB | Posttranslational modification, protein turnover, chaperones [O] | 0.88 |
| COG0557 | Exoribonuclease R | Transcription [K] | 0.88 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.88 |
| COG1158 | Transcription termination factor Rho | Transcription [K] | 0.88 |
| COG1278 | Cold shock protein, CspA family | Transcription [K] | 0.88 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.88 |
| COG4776 | Exoribonuclease II | Transcription [K] | 0.88 |
| COG4856 | Cyclic di-AMP synthase regulator CdaR, YbbR domain | Signal transduction mechanisms [T] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 83.19 % |
| Unclassified | root | N/A | 16.81 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001131|JGI12631J13338_1024900 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 626 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100043729 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4044 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100147136 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2226 | Open in IMG/M |
| 3300004092|Ga0062389_100983523 | All Organisms → cellular organisms → Bacteria | 1028 | Open in IMG/M |
| 3300005434|Ga0070709_10395634 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1030 | Open in IMG/M |
| 3300005534|Ga0070735_10333439 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
| 3300005537|Ga0070730_10031758 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3979 | Open in IMG/M |
| 3300005541|Ga0070733_10006183 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7832 | Open in IMG/M |
| 3300005541|Ga0070733_10123509 | All Organisms → cellular organisms → Bacteria | 1666 | Open in IMG/M |
| 3300005577|Ga0068857_100825998 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
| 3300006032|Ga0066696_10348591 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 965 | Open in IMG/M |
| 3300006034|Ga0066656_11093333 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
| 3300006046|Ga0066652_100571733 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Magnetococcales → unclassified Magnetococcales → Magnetococcales bacterium | 1062 | Open in IMG/M |
| 3300006162|Ga0075030_100513047 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 953 | Open in IMG/M |
| 3300006176|Ga0070765_101127136 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 741 | Open in IMG/M |
| 3300006755|Ga0079222_11210409 | Not Available | 677 | Open in IMG/M |
| 3300006806|Ga0079220_10053701 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1913 | Open in IMG/M |
| 3300006893|Ga0073928_10936516 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 592 | Open in IMG/M |
| 3300009029|Ga0066793_10416657 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 771 | Open in IMG/M |
| 3300009090|Ga0099827_11814877 | Not Available | 531 | Open in IMG/M |
| 3300009522|Ga0116218_1136302 | All Organisms → cellular organisms → Bacteria | 1116 | Open in IMG/M |
| 3300009524|Ga0116225_1015807 | All Organisms → cellular organisms → Bacteria | 3971 | Open in IMG/M |
| 3300009623|Ga0116133_1117981 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300009637|Ga0116118_1030737 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 1972 | Open in IMG/M |
| 3300009672|Ga0116215_1002730 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 10673 | Open in IMG/M |
| 3300009698|Ga0116216_10845310 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300009700|Ga0116217_10946097 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
| 3300010048|Ga0126373_10094144 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2758 | Open in IMG/M |
| 3300010048|Ga0126373_11801628 | Not Available | 676 | Open in IMG/M |
| 3300010339|Ga0074046_10856952 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300010360|Ga0126372_10426687 | All Organisms → cellular organisms → Bacteria | 1220 | Open in IMG/M |
| 3300010362|Ga0126377_11471711 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 754 | Open in IMG/M |
| 3300010375|Ga0105239_11657275 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300010379|Ga0136449_103045496 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300011271|Ga0137393_10356860 | Not Available | 1249 | Open in IMG/M |
| 3300012004|Ga0120134_1075353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Magnetococcales → unclassified Magnetococcales → Magnetococcales bacterium | 611 | Open in IMG/M |
| 3300012349|Ga0137387_10460208 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 923 | Open in IMG/M |
| 3300012350|Ga0137372_10867787 | Not Available | 643 | Open in IMG/M |
| 3300012917|Ga0137395_10871340 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300012951|Ga0164300_10513461 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 688 | Open in IMG/M |
| 3300012986|Ga0164304_10135233 | All Organisms → cellular organisms → Bacteria | 1530 | Open in IMG/M |
| 3300013307|Ga0157372_12390842 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300014164|Ga0181532_10152619 | All Organisms → cellular organisms → Bacteria | 1388 | Open in IMG/M |
| 3300014165|Ga0181523_10063591 | Not Available | 2260 | Open in IMG/M |
| 3300014168|Ga0181534_10853355 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 542 | Open in IMG/M |
| 3300014169|Ga0181531_10289112 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1002 | Open in IMG/M |
| 3300014169|Ga0181531_10302702 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 978 | Open in IMG/M |
| 3300014497|Ga0182008_10017330 | All Organisms → cellular organisms → Bacteria | 3738 | Open in IMG/M |
| 3300014657|Ga0181522_10449478 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 774 | Open in IMG/M |
| 3300016319|Ga0182033_11905765 | Not Available | 540 | Open in IMG/M |
| 3300016422|Ga0182039_11276256 | Not Available | 665 | Open in IMG/M |
| 3300017924|Ga0187820_1301510 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300017943|Ga0187819_10778581 | Not Available | 538 | Open in IMG/M |
| 3300017946|Ga0187879_10156001 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1290 | Open in IMG/M |
| 3300017998|Ga0187870_1165067 | Not Available | 800 | Open in IMG/M |
| 3300018006|Ga0187804_10107334 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1151 | Open in IMG/M |
| 3300018007|Ga0187805_10450641 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 600 | Open in IMG/M |
| 3300018009|Ga0187884_10234895 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 749 | Open in IMG/M |
| 3300018035|Ga0187875_10181939 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1166 | Open in IMG/M |
| 3300018035|Ga0187875_10393704 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 741 | Open in IMG/M |
| 3300018040|Ga0187862_10757995 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
| 3300018086|Ga0187769_10567745 | Not Available | 857 | Open in IMG/M |
| 3300018468|Ga0066662_10487667 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1118 | Open in IMG/M |
| 3300019882|Ga0193713_1146425 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300020004|Ga0193755_1158437 | Not Available | 681 | Open in IMG/M |
| 3300020583|Ga0210401_11442252 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
| 3300021170|Ga0210400_11206198 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 609 | Open in IMG/M |
| 3300021170|Ga0210400_11227006 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
| 3300021180|Ga0210396_10803309 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
| 3300021420|Ga0210394_10076293 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2899 | Open in IMG/M |
| 3300021420|Ga0210394_10320714 | All Organisms → cellular organisms → Bacteria | 1360 | Open in IMG/M |
| 3300021420|Ga0210394_11326496 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300021475|Ga0210392_10724899 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 741 | Open in IMG/M |
| 3300021479|Ga0210410_10076373 | All Organisms → cellular organisms → Bacteria | 2939 | Open in IMG/M |
| 3300021479|Ga0210410_10495703 | All Organisms → cellular organisms → Bacteria | 1091 | Open in IMG/M |
| 3300021559|Ga0210409_11149593 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 651 | Open in IMG/M |
| 3300025944|Ga0207661_10735779 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 908 | Open in IMG/M |
| 3300026542|Ga0209805_1178569 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 943 | Open in IMG/M |
| 3300026552|Ga0209577_10067025 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2981 | Open in IMG/M |
| 3300027502|Ga0209622_1035889 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
| 3300027591|Ga0209733_1174506 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300027604|Ga0208324_1115199 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 745 | Open in IMG/M |
| 3300027662|Ga0208565_1237721 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300027854|Ga0209517_10106781 | All Organisms → cellular organisms → Bacteria | 1872 | Open in IMG/M |
| 3300027862|Ga0209701_10141511 | All Organisms → cellular organisms → Bacteria | 1475 | Open in IMG/M |
| 3300027867|Ga0209167_10659732 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300027894|Ga0209068_10403080 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 780 | Open in IMG/M |
| 3300027986|Ga0209168_10445470 | Not Available | 628 | Open in IMG/M |
| 3300028759|Ga0302224_10130000 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
| 3300030707|Ga0310038_10160597 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1107 | Open in IMG/M |
| 3300031573|Ga0310915_11285723 | Not Available | 504 | Open in IMG/M |
| 3300031708|Ga0310686_109306053 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
| 3300031715|Ga0307476_10816513 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 689 | Open in IMG/M |
| 3300031715|Ga0307476_11223199 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
| 3300031833|Ga0310917_10645057 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 718 | Open in IMG/M |
| 3300031893|Ga0318536_10416819 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 678 | Open in IMG/M |
| 3300031942|Ga0310916_10334563 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1285 | Open in IMG/M |
| 3300031996|Ga0308176_10480023 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1258 | Open in IMG/M |
| 3300031996|Ga0308176_12972277 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 502 | Open in IMG/M |
| 3300032035|Ga0310911_10116629 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1479 | Open in IMG/M |
| 3300032074|Ga0308173_10531445 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1057 | Open in IMG/M |
| 3300032160|Ga0311301_12219118 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 629 | Open in IMG/M |
| 3300032828|Ga0335080_12142332 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 538 | Open in IMG/M |
| 3300032892|Ga0335081_10449562 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1639 | Open in IMG/M |
| 3300032893|Ga0335069_10186259 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2541 | Open in IMG/M |
| 3300032955|Ga0335076_10218368 | All Organisms → cellular organisms → Bacteria | 1806 | Open in IMG/M |
| 3300033004|Ga0335084_10252381 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1827 | Open in IMG/M |
| 3300033004|Ga0335084_10576078 | Not Available | 1153 | Open in IMG/M |
| 3300033004|Ga0335084_10579011 | Not Available | 1150 | Open in IMG/M |
| 3300033158|Ga0335077_10460159 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1353 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.16% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 9.73% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 7.08% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.19% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 5.31% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 5.31% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 5.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.42% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.42% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.54% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.65% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.77% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.77% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.77% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.77% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.89% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.89% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.89% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.89% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.89% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.89% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.89% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.89% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.89% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.89% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.89% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.89% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001131 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
| 3300009637 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012004 | Permafrost microbial communities from Nunavut, Canada - A30_5cm_6M | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017998 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_150 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
| 3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027502 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027662 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028759 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12631J13338_10249001 | 3300001131 | Forest Soil | RIRVLVDRIDPVEKKIQFGILEEKPPLKRKRKKG* |
| JGIcombinedJ26739_1000437291 | 3300002245 | Forest Soil | GQRIRVLVDRIDPVEKKIQFAVFEEAPPRVTGKRRKRK* |
| JGIcombinedJ26739_1001471361 | 3300002245 | Forest Soil | YHLGQKIRVLVDRIDPVEKKIQFAVLEEAPGRTAGKKRKR* |
| Ga0062389_1009835233 | 3300004092 | Bog Forest Soil | KIYSLGDRVRVLVDRIDPVEKKIQFALLEEEKRPKPWGKSRRKGS* |
| Ga0070709_103956341 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | RKIYGLGQKIRVLVDRIDPMEKKIQFAILQEKPVPKRKKRQG* |
| Ga0070735_103334391 | 3300005534 | Surface Soil | RIGDRLRVIVDRIDPVEKKINFAVMEEARPKREKRRKKK* |
| Ga0070730_100317581 | 3300005537 | Surface Soil | IFRIGDRLKVLVDRIDPVEKKINFAVFEEAPPRREGKHRKRK* |
| Ga0070733_100061836 | 3300005541 | Surface Soil | LGQRVRVLVDRIDPVEKKIQFALLEEEKPQAPKRKKKR* |
| Ga0070733_101235093 | 3300005541 | Surface Soil | GGRVRVLVDRIDPVEKKIQFAVFEEKPVPKRKNR* |
| Ga0068857_1008259982 | 3300005577 | Corn Rhizosphere | YRIGDRLRVLVDRIDPVEKKINFAVLEEEPKPRRGKRRKK* |
| Ga0066696_103485911 | 3300006032 | Soil | GQRVRVLVDRIDPVEKKIQFALIEERPPRGVKARHKSK* |
| Ga0066656_110933331 | 3300006034 | Soil | LGQRIRVLVDRIDPVEKKIQFAIVEEQDQHAAKRKRR* |
| Ga0066652_1005717331 | 3300006046 | Soil | RLGQKVRVIVDRIDPVEKKIQFALLEEVKPRAAKRKRR* |
| Ga0075030_1005130471 | 3300006162 | Watersheds | YHLGQKIRVLVDRIDPVEKKIQFAVFEEQPVRAAGKRRKRK* |
| Ga0070765_1011271361 | 3300006176 | Soil | GDRVRVLVDRIDPVEKKIQFALIEEERVRVKRKR* |
| Ga0079222_112104091 | 3300006755 | Agricultural Soil | VIVDRIDPVEKKINFAIVEEEPKRRDKKRKKSSK* |
| Ga0079220_100537011 | 3300006806 | Agricultural Soil | KTYRLGQKVHVLVDRIDPVEKKIQFALLEEKPARGTHGRRKRH* |
| Ga0073928_109365162 | 3300006893 | Iron-Sulfur Acid Spring | HVLVDRIDPVEKKIQFALLEEEEAPPNLRARSRKKR* |
| Ga0075426_100215377 | 3300006903 | Populus Rhizosphere | QVRVLVDRIDPVQKKIQFALLQERPARGQRKQKKH* |
| Ga0066793_104166571 | 3300009029 | Prmafrost Soil | NRVRVLVDRIDPVEKKIQFAVFEEEAQRPTPRRRK* |
| Ga0099827_118148772 | 3300009090 | Vadose Zone Soil | RLGQKVRVIVDRIDPVEKKIQFAFLEEVKPPRVKRKKRK* |
| Ga0116218_11363022 | 3300009522 | Peatlands Soil | GQKIRVLVDRIDPVEKKIQFAVLEEEPVRAKGKRKKRK* |
| Ga0116225_10158073 | 3300009524 | Peatlands Soil | LGQKIRVLVDRIDPVEKKIQFAVFEEAPAPLRHKASGKCKR* |
| Ga0116133_11179812 | 3300009623 | Peatland | GQKIRVLVDRIDPVEKKIQFAVLEEEPVRARGKRKKM* |
| Ga0116118_10307371 | 3300009637 | Peatland | RLRVLVDRIDPVEKKIQFAVLEEQPKPSAKSRRK* |
| Ga0116215_10027301 | 3300009672 | Peatlands Soil | RLGQRIRVLVDRIDPVEKKIQFAVWEEEPVRTTGRRKRR* |
| Ga0116216_108453101 | 3300009698 | Peatlands Soil | LGQKIRVLVDRIDPVEKKIQFAVFEEAPARPAKRSKRKA* |
| Ga0116217_109460973 | 3300009700 | Peatlands Soil | LGDRVRVLVDRIDPVEKKIQFAMIEEQPKPSGKSRRK* |
| Ga0126373_100941441 | 3300010048 | Tropical Forest Soil | IYHMGDRMKVIVDRIDPVEKKINFAVLEEETAKPAKRRKRK* |
| Ga0126373_118016281 | 3300010048 | Tropical Forest Soil | RLRVIVDRIDPVEKKINFAVMEEERPKPLKKRKRR* |
| Ga0074046_108569522 | 3300010339 | Bog Forest Soil | QKIRVLVDRIDPVEKKLQFAVLEEEPVRSVGKRRKRK* |
| Ga0126372_104266871 | 3300010360 | Tropical Forest Soil | LKVIVDRIDPVEKKINFAVLDKEHAKPAKRRKRR* |
| Ga0126377_114717111 | 3300010362 | Tropical Forest Soil | RRTYRLGQRIRVIVDRIDPVEKKIQFAVLEEKPKTKGRKKSGLRI* |
| Ga0105239_116572751 | 3300010375 | Corn Rhizosphere | LGQRIRVLVDRIDPVEKKIQFAVLEEKPAPKRKKR* |
| Ga0136449_1030454962 | 3300010379 | Peatlands Soil | HLGQKIRVLVDRIDPVEKKIQFAVLEEEKRRSEGKRKKRK* |
| Ga0137393_103568601 | 3300011271 | Vadose Zone Soil | RVRVLVDRIDPVEKKIQFAVVDEQPKPSGKSRRK* |
| Ga0120134_10753531 | 3300012004 | Permafrost | MGQKLRVLVDRIDPVEKKIQFALLEEEKPRVTKRKRK* |
| Ga0137377_107099732 | 3300012211 | Vadose Zone Soil | QKIRVLVDRIDPVEKKIQFVLLEERPQKGPKKPRRN* |
| Ga0137387_104602081 | 3300012349 | Vadose Zone Soil | LGQKIRVLVDRIDPVEKKIQFAVFEEEPVRTKAKRKKH* |
| Ga0137372_108677871 | 3300012350 | Vadose Zone Soil | IGQQLKVIVDRIDPVEKEINFAVVEEERPKPAKRRKKR* |
| Ga0137395_108713403 | 3300012917 | Vadose Zone Soil | SRKTCRLGRKVRVLVDRVDPVEKKIQFALLEEIKPRQPNRKRRGLV* |
| Ga0164300_105134611 | 3300012951 | Soil | SRRTFRLGQRIRVIVDRIDPVEKKIQFALLEEAKPRSAKRKRR* |
| Ga0164304_101352334 | 3300012986 | Soil | YSLGQRIRVLVDRIDPVEKKIQFALLEEKPAPKRKNR* |
| Ga0157372_123908421 | 3300013307 | Corn Rhizosphere | TYRIGDRLRVLVDRIDPVEKKINFAVLDEEPKPRPRKRRKK* |
| Ga0181532_101526191 | 3300014164 | Bog | RIRVLVDRIDPVEKKIQFAVIEEQPQRSRSQRRR* |
| Ga0181523_100635914 | 3300014165 | Bog | YGLGNRVRVLVDRIDPVEKKIQFAILEEQPKPSAKSRRK* |
| Ga0181534_108533551 | 3300014168 | Bog | SLGQKIRVLVDRIDPVEKKIQFAVLEEEPVRARGKRKKM* |
| Ga0181531_102891123 | 3300014169 | Bog | RSRIRVLVDRIDPVEKKIQFAILEEKPLPKRKRKKS* |
| Ga0181531_103027021 | 3300014169 | Bog | GQTIRVLVDRIDPVEKKIQFAILEETPLPKRRRKKS* |
| Ga0182008_100173307 | 3300014497 | Rhizosphere | FRLGDKVRVLVDRIDPVEKKIQFALLQDRPRQKSRGRRS* |
| Ga0181522_104494781 | 3300014657 | Bog | RIRVLVDRIDPVEKKIQFAVFEEEPKPLGKRRRK* |
| Ga0132256_1018359962 | 3300015372 | Arabidopsis Rhizosphere | GQRTRKTYRLGQRLRVIVDRIDPVEKKIQFAVLEEKPKARSGRKKIRL* |
| Ga0182033_119057651 | 3300016319 | Soil | GQRTGKTYGLGQKIRVLVDRIDPVEKKIQFAMFEQPKSRKKRS |
| Ga0182039_112762561 | 3300016422 | Soil | TRKIYHIGDRVKVIVDRIDPVEKKINFAVLDDEPAKPAKRRKRK |
| Ga0187820_13015101 | 3300017924 | Freshwater Sediment | YRLGQKIRVLVDRIDPVEKKIQFAVFEEQPVPATGKRRRRK |
| Ga0187819_107785811 | 3300017943 | Freshwater Sediment | GDRIRVLVDRIDPVEKKIQFAVIEEKTQKLTSHRRK |
| Ga0187879_101560011 | 3300017946 | Peatland | YSLGQRIRVLVDRIDPVEKKIQFAILEEKAPLKRKRKKG |
| Ga0187870_11650671 | 3300017998 | Peatland | YSLGNRVRVLVDRIDPVEKKIQFAVLEEQPKPSAKSRRK |
| Ga0187804_101073341 | 3300018006 | Freshwater Sediment | RSRKIYRIGDRLGVILDRIDPVEKKINFAVFEEAPPRQARRRKRK |
| Ga0187805_104506411 | 3300018007 | Freshwater Sediment | IRVLVDRIDPVEKKIQFAILADKEKPLPKRKRKKS |
| Ga0187884_102348952 | 3300018009 | Peatland | GQRIRVLVDRIDPVEKKIQFAVLEERPVPKRKRKK |
| Ga0187875_101819393 | 3300018035 | Peatland | LGQRIRVLVDRIDPVEKKIQFAILEEKALPKRKRKKS |
| Ga0187875_103937041 | 3300018035 | Peatland | QKIRVLVDRIDPVEKKIQFAVLEEEPVRARGKRKKM |
| Ga0187862_107579952 | 3300018040 | Peatland | KTYGLGQKIRVILDRIDPVEKKIQFAVLEEKLLPKRKRKKR |
| Ga0187769_105677451 | 3300018086 | Tropical Peatland | DRVRVLVDRIDPVEKKIQFAVLEEQPRRSGKDRVK |
| Ga0066662_104876672 | 3300018468 | Grasslands Soil | GDRLRVLVDRIDPVEKKINFAVLEEEPKPRRGKRRKK |
| Ga0193713_11464252 | 3300019882 | Soil | RVQVIVDRIDPVEKKIQFALWEEPPVRSNKRSKRR |
| Ga0193755_11584371 | 3300020004 | Soil | KVRVIVDRIDPVEKKIQFALLEEEPQRGRKRAGRK |
| Ga0210401_114422521 | 3300020583 | Soil | SRKTYSLGQRIRVLVDRIDSVEKKIQFALFVEQPAPKRKRSRK |
| Ga0210400_112061981 | 3300021170 | Soil | LGQKVRVIVDRIDPVEKKIQFALLEERPPRRPKVRHKGK |
| Ga0210400_112270061 | 3300021170 | Soil | RKTYHLGQKIRVLVDRIDPVEKKIQFAVFEKEPVRAEGKKRKRK |
| Ga0210396_108033091 | 3300021180 | Soil | IRVLVDRIDPVEKKIQFAVVEEEPVRAGGKRKKRK |
| Ga0210394_100762931 | 3300021420 | Soil | IRVLVDRIDPVEKKIQFAVLAEESVRTLGRRRKRSRER |
| Ga0210394_103207141 | 3300021420 | Soil | RMGQRIRVLVDRIDPVEKKIQFAVFEEKPQRSPKRKRK |
| Ga0210394_113264961 | 3300021420 | Soil | KIRVLVDRIDPVEKKIQFAVLEEAPVRTAGKKRKR |
| Ga0210392_107248991 | 3300021475 | Soil | KIRVLVDRIDPVEKKIQFAVLEEEPVRAKGKERKRKKR |
| Ga0210410_100763731 | 3300021479 | Soil | SMGQRVRVLVDRIDPVEKKIQFAVLEEKPVPKRKKR |
| Ga0210410_104957032 | 3300021479 | Soil | VLVDRIDPVEKKIQFAVLEEEPVRAKGKERKRKKR |
| Ga0210409_111495931 | 3300021559 | Soil | YSLGQRVRVLVDRIDPVEKKIQFALFEEKPALKRKNR |
| Ga0207661_107357793 | 3300025944 | Corn Rhizosphere | DRLRVLVDRIDPVEKKINFAVLEEEPKPRRGKRRKK |
| Ga0209805_11785693 | 3300026542 | Soil | GQRIRVLVDRIDPVEKKIQFAIVEEQKRQTAKRKRR |
| Ga0209577_100670254 | 3300026552 | Soil | YRIGQTIRVLVDRIDPVERKINFAVIEEEPPHRKSRRKRR |
| Ga0209622_10358892 | 3300027502 | Forest Soil | LVDRIDPVEKKIQFAVFEEEPVRAKGKRRKRAAEH |
| Ga0209733_11745061 | 3300027591 | Forest Soil | HLGQKIRVLVDRIDPVEKKIQFAVLEEAPVRTAGKKRKR |
| Ga0208324_11151991 | 3300027604 | Peatlands Soil | GQKIRVLVDRIDPVEKKIQFAVLEEEPVRAKGKRKKRK |
| Ga0208565_12377211 | 3300027662 | Peatlands Soil | RLGQRIRVLVDRIDPVEKKIQFAVWEEEPVRTTGRRKRR |
| Ga0209517_101067814 | 3300027854 | Peatlands Soil | TYSLGNRVRVLVDRIDPVEKKIQFAVLEAQPKPSGKSRRN |
| Ga0209701_101415111 | 3300027862 | Vadose Zone Soil | SRKTFRLGQKVRVLVDRIDPVEKKIQFALLEEIKPRQPKRKRRGLV |
| Ga0209167_106597322 | 3300027867 | Surface Soil | RVLVDRIDPVEKKIQFAVVEEEPVRAKGKERKRKKR |
| Ga0209068_104030803 | 3300027894 | Watersheds | IYSLGQRVRVIVDRIDPVEKKIQFALLEEKPTPKRKNR |
| Ga0209168_104454701 | 3300027986 | Surface Soil | RIGDRLRVIVDRIDPVEKKINFAVMEEARPKREKRRKKK |
| Ga0302224_101300001 | 3300028759 | Palsa | HIGDRLKVLVDRIDPVEKKIQFAVFEEEPPRSGRRKKRTG |
| Ga0310038_101605971 | 3300030707 | Peatlands Soil | YSLGQKIRVLVDRIDPVEKKIQFAVFEEAPVPAQGKRRKKR |
| Ga0310915_112857232 | 3300031573 | Soil | QRTRKIYHIGDRVKVIVDRIDPVEKKINFAVLDDEPAKPAKRRKRK |
| Ga0310686_1093060532 | 3300031708 | Soil | QRIRVLVDRIDPVEKKIQFAVFEEKPQRSPKRKRK |
| Ga0307476_108165133 | 3300031715 | Hardwood Forest Soil | GQHTRKTYGLGDGVRVLVDRIDPVEKKIQFAVLEEEGQPKRSGKSRKK |
| Ga0307476_112231991 | 3300031715 | Hardwood Forest Soil | YSLGQRIRVLVDRIDPVEKKIQFALSVEQPAPKRKRSRN |
| Ga0310917_106450572 | 3300031833 | Soil | QLRVLVDRIDPVEKKVNFAVVEEERPKPAKAKRHKRK |
| Ga0318536_104168191 | 3300031893 | Soil | RRTFRLGQPVQVLVDRIDPVEKKIQFAFYEEAPPTRKRAKRR |
| Ga0310916_103345631 | 3300031942 | Soil | RMKVIVDRIDPVEKKINFAVLEEQPAPSAKRRKRR |
| Ga0308176_104800232 | 3300031996 | Soil | SYRIGDRLRVLVDRIDPVEKKINFAVLEEEPKPRWGKRRKK |
| Ga0308176_129722772 | 3300031996 | Soil | SRRAFRLGEKVHVLVDRIDPVEKKIQFALLYEKRPTAHHRRK |
| Ga0310911_101166292 | 3300032035 | Soil | LGQPVQVLVDRIDPVEKKIQFAFYEEAPPTRKRAKRR |
| Ga0308173_105314451 | 3300032074 | Soil | YRIGDRLRVLIDRIDPVEKKINFAVLEEEPKPRRGKRRKK |
| Ga0311301_122191181 | 3300032160 | Peatlands Soil | TYRLGQKIRVLIDRIDPVEKKIQFAVFEEEPVRAAGRRRKR |
| Ga0335080_121423322 | 3300032828 | Soil | YALGQKVHVLLDRIDPVEKKLQFALVEEVEQRPGKRKRK |
| Ga0335081_104495623 | 3300032892 | Soil | KTYRLGQKVRVIVDRIDPVEKKIQFALLEEEKPRSGTRKRR |
| Ga0335069_101862591 | 3300032893 | Soil | GQQIRVLVDRIDPVEKKIQFALVEERPVRKVGGKKRKK |
| Ga0335076_102183681 | 3300032955 | Soil | YSLGDRVRVLVDRIDPVEKKIQFALYEPPPPLRRPK |
| Ga0335084_102523813 | 3300033004 | Soil | DRVRVLVDRIDPVEKKIQFAVFEEPVVRPAGRCRK |
| Ga0335084_105760781 | 3300033004 | Soil | GDRLRVIVDRIDPVEKKINFAVMEEERPKPAKRRKRR |
| Ga0335084_105790111 | 3300033004 | Soil | IYRIGQQLRVLVDRIDPVEKKINFAVVEEEPPKPARRRKQR |
| Ga0335077_104601594 | 3300033158 | Soil | TFRLGQRVHVLVDRIDPVEKKIQFALMEGVRPAPRRR |
| ⦗Top⦘ |