


| Basic Information | |
|---|---|
| Family ID | F082950 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 113 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MAARLRSTSSSVVAQDETLIRIAVRPCQTVPPHQHVPS |
| Number of Associated Samples | 104 |
| Number of Associated Scaffolds | 113 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 41.59 % |
| % of genes near scaffold ends (potentially truncated) | 96.46 % |
| % of genes from short scaffolds (< 2000 bps) | 90.27 % |
| Associated GOLD sequencing projects | 100 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (80.531 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (7.080 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.549 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.133 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 34.85% β-sheet: 0.00% Coil/Unstructured: 65.15% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 113 Family Scaffolds |
|---|---|---|
| PF06271 | RDD | 7.96 |
| PF08002 | DUF1697 | 5.31 |
| PF07883 | Cupin_2 | 2.65 |
| PF12867 | DinB_2 | 2.65 |
| PF07729 | FCD | 1.77 |
| PF00704 | Glyco_hydro_18 | 1.77 |
| PF00440 | TetR_N | 1.77 |
| PF12792 | CSS-motif | 1.77 |
| PF00266 | Aminotran_5 | 1.77 |
| PF00005 | ABC_tran | 1.77 |
| PF13450 | NAD_binding_8 | 1.77 |
| PF02518 | HATPase_c | 1.77 |
| PF00206 | Lyase_1 | 0.88 |
| PF02627 | CMD | 0.88 |
| PF01436 | NHL | 0.88 |
| PF06674 | DUF1176 | 0.88 |
| PF01177 | Asp_Glu_race | 0.88 |
| PF07221 | GlcNAc_2-epim | 0.88 |
| PF05235 | CHAD | 0.88 |
| PF12680 | SnoaL_2 | 0.88 |
| PF11918 | Peptidase_S41_N | 0.88 |
| PF13103 | TonB_2 | 0.88 |
| PF00903 | Glyoxalase | 0.88 |
| PF11902 | DUF3422 | 0.88 |
| PF04542 | Sigma70_r2 | 0.88 |
| PF00156 | Pribosyltran | 0.88 |
| PF13180 | PDZ_2 | 0.88 |
| PF03459 | TOBE | 0.88 |
| PF17137 | DUF5110 | 0.88 |
| PF01346 | FKBP_N | 0.88 |
| PF04480 | DUF559 | 0.88 |
| PF02954 | HTH_8 | 0.88 |
| PF08327 | AHSA1 | 0.88 |
| PF05694 | SBP56 | 0.88 |
| PF01850 | PIN | 0.88 |
| PF04909 | Amidohydro_2 | 0.88 |
| PF07589 | PEP-CTERM | 0.88 |
| PF00480 | ROK | 0.88 |
| PF06559 | DCD | 0.88 |
| PF06723 | MreB_Mbl | 0.88 |
| PF01872 | RibD_C | 0.88 |
| PF04519 | Bactofilin | 0.88 |
| PF13644 | DKNYY | 0.88 |
| PF02574 | S-methyl_trans | 0.88 |
| PF07730 | HisKA_3 | 0.88 |
| PF02146 | SIR2 | 0.88 |
| PF03466 | LysR_substrate | 0.88 |
| PF01197 | Ribosomal_L31 | 0.88 |
| PF05746 | DALR_1 | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
|---|---|---|---|
| COG1714 | Uncharacterized membrane protein YckC, RDD family | Function unknown [S] | 7.96 |
| COG3797 | Uncharacterized conserved protein, DUF1697 family | Function unknown [S] | 5.31 |
| COG1802 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 1.77 |
| COG1940 | Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domain | Transcription [K] | 1.77 |
| COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 1.77 |
| COG0018 | Arginyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.88 |
| COG0254 | Ribosomal protein L31 | Translation, ribosomal structure and biogenesis [J] | 0.88 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.88 |
| COG0545 | FKBP-type peptidyl-prolyl cis-trans isomerase | Posttranslational modification, protein turnover, chaperones [O] | 0.88 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.88 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.88 |
| COG0646 | Methionine synthase I (cobalamin-dependent), methyltransferase domain | Amino acid transport and metabolism [E] | 0.88 |
| COG0717 | dCTP deaminase | Nucleotide transport and metabolism [F] | 0.88 |
| COG0751 | Glycyl-tRNA synthetase, beta subunit | Translation, ribosomal structure and biogenesis [J] | 0.88 |
| COG0846 | NAD-dependent protein deacetylase, SIR2 family | Posttranslational modification, protein turnover, chaperones [O] | 0.88 |
| COG1077 | Cell shape-determining ATPase MreB, actin-like superfamily | Cell cycle control, cell division, chromosome partitioning [D] | 0.88 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.88 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.88 |
| COG1664 | Cytoskeletal protein CcmA, bactofilin family | Cytoskeleton [Z] | 0.88 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.88 |
| COG2040 | Homocysteine/selenocysteine methylase (S-methylmethionine-dependent) | Amino acid transport and metabolism [E] | 0.88 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.88 |
| COG2942 | Mannose or cellobiose epimerase, N-acyl-D-glucosamine 2-epimerase family | Carbohydrate transport and metabolism [G] | 0.88 |
| COG3025 | Inorganic triphosphatase YgiF, contains CYTH and CHAD domains | Inorganic ion transport and metabolism [P] | 0.88 |
| COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.88 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.88 |
| COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.88 |
| COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.88 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.88 |
| COG5607 | CHAD domain, binds inorganic polyphosphates | Function unknown [S] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 80.53 % |
| Unclassified | root | N/A | 19.47 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908039|B3_v_NODE_125812_len_9783_cov_10_237043 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 9833 | Open in IMG/M |
| 3300000789|JGI1027J11758_11868837 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300000887|AL16A1W_10447911 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 897 | Open in IMG/M |
| 3300000955|JGI1027J12803_105647127 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1070 | Open in IMG/M |
| 3300001538|A10PFW1_10165655 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 696 | Open in IMG/M |
| 3300002128|JGI24036J26619_10083015 | Not Available | 644 | Open in IMG/M |
| 3300004184|Ga0066401_1099044 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 523 | Open in IMG/M |
| 3300004481|Ga0069718_15228831 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2295 | Open in IMG/M |
| 3300004594|Ga0068976_1204378 | All Organisms → cellular organisms → Bacteria | 1870 | Open in IMG/M |
| 3300005175|Ga0066673_10430802 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 773 | Open in IMG/M |
| 3300005331|Ga0070670_100935799 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → Lysobacter enzymogenes | 787 | Open in IMG/M |
| 3300005335|Ga0070666_10602391 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter | 802 | Open in IMG/M |
| 3300005364|Ga0070673_100479670 | Not Available | 1122 | Open in IMG/M |
| 3300005539|Ga0068853_100777578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Arenimonas → Arenimonas oryziterrae → Arenimonas oryziterrae DSM 21050 = YC6267 | 916 | Open in IMG/M |
| 3300005540|Ga0066697_10781329 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
| 3300005553|Ga0066695_10300832 | All Organisms → cellular organisms → Bacteria | 1011 | Open in IMG/M |
| 3300005718|Ga0068866_10760283 | Not Available | 670 | Open in IMG/M |
| 3300005764|Ga0066903_105606725 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 661 | Open in IMG/M |
| 3300005841|Ga0068863_101157030 | Not Available | 779 | Open in IMG/M |
| 3300005841|Ga0068863_101618984 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter | 657 | Open in IMG/M |
| 3300005921|Ga0070766_10168571 | All Organisms → cellular organisms → Bacteria | 1352 | Open in IMG/M |
| 3300005994|Ga0066789_10346785 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 620 | Open in IMG/M |
| 3300005995|Ga0066790_10047447 | All Organisms → cellular organisms → Bacteria | 1860 | Open in IMG/M |
| 3300006176|Ga0070765_101617871 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 609 | Open in IMG/M |
| 3300006846|Ga0075430_101516395 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 551 | Open in IMG/M |
| 3300006854|Ga0075425_102814731 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300006876|Ga0079217_10382268 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfobotulus | 822 | Open in IMG/M |
| 3300006880|Ga0075429_101131840 | Not Available | 684 | Open in IMG/M |
| 3300007255|Ga0099791_10183395 | All Organisms → cellular organisms → Bacteria | 984 | Open in IMG/M |
| 3300009012|Ga0066710_101202286 | All Organisms → cellular organisms → Bacteria | 1174 | Open in IMG/M |
| 3300009012|Ga0066710_103100824 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 643 | Open in IMG/M |
| 3300009012|Ga0066710_103455789 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium A1 | 599 | Open in IMG/M |
| 3300009038|Ga0099829_10577993 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 934 | Open in IMG/M |
| 3300009078|Ga0105106_10007249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Hydrocarboniphaga | 7965 | Open in IMG/M |
| 3300009166|Ga0105100_10061712 | All Organisms → cellular organisms → Bacteria | 2177 | Open in IMG/M |
| 3300009167|Ga0113563_11372003 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300009169|Ga0105097_10468930 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300009638|Ga0116113_1137432 | Not Available | 607 | Open in IMG/M |
| 3300009816|Ga0105076_1099643 | Not Available | 563 | Open in IMG/M |
| 3300010358|Ga0126370_12242640 | Not Available | 539 | Open in IMG/M |
| 3300011028|Ga0138577_100872 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1684 | Open in IMG/M |
| 3300011112|Ga0114947_10478097 | Not Available | 883 | Open in IMG/M |
| 3300012014|Ga0120159_1207898 | Not Available | 519 | Open in IMG/M |
| 3300012198|Ga0137364_11036089 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 619 | Open in IMG/M |
| 3300012362|Ga0137361_10737755 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
| 3300014165|Ga0181523_10152875 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1357 | Open in IMG/M |
| 3300014165|Ga0181523_10828314 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300014495|Ga0182015_10181391 | All Organisms → cellular organisms → Bacteria | 1415 | Open in IMG/M |
| 3300015359|Ga0134085_10254492 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 765 | Open in IMG/M |
| 3300016294|Ga0182041_12003480 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300017792|Ga0163161_11661627 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
| 3300018003|Ga0187876_1154429 | Not Available | 800 | Open in IMG/M |
| 3300018042|Ga0187871_10340468 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300018059|Ga0184615_10430676 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300018086|Ga0187769_10094526 | All Organisms → cellular organisms → Bacteria | 2141 | Open in IMG/M |
| 3300018086|Ga0187769_10373365 | All Organisms → cellular organisms → Bacteria | 1071 | Open in IMG/M |
| 3300018432|Ga0190275_10136167 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Sphaerobacteridae → Sphaerobacterales → Sphaerobacterineae → Sphaerobacteraceae | 2241 | Open in IMG/M |
| 3300018432|Ga0190275_13571893 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300018482|Ga0066669_10940875 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300018482|Ga0066669_11897124 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 554 | Open in IMG/M |
| 3300019786|Ga0182025_1019179 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 1221 | Open in IMG/M |
| 3300019885|Ga0193747_1051005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1028 | Open in IMG/M |
| 3300020170|Ga0179594_10169902 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300020581|Ga0210399_11229674 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
| 3300021168|Ga0210406_10916200 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300021358|Ga0213873_10220770 | Not Available | 593 | Open in IMG/M |
| 3300021401|Ga0210393_10558427 | Not Available | 935 | Open in IMG/M |
| 3300021403|Ga0210397_10759525 | Not Available | 747 | Open in IMG/M |
| 3300021560|Ga0126371_11743693 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 745 | Open in IMG/M |
| 3300022226|Ga0224512_10054414 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2369 | Open in IMG/M |
| 3300022724|Ga0242665_10288083 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300025864|Ga0209429_10163640 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter | 927 | Open in IMG/M |
| 3300025899|Ga0207642_10189710 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1127 | Open in IMG/M |
| 3300025924|Ga0207694_11303713 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → Lysobacter enzymogenes | 614 | Open in IMG/M |
| 3300025935|Ga0207709_10758081 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300025935|Ga0207709_11654661 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 532 | Open in IMG/M |
| 3300025938|Ga0207704_10734153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax → unclassified Rubrivivax → Rubrivivax sp. | 820 | Open in IMG/M |
| 3300026035|Ga0207703_11980908 | Not Available | 559 | Open in IMG/M |
| 3300026078|Ga0207702_11518634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → Lysobacter enzymogenes | 663 | Open in IMG/M |
| 3300026121|Ga0207683_11014213 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300026343|Ga0209159_1095825 | All Organisms → cellular organisms → Bacteria | 1300 | Open in IMG/M |
| 3300026467|Ga0257154_1045793 | Not Available | 673 | Open in IMG/M |
| 3300026523|Ga0209808_1250539 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 565 | Open in IMG/M |
| 3300027371|Ga0209418_1105551 | Not Available | 505 | Open in IMG/M |
| 3300027765|Ga0209073_10096251 | All Organisms → cellular organisms → Bacteria | 1039 | Open in IMG/M |
| 3300027846|Ga0209180_10127180 | All Organisms → cellular organisms → Bacteria | 1463 | Open in IMG/M |
| 3300027853|Ga0209274_10008414 | All Organisms → cellular organisms → Bacteria | 4662 | Open in IMG/M |
| 3300027857|Ga0209166_10684319 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300027871|Ga0209397_10030142 | Not Available | 1830 | Open in IMG/M |
| 3300027871|Ga0209397_10416368 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 659 | Open in IMG/M |
| 3300027909|Ga0209382_11782520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfobotulus | 600 | Open in IMG/M |
| 3300028145|Ga0247663_1076463 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300028380|Ga0268265_10190488 | All Organisms → cellular organisms → Bacteria | 1770 | Open in IMG/M |
| 3300028381|Ga0268264_10401149 | Not Available | 1318 | Open in IMG/M |
| 3300028745|Ga0302267_10154827 | Not Available | 1056 | Open in IMG/M |
| 3300028775|Ga0302231_10153590 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 961 | Open in IMG/M |
| 3300028813|Ga0302157_10726505 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| 3300028824|Ga0307310_10031835 | All Organisms → cellular organisms → Bacteria | 2123 | Open in IMG/M |
| 3300029952|Ga0311346_10026727 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 9003 | Open in IMG/M |
| 3300029999|Ga0311339_11284318 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 665 | Open in IMG/M |
| 3300030693|Ga0302313_10031027 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Methylibium → unclassified Methylibium → Methylibium sp. NZG | 2487 | Open in IMG/M |
| 3300030943|Ga0311366_10694854 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
| 3300031235|Ga0265330_10109857 | All Organisms → cellular organisms → Bacteria | 1178 | Open in IMG/M |
| 3300031802|Ga0310123_10611873 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Prosthecobacter → Prosthecobacter debontii | 672 | Open in IMG/M |
| 3300031823|Ga0307478_11027949 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300031852|Ga0307410_10516784 | Not Available | 985 | Open in IMG/M |
| 3300031995|Ga0307409_101854070 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300032000|Ga0310903_10501107 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 634 | Open in IMG/M |
| 3300032009|Ga0318563_10472759 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300032261|Ga0306920_103736416 | Not Available | 558 | Open in IMG/M |
| 3300033405|Ga0326727_10404912 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter savannae | 1249 | Open in IMG/M |
| 3300033413|Ga0316603_10878096 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 844 | Open in IMG/M |
| 3300033482|Ga0316627_102756793 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.08% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.31% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.42% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.54% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.54% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.65% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 2.65% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.65% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.65% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.65% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.65% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.65% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 1.77% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.77% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.77% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.77% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.77% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.77% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.77% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.77% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.77% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.77% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.77% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.89% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.89% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.89% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.89% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.89% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.89% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.89% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.89% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.89% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.89% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.89% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.89% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.89% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.89% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.89% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.89% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.89% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.89% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.89% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.89% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908039 | Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Bog Site B4 | Environmental | Open in IMG/M |
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000887 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-65cm-16A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001538 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300002128 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Environmental | Open in IMG/M |
| 3300004184 | Freshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metagenome 1_LOW4 | Environmental | Open in IMG/M |
| 3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
| 3300004594 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 73 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009166 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009638 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 | Environmental | Open in IMG/M |
| 3300009816 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300011028 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 64 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011112 | Deep subsurface microbial communities from Mariana Trench to uncover new lineages of life (NeLLi) - CR02 metaG | Environmental | Open in IMG/M |
| 3300012014 | Permafrost microbial communities from Nunavut, Canada - A10_80cm_6M | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018003 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_40 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018059 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coex | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Host-Associated | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022226 | Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_13 | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025864 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-212 (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300026467 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-A | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300027371 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027871 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028145 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK04 | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028745 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_3 | Environmental | Open in IMG/M |
| 3300028775 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2 | Environmental | Open in IMG/M |
| 3300028813 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_3 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300029952 | II_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030693 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_2 | Environmental | Open in IMG/M |
| 3300030943 | III_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Host-Associated | Open in IMG/M |
| 3300031802 | Marine microbial communities from Western Arctic Ocean, Canada - CB6_AW_1057 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| 3300033413 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT | Environmental | Open in IMG/M |
| 3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B3_v_00494240 | 2124908039 | Soil | MRIIAARLRSTSSCVVAHDETLMRIAVRPCQTVRPA |
| JGI1027J11758_118688372 | 3300000789 | Soil | MAARLSWMSASVVAQLETETRIAVWPCHSVGPHQQVP |
| AL16A1W_104479112 | 3300000887 | Permafrost | MRMIASALLSMSAAVVAQEDTLIRIAARPCHSVPPHQQVP |
| JGI1027J12803_1056471271 | 3300000955 | Soil | MASTLRATSSAVVAHELTLMRIAARPCQRVGPHQHV |
| A10PFW1_101656552 | 3300001538 | Permafrost | MRMIASALLSMSAAVVAQEDTLIRIAARPCHSVPPHQQVPS |
| JGI24036J26619_100830151 | 3300002128 | Corn, Switchgrass And Miscanthus Rhizosphere | MASTERSTSSSVVAQEITLTRIAVTPCQMVTPHQHVP |
| Ga0066401_10990441 | 3300004184 | Freshwater Sediment | MASMLRSTSASVVAQEQTLMRIAARPCQRLPPHQQVPSAWSSS |
| Ga0069718_152288313 | 3300004481 | Sediment | MAAALRSTSASVVAHEQTLIRIAVCPCQTVPPHQHVPSAWI |
| Ga0068976_12043782 | 3300004594 | Peatlands Soil | MAVRLFSTSSALVAQEDTLIRMAFLPCQTVPPHQQVPSARISSITF* |
| Ga0066673_104308023 | 3300005175 | Soil | MGKPNRYARAMRIIAARLCSTSCSVVAQDETLMRIAVRPCHTVPPHQQV |
| Ga0070670_1009357991 | 3300005331 | Switchgrass Rhizosphere | MLFSTSSSVVAHDDTLIRIAVSPCQTVPPHQHVPSSWIAAI |
| Ga0070666_106023912 | 3300005335 | Switchgrass Rhizosphere | MPRAIRTMACALRSASASVVAHDETLIRMAVRPCHSVGPHQHVPSSWMAAI |
| Ga0070673_1004796703 | 3300005364 | Switchgrass Rhizosphere | MIASIERSTSASVVAHEMTLTRIAVRPCHTVGPHQHVPSS |
| Ga0068853_1007775782 | 3300005539 | Corn Rhizosphere | MDRATRKIAAMLRSMSSSVVAQDETLMRIAVRPCQTVPPHQQ |
| Ga0066697_107813291 | 3300005540 | Soil | MRIIACRLRFTSVSVVAQDDTLIRIAVFPCHTVPPHQQVPSSW |
| Ga0066695_103008321 | 3300005553 | Soil | MSPATRIIASRLRSTSSSVVAHDETLIRMAVCPCHTVAPAQH |
| Ga0068866_107602831 | 3300005718 | Miscanthus Rhizosphere | MAAMEASTSASVVAQEMTLTRIAVLPCHTVTPHQH |
| Ga0066903_1056067252 | 3300005764 | Tropical Forest Soil | MAETLFSMSASVVDQLLTLMRIAVRPFHTVPPHQQVPS |
| Ga0068863_1011570301 | 3300005841 | Switchgrass Rhizosphere | MRRIARKLRSISASVVAQEETLMRMAARPCHSVGPHQ |
| Ga0068863_1016189841 | 3300005841 | Switchgrass Rhizosphere | MPRATRTMACALRSASSSVVAHDETLIRIAVRPCQRVGPHQHVPSSCMAA |
| Ga0070766_101685711 | 3300005921 | Soil | MASRLSSTSASVVAQEETLTLIADFPCHTVPPHQHVPS |
| Ga0066789_103467851 | 3300005994 | Soil | VAALRSTSSSVVAQQETEIRMAVCPCQTVPPHQQV |
| Ga0066790_100474471 | 3300005995 | Soil | MAARLCSTSASVVAQLHTLMRIAVRPCQTVPPHQQ |
| Ga0070765_1016178711 | 3300006176 | Soil | MAAMLRSTSSSVVAQLETLMRIAVWPCHWVAPHQQVPS |
| Ga0075430_1015163952 | 3300006846 | Populus Rhizosphere | MTSAQRSTSASVVAQLDTEKRSAGRPCQTVPPAQNVPS |
| Ga0075425_1028147312 | 3300006854 | Populus Rhizosphere | VVLLSMSSSVVDQLLTLMRMAVRPFQTVPPHQQVPS |
| Ga0079217_103822681 | 3300006876 | Agricultural Soil | MLCATSASVVAHDETLMRIAMVPCHDVPPHQHVPSCWIAA |
| Ga0075429_1011318401 | 3300006880 | Populus Rhizosphere | MLTSTSWVVVAHDEMLMRIAARPCHSVPPHQQVPS |
| Ga0099791_101833952 | 3300007255 | Vadose Zone Soil | MRKIACRLYSTSDSVVAQDDTLIRMAGFPCQTVPPHQQVP |
| Ga0066710_1012022862 | 3300009012 | Grasslands Soil | MLRSTSAAVVAQDETLIRMAWRPCQTVPPHQQVPSRWTDATTRVV |
| Ga0066710_1031008241 | 3300009012 | Grasslands Soil | MSPATRIIASRLRSTSSSVVAHDETLIRMAVCPCHTVAPAQHV |
| Ga0066710_1034557891 | 3300009012 | Grasslands Soil | MAAATRIIASRLRSTSSSVVAHDETLIRMAVCPCHTVAPAQHV |
| Ga0099829_105779932 | 3300009038 | Vadose Zone Soil | MAAKLASTSSSVVAQDETLMRIAVCLCHSVPPHQQV |
| Ga0105106_100072491 | 3300009078 | Freshwater Sediment | MAAALRSTSASVVAHEQTLIRIAVCPCQTVPPHQHVPSAWIAS |
| Ga0105100_100617121 | 3300009166 | Freshwater Sediment | MPMIAFSLFFSSFSVAAQEDTLLRIAVRPCQTVPPHEEVR |
| Ga0113563_113720031 | 3300009167 | Freshwater Wetlands | MASMLLETSRSVVAHEETLILIARRPCQVVPPHQQVPSAWMPAMTR |
| Ga0105097_104689301 | 3300009169 | Freshwater Sediment | MAAALRSTSASVVAHEQTLIRIAVCPCQTVPPHQHVPSAW |
| Ga0116113_11374322 | 3300009638 | Peatland | MLRSTSSSVVAHDETLILIAVCPCHTVDPHQQVPSAC |
| Ga0105076_10996431 | 3300009816 | Groundwater Sand | MACTLRSTSASVVAQDETLIRIAVRPCHSVSPQKQVPSA |
| Ga0126370_122426401 | 3300010358 | Tropical Forest Soil | MADMERSISPSVVAQELTLMRIAARPLQLVPPHQQVPASW |
| Ga0138577_1008721 | 3300011028 | Peatlands Soil | MAVRLFSTSSAVVAQEDTLIRMAFLPCQTVPPHQQ |
| Ga0114947_104780971 | 3300011112 | Deep Subsurface | MIAVSDASTSASVVAHDETLILIAARPRQTVPAHQHVPSSCTPAI |
| Ga0120159_12078981 | 3300012014 | Permafrost | MRMIASALLSMSAAVVAQEDTLIRIAARPCHSVPPHQQVPSSC |
| Ga0137364_110360892 | 3300012198 | Vadose Zone Soil | MRIIACRLRSTSVSVVAQDDTLIRIAVFPCHTVPPHQQV |
| Ga0137361_107377552 | 3300012362 | Vadose Zone Soil | MASRLRSTSVSVVAQEDTLIRIAVFPCQTVPPHQQVPSSWTR |
| Ga0181523_101528752 | 3300014165 | Bog | MAVRLISTSSSDVTHEETLIRIAGRPRHSVPPHQQVP |
| Ga0181523_108283141 | 3300014165 | Bog | MASRLRSTSSAVVAQEATLIRIAVRPCQVVGPHQQVPSRWMRSITC |
| Ga0182015_101813911 | 3300014495 | Palsa | MAATLRSTSSLVVAQLDTLMRIAACPCQWVPPHQQ |
| Ga0134085_102544923 | 3300015359 | Grasslands Soil | MSPATRIIASRLRSTSSSVVAHDETLIRMAVCPCHTVAPAQ |
| Ga0182041_120034802 | 3300016294 | Soil | MAAKLRSTSAPVVAHEEMLMRMAGCPCQTVGPRCGHT |
| Ga0163161_116616271 | 3300017792 | Switchgrass Rhizosphere | MRVIAARLVSTSSSVVAHEDTLIRMAGWPRQVVPPHQHVPSR |
| Ga0187876_11544292 | 3300018003 | Peatland | MACRLRSTSAAVVAHEDTLIRIAVRPCHVVAPHQQVPSCWMRSIT |
| Ga0187871_103404681 | 3300018042 | Peatland | MLSLAAFRIAARLFSTSASVVAQDDTLIRIAVFPCQTVPPHQHVPS |
| Ga0184615_104306761 | 3300018059 | Groundwater Sediment | MLLSTSASVVAHELTLMRMAVRPCHTVLPHQHVPSR |
| Ga0187769_100945261 | 3300018086 | Tropical Peatland | MLRSTSSSVVDQLLTLMRMDARPFHTVPPHQHVPSSWMAA |
| Ga0187769_103733651 | 3300018086 | Tropical Peatland | MMLAKERSTSSSVVAQEDRLIRMAVRPCHTVPPHQH |
| Ga0190275_101361673 | 3300018432 | Soil | MTIRATRTIAARLRSTSSSVVAQDETLIRIAARPCQVVPPHQQVPS |
| Ga0190275_135718931 | 3300018432 | Soil | MLRSTSSSVVAHDETDIRIARLPCQVVPPAQQVPSDWT |
| Ga0066669_109408751 | 3300018482 | Grasslands Soil | MGKPNRYARAMRIIAARLCSTSCSVVAQDETLMRIAVRPCHTVPPHQQVP |
| Ga0066669_118971241 | 3300018482 | Grasslands Soil | MAAALRSTSASVVAALHTLMRMAVEPCHTVPPAQQVP |
| Ga0182025_10191791 | 3300019786 | Permafrost | LFYSSAALIIAARLRSTSSLLVTQDETLIRIAVFPCHTVEPHQQVFPQ |
| Ga0193747_10510051 | 3300019885 | Soil | MIASALLSMSASVVAHEDTLIRIAARPCHSVPPHQQ |
| Ga0179594_101699022 | 3300020170 | Vadose Zone Soil | MAARLRCTSSSVVAQEETLMRIAVLPCQTVPAHQQVPSSWMRRIT |
| Ga0210399_112296742 | 3300020581 | Soil | MRIIAAWLRSTSSSVVSQLDRLIRIAVLPCHCVPPHQQVPSFCN |
| Ga0210406_109162001 | 3300021168 | Soil | MRMMAPRLLSTSVSVVAQEQTLMRIAVFPCHTVAPHQH |
| Ga0213873_102207702 | 3300021358 | Rhizosphere | MAARLISTSSSLVAQEETLMRMAGRPCHSVPPHQH |
| Ga0210393_105584273 | 3300021401 | Soil | MRTMAARLRTTSSLVVAQEDTLMRIAVFPCHTVPLHQQVPSS |
| Ga0210397_107595251 | 3300021403 | Soil | MIAWTLRSTSSAVVIHDEMLIRIAVCPCQTVLPHQHVPSSWTL |
| Ga0126371_117436931 | 3300021560 | Tropical Forest Soil | MLFSISSSVVDQLLTLMRMAVRPFHTVPPHQQVPSSCMAEMTRRVC |
| Ga0224512_100544144 | 3300022226 | Sediment | MAARLRSTSAVVVDQFETLMRIAVFPCQTVTPHQHVPS |
| Ga0242665_102880831 | 3300022724 | Soil | MAARLCSTSSSVVAHEETLIRMAVFPCQTVPPHQQVPS |
| Ga0209429_101636401 | 3300025864 | Arctic Peat Soil | MASRLRSTSASVVAHEETLMRIATRPCHSVGPHQQ |
| Ga0207642_101897102 | 3300025899 | Miscanthus Rhizosphere | MAAMLRSTSASVVAQDETLIRIATLPCQSVLPHQQLPSSCKR |
| Ga0207694_113037131 | 3300025924 | Corn Rhizosphere | MLFSTSSSVVAHDDTLIRIAVSPCQTVPPHQHVPSSWIAAIT |
| Ga0207709_107580812 | 3300025935 | Miscanthus Rhizosphere | MRKMAAMERSTSASVVAHEITLTRIAVRPCHAVAPHQHVPS |
| Ga0207709_116546611 | 3300025935 | Miscanthus Rhizosphere | MLRPTSSSVVAHDDTLMRIAARPRQRVGPHQQVPSACS |
| Ga0207704_107341532 | 3300025938 | Miscanthus Rhizosphere | MAARLRRTSASVVAHEDTLMRIATRPCHCVSPHQQVPSACT |
| Ga0207703_119809082 | 3300026035 | Switchgrass Rhizosphere | MAATEASTSASVVAQEMTLTRIAVLPCHTVTPHQHVPSA |
| Ga0207702_115186341 | 3300026078 | Corn Rhizosphere | MLFSTSSSVVAHDDTLIRIAVSPCQTVPPHQHVPSSWIAAITRC |
| Ga0207683_110142131 | 3300026121 | Miscanthus Rhizosphere | MMPRATRTMAWALRSASSSVVAHDETLIRIAVRPCHNVGPHQQVPSSCM |
| Ga0209159_10958253 | 3300026343 | Soil | MSPATRIIASRLRSTSSSVVAHDETLIRMAVCPCHTVAPAQHVP |
| Ga0257154_10457932 | 3300026467 | Soil | VARAIRIMAAKLRSTSSVVAAQEETLMRIAVFACQTVPLHQQ |
| Ga0209808_12505392 | 3300026523 | Soil | MSPATRIIASKLRSTSSSVVAHDETLIRMAVCPCHTVAPAQHVPSA |
| Ga0209418_11055511 | 3300027371 | Forest Soil | MTLFATLTIAAALFSTSSSVVAQLETEIRMAVCPCHTVPPRQQVP |
| Ga0209073_100962511 | 3300027765 | Agricultural Soil | MLFSTSASVVDQLLTLIRIAARPFHVVPPHQQTPS |
| Ga0209180_101271801 | 3300027846 | Vadose Zone Soil | MASKLRSTSSSVVAHEEMLMRMAVRPCQTVPPAQQ |
| Ga0209274_100084146 | 3300027853 | Soil | MPTIAARLRSTSSAVVAQEDTLMRIAVFPCQTVPLHQQVPSSCMR |
| Ga0209166_106843192 | 3300027857 | Surface Soil | MAAMRIMASTLRSISSSVVAQQETEMRMAVCPCHTVPPHQQVP |
| Ga0209397_100301421 | 3300027871 | Wetland | MLRSTSSSVVAHEHTLIRIAVRPCHTVPPHQQVPSACTAEMPC |
| Ga0209397_104163683 | 3300027871 | Wetland | MLSSTSASVVAQEQTLMRMAVRPCQTVPPHQQVPSCCT |
| Ga0209382_117825202 | 3300027909 | Populus Rhizosphere | MLCATSASVVAHDETLIRIAVFPCHEVPPHQQVPSCWIRAMT |
| Ga0247663_10764631 | 3300028145 | Soil | MAARLSWMSASVVAQLETDTRIAVWPCHSVGPHQQVPSAWTSRIT |
| Ga0268265_101904881 | 3300028380 | Switchgrass Rhizosphere | MASTERSTSSSVVAQEITLTRIAVTPCQTVTPHQH |
| Ga0268264_104011492 | 3300028381 | Switchgrass Rhizosphere | MASTLRSTSASVVAHEHTLMRIAVRFCQTVTPHQQVPSV |
| Ga0302267_101548271 | 3300028745 | Bog | MAARLRSTSSVVVAQLDTLMRMAVCPCHTVDPHQHVPTACKRA |
| Ga0302231_101535901 | 3300028775 | Palsa | MRTMAAMLRSTSAPVVDQLLTLILMAVRPCQTVIPHQQVPSA |
| Ga0302157_107265051 | 3300028813 | Bog | MAARLRSTSSLVVAHDDTLMRIAVFPCHTVGPHQQVPS |
| Ga0307310_100318351 | 3300028824 | Soil | MAARLRSTSSSVVAQDETLIRIAVRPCQTVPPHQHVPS |
| Ga0311346_1002672710 | 3300029952 | Bog | MAATLLSTSSSVVAHELTLMRMAVLPCHTVMPHQQVPSAWIASIA |
| Ga0311339_112843182 | 3300029999 | Palsa | MAAALRSTSASVVAHELTLIRIAVRPCQTVMPHQQVP |
| Ga0302313_100310271 | 3300030693 | Palsa | MAAMLRVTSSSVVAHEQTLMRIAVRPCQRVGPHQH |
| Ga0311366_106948541 | 3300030943 | Fen | MAARLASTSSLVVAHDETLIRIAVRPCHSVPPHQQVP |
| Ga0265330_101098572 | 3300031235 | Rhizosphere | VAAVSCRAERIIASRLRSTSAAVVAQDETLIRIAARPCQTVPPHQHVPS |
| Ga0310123_106118732 | 3300031802 | Marine | MRTMASRLFATSASVVAQEETLMRIAVIPCHWVPPHQV |
| Ga0307478_110279491 | 3300031823 | Hardwood Forest Soil | MRIIASKLRSTSFSVVAQEDTLIRIAVFPCQTVPPHQ |
| Ga0307410_105167841 | 3300031852 | Rhizosphere | MRIIASSERSTSSSVVAHDETLMRITARPFHTLPPHQLVP |
| Ga0307409_1018540701 | 3300031995 | Rhizosphere | MRIIASSERSTSSSVVAHDETLMRITARPFHTLPPHQHVPSR |
| Ga0310903_105011071 | 3300032000 | Soil | MRSIAARLRSTSSSVVAHETTLIRIAVRPCHVDGPHQHVPSSWM |
| Ga0318563_104727591 | 3300032009 | Soil | MARSTSSAVVAQQLTLIRIAARPRQAVPPHQQVPASWM |
| Ga0306920_1037364161 | 3300032261 | Soil | MTAMLRSTSASVVAQEDTLIRIATRPCQSVPPHQQV |
| Ga0326727_104049121 | 3300033405 | Peat Soil | MAARLRSTSSFVVAQLDTLMRMAVCPCHTVDPHQQVP |
| Ga0316603_108780963 | 3300033413 | Soil | MLSSTSASVVAQEQTLMRMAVRPCQTVPPHQQVPSSCT |
| Ga0316627_1027567931 | 3300033482 | Soil | MLSSTSASVVAQEQTLMRMAVRPCQTVPPHQHVPSSCTAAI |
| ⦗Top⦘ |