


| Basic Information | |
|---|---|
| Family ID | F082929 |
| Family Type | Metagenome |
| Number of Sequences | 113 |
| Average Sequence Length | 39 residues |
| Representative Sequence | AAREAREPRERHTPQFLQRPTAPQRAGAGAPLDDDDDFED |
| Number of Associated Samples | 97 |
| Number of Associated Scaffolds | 113 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.12 % |
| % of genes from short scaffolds (< 2000 bps) | 94.69 % |
| Associated GOLD sequencing projects | 93 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.25 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (51.327 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (32.743 % of family members) |
| Environment Ontology (ENVO) | Unclassified (39.823 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.903 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 5.88% β-sheet: 0.00% Coil/Unstructured: 94.12% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.25 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 113 Family Scaffolds |
|---|---|---|
| PF03167 | UDG | 40.71 |
| PF08534 | Redoxin | 8.85 |
| PF00392 | GntR | 1.77 |
| PF03401 | TctC | 0.88 |
| PF04392 | ABC_sub_bind | 0.88 |
| PF10431 | ClpB_D2-small | 0.88 |
| PF07508 | Recombinase | 0.88 |
| PF01668 | SmpB | 0.88 |
| PF01425 | Amidase | 0.88 |
| PF04430 | DUF498 | 0.88 |
| PF02668 | TauD | 0.88 |
| PF13649 | Methyltransf_25 | 0.88 |
| PF00300 | His_Phos_1 | 0.88 |
| PF02518 | HATPase_c | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
|---|---|---|---|
| COG0692 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 40.71 |
| COG1573 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 40.71 |
| COG3663 | G:T/U-mismatch repair DNA glycosylase | Replication, recombination and repair [L] | 40.71 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.88 |
| COG0691 | tmRNA-binding protein | Posttranslational modification, protein turnover, chaperones [O] | 0.88 |
| COG1504 | Uncharacterized conserved protein, DUF498 domain | Function unknown [S] | 0.88 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.88 |
| COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.88 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.88 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.88 |
| COG3737 | Uncharacterized protein, contains Mth938-like domain | Function unknown [S] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 51.33 % |
| All Organisms | root | All Organisms | 48.67 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459012|GOYVCMS02IZOM9 | Not Available | 540 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10033952 | Not Available | 1188 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10041849 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1044 | Open in IMG/M |
| 3300005332|Ga0066388_104385716 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 719 | Open in IMG/M |
| 3300005439|Ga0070711_100677148 | Not Available | 867 | Open in IMG/M |
| 3300005713|Ga0066905_100522275 | Not Available | 991 | Open in IMG/M |
| 3300005719|Ga0068861_101582866 | Not Available | 645 | Open in IMG/M |
| 3300005764|Ga0066903_104596046 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 735 | Open in IMG/M |
| 3300006038|Ga0075365_10155072 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris | 1594 | Open in IMG/M |
| 3300006046|Ga0066652_101846837 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 544 | Open in IMG/M |
| 3300006178|Ga0075367_10938246 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 552 | Open in IMG/M |
| 3300006800|Ga0066660_10929534 | Not Available | 706 | Open in IMG/M |
| 3300007076|Ga0075435_100164411 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1871 | Open in IMG/M |
| 3300009088|Ga0099830_10834162 | Not Available | 761 | Open in IMG/M |
| 3300009090|Ga0099827_10591634 | Not Available | 956 | Open in IMG/M |
| 3300009143|Ga0099792_10763198 | Not Available | 630 | Open in IMG/M |
| 3300009545|Ga0105237_12580612 | Not Available | 519 | Open in IMG/M |
| 3300009792|Ga0126374_11382525 | Not Available | 572 | Open in IMG/M |
| 3300010043|Ga0126380_11852885 | Not Available | 547 | Open in IMG/M |
| 3300010046|Ga0126384_11128492 | Not Available | 720 | Open in IMG/M |
| 3300010162|Ga0131853_11313682 | Not Available | 534 | Open in IMG/M |
| 3300010358|Ga0126370_12321137 | Not Available | 531 | Open in IMG/M |
| 3300010361|Ga0126378_10177886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2191 | Open in IMG/M |
| 3300010361|Ga0126378_11576201 | Not Available | 745 | Open in IMG/M |
| 3300010361|Ga0126378_11784974 | Not Available | 699 | Open in IMG/M |
| 3300010366|Ga0126379_11550170 | Not Available | 768 | Open in IMG/M |
| 3300010376|Ga0126381_102003927 | Not Available | 834 | Open in IMG/M |
| 3300010376|Ga0126381_103345904 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300010398|Ga0126383_10529400 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1241 | Open in IMG/M |
| 3300010863|Ga0124850_1090971 | Not Available | 883 | Open in IMG/M |
| 3300012096|Ga0137389_10453200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1098 | Open in IMG/M |
| 3300012211|Ga0137377_11380190 | Not Available | 633 | Open in IMG/M |
| 3300012354|Ga0137366_10164617 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1666 | Open in IMG/M |
| 3300012359|Ga0137385_10383898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1199 | Open in IMG/M |
| 3300012362|Ga0137361_10673987 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris | 946 | Open in IMG/M |
| 3300012958|Ga0164299_10951961 | Not Available | 628 | Open in IMG/M |
| 3300012989|Ga0164305_11428712 | Not Available | 610 | Open in IMG/M |
| 3300014157|Ga0134078_10157599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 898 | Open in IMG/M |
| 3300014968|Ga0157379_12102221 | Not Available | 559 | Open in IMG/M |
| 3300015077|Ga0173483_10631543 | Not Available | 594 | Open in IMG/M |
| 3300015373|Ga0132257_101499546 | Not Available | 860 | Open in IMG/M |
| 3300016294|Ga0182041_10015247 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4539 | Open in IMG/M |
| 3300016357|Ga0182032_10388546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1126 | Open in IMG/M |
| 3300016357|Ga0182032_11138525 | Not Available | 670 | Open in IMG/M |
| 3300016422|Ga0182039_10198507 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1598 | Open in IMG/M |
| 3300018067|Ga0184611_1072112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1176 | Open in IMG/M |
| 3300018431|Ga0066655_10721716 | Not Available | 675 | Open in IMG/M |
| 3300018481|Ga0190271_12909623 | Not Available | 575 | Open in IMG/M |
| 3300019881|Ga0193707_1059379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1205 | Open in IMG/M |
| 3300019890|Ga0193728_1149146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1030 | Open in IMG/M |
| 3300021080|Ga0210382_10051015 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1628 | Open in IMG/M |
| 3300021086|Ga0179596_10430536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 667 | Open in IMG/M |
| 3300021178|Ga0210408_10306539 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1266 | Open in IMG/M |
| 3300021178|Ga0210408_11072057 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum | 621 | Open in IMG/M |
| 3300021432|Ga0210384_10683054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 919 | Open in IMG/M |
| 3300021479|Ga0210410_10984880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 732 | Open in IMG/M |
| 3300021559|Ga0210409_10470061 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1119 | Open in IMG/M |
| 3300025906|Ga0207699_10315965 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1094 | Open in IMG/M |
| 3300025915|Ga0207693_11037820 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 625 | Open in IMG/M |
| 3300025925|Ga0207650_10154864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1812 | Open in IMG/M |
| 3300026041|Ga0207639_11730173 | Not Available | 586 | Open in IMG/M |
| 3300026298|Ga0209236_1270876 | Not Available | 551 | Open in IMG/M |
| 3300026310|Ga0209239_1149455 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 930 | Open in IMG/M |
| 3300026327|Ga0209266_1254605 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300026361|Ga0257176_1089942 | Not Available | 504 | Open in IMG/M |
| 3300026498|Ga0257156_1070910 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 722 | Open in IMG/M |
| 3300026552|Ga0209577_10545257 | Not Available | 742 | Open in IMG/M |
| 3300027986|Ga0209168_10164646 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1120 | Open in IMG/M |
| 3300028536|Ga0137415_11221043 | Not Available | 567 | Open in IMG/M |
| 3300028814|Ga0307302_10590681 | Not Available | 552 | Open in IMG/M |
| 3300031545|Ga0318541_10119239 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1431 | Open in IMG/M |
| 3300031561|Ga0318528_10016219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3483 | Open in IMG/M |
| 3300031572|Ga0318515_10259451 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 932 | Open in IMG/M |
| 3300031640|Ga0318555_10467992 | Not Available | 683 | Open in IMG/M |
| 3300031680|Ga0318574_10701040 | Not Available | 593 | Open in IMG/M |
| 3300031682|Ga0318560_10315254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 843 | Open in IMG/M |
| 3300031682|Ga0318560_10534131 | Not Available | 635 | Open in IMG/M |
| 3300031682|Ga0318560_10631750 | Not Available | 580 | Open in IMG/M |
| 3300031713|Ga0318496_10565893 | Not Available | 628 | Open in IMG/M |
| 3300031719|Ga0306917_10911409 | Not Available | 687 | Open in IMG/M |
| 3300031744|Ga0306918_10289880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1258 | Open in IMG/M |
| 3300031744|Ga0306918_10358777 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1131 | Open in IMG/M |
| 3300031771|Ga0318546_10698804 | Not Available | 713 | Open in IMG/M |
| 3300031771|Ga0318546_10797964 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 664 | Open in IMG/M |
| 3300031777|Ga0318543_10185145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 922 | Open in IMG/M |
| 3300031777|Ga0318543_10434231 | Not Available | 589 | Open in IMG/M |
| 3300031777|Ga0318543_10512579 | Not Available | 537 | Open in IMG/M |
| 3300031793|Ga0318548_10094699 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1424 | Open in IMG/M |
| 3300031833|Ga0310917_10378823 | Not Available | 961 | Open in IMG/M |
| 3300031879|Ga0306919_10613481 | Not Available | 839 | Open in IMG/M |
| 3300031879|Ga0306919_11484701 | Not Available | 510 | Open in IMG/M |
| 3300031880|Ga0318544_10242308 | Not Available | 698 | Open in IMG/M |
| 3300031880|Ga0318544_10243101 | Not Available | 696 | Open in IMG/M |
| 3300031890|Ga0306925_11819706 | Not Available | 582 | Open in IMG/M |
| 3300031890|Ga0306925_12158840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 519 | Open in IMG/M |
| 3300031894|Ga0318522_10247726 | Not Available | 675 | Open in IMG/M |
| 3300031897|Ga0318520_10667146 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 649 | Open in IMG/M |
| 3300031910|Ga0306923_10065385 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4047 | Open in IMG/M |
| 3300031942|Ga0310916_10801154 | Not Available | 793 | Open in IMG/M |
| 3300031942|Ga0310916_10835145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 774 | Open in IMG/M |
| 3300031954|Ga0306926_11770107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 702 | Open in IMG/M |
| 3300032001|Ga0306922_10589721 | All Organisms → cellular organisms → Bacteria | 1178 | Open in IMG/M |
| 3300032042|Ga0318545_10007505 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3193 | Open in IMG/M |
| 3300032044|Ga0318558_10206459 | Not Available | 959 | Open in IMG/M |
| 3300032052|Ga0318506_10070884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1447 | Open in IMG/M |
| 3300032054|Ga0318570_10502094 | Not Available | 553 | Open in IMG/M |
| 3300032068|Ga0318553_10699775 | Not Available | 530 | Open in IMG/M |
| 3300032090|Ga0318518_10440630 | Not Available | 667 | Open in IMG/M |
| 3300032091|Ga0318577_10329848 | Not Available | 729 | Open in IMG/M |
| 3300032261|Ga0306920_104336027 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300033233|Ga0334722_10499903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 873 | Open in IMG/M |
| 3300033290|Ga0318519_10792864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 582 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 32.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.27% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.73% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.19% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.54% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.54% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.65% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.65% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.77% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 1.77% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.89% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.89% |
| Salt Marsh Sediment | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment | 0.89% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.89% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.89% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.89% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.89% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.89% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459012 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO1O1 lysis Rhizosphere grass | Environmental | Open in IMG/M |
| 3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006178 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Host-Associated | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010162 | Labiotermes labralis P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010863 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300026361 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-B | Environmental | Open in IMG/M |
| 3300026498 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-A | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032062 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1602-90 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| N56_07213120 | 2170459012 | Grass Soil | VAILRASRAGGREPRERHTPQFLQRPAAPRAGGAGAPIDDDDFED |
| AF_2010_repII_A001DRAFT_100339523 | 3300000793 | Forest Soil | RAAREAREPRERHTPQFLQRPAAPQRAGAGAAFNDDDDFED* |
| AF_2010_repII_A001DRAFT_100418491 | 3300000793 | Forest Soil | AERAAREAREPRERHTPQFLQRPTAPQRAGAGAPLDDDDFED* |
| Ga0066388_1043857162 | 3300005332 | Tropical Forest Soil | RAAREREPRHTPQFLQRSPAPQRAGAGAGADTDDDEFDED* |
| Ga0070711_1006771482 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | AAREAREPRERHTPQFLQRPTTPQRAGAGAPIDDDDFED* |
| Ga0066905_1005222751 | 3300005713 | Tropical Forest Soil | PAERAAREAREPRDRHTPQFLQRPTAPQPAGAGAPLDDDDDFED* |
| Ga0068861_1015828661 | 3300005719 | Switchgrass Rhizosphere | REPRGERHTPQFLQRPAPAPARAPAGADDDFDEE* |
| Ga0066903_1045960461 | 3300005764 | Tropical Forest Soil | AARESREPRHTPQFLQRPTAPQRAGAGDDDDFEED* |
| Ga0075365_101550721 | 3300006038 | Populus Endosphere | AREAREPRERHTPQFLQRPTTPQRAGAGAPIDDDDFED* |
| Ga0066652_1018468371 | 3300006046 | Soil | AERAAREAREPRERHTPQFLQRSTAPQRAGAGASLDDDDDFED* |
| Ga0075367_109382462 | 3300006178 | Populus Endosphere | AREAREPRERHTPQFLQRSTTPQRASAGAAFDDDDEFED* |
| Ga0066660_109295342 | 3300006800 | Soil | PAERAAREREPRHTPQFLQRPPAPQRVGAGAEADEDEFDED* |
| Ga0075435_1001644111 | 3300007076 | Populus Rhizosphere | REPRHGSHTPQFLQRGTTPQRAPASTADDDDFED* |
| Ga0099830_108341622 | 3300009088 | Vadose Zone Soil | AERAAREAREPRERHTPQFLQRSAAPQRASASAADDDDFDD* |
| Ga0099827_105916341 | 3300009090 | Vadose Zone Soil | ERAAREAREPRDRHTPQFLQRSPSPQRAGAGTTVDDDDDFED* |
| Ga0099792_107631982 | 3300009143 | Vadose Zone Soil | AAREAREPRERHTPQFLRRSTAPQRASAGAAFDDDDDFED* |
| Ga0105237_125806121 | 3300009545 | Corn Rhizosphere | RGPREEREPGQHTPQFLQRPATPQRTGAGAPEDEFEED* |
| Ga0126374_113825251 | 3300009792 | Tropical Forest Soil | DPAERAAREREPRHTPQFLQRTPAPQRAGAGADADDDEFEED* |
| Ga0126380_118528851 | 3300010043 | Tropical Forest Soil | AERAAREAREPRERHTPQFLQRPAAPQRAGAGAAFNDDDDFED* |
| Ga0126384_111284921 | 3300010046 | Tropical Forest Soil | EPRERHTPQFLQRPTAPQPAGAGAPLDDDDDFED* |
| Ga0131853_113136822 | 3300010162 | Termite Gut | DPAERAAREPRHTPQFLQRPAAPQRAGASDDDEFEDE* |
| Ga0126370_123211371 | 3300010358 | Tropical Forest Soil | RAAREAREPDERHTPQFLQRSTAPQRAGAGAAFNDDDDFED* |
| Ga0126378_101778861 | 3300010361 | Tropical Forest Soil | EPAERAAREAREPRDRHTPQFLQRPTAPQPAGAGAPLDDDDDFED* |
| Ga0126378_115762011 | 3300010361 | Tropical Forest Soil | AERAAREAREPRERHTPQFLQRPTAPQPAGAGAPLDDDDDFED* |
| Ga0126378_117849741 | 3300010361 | Tropical Forest Soil | AERAAREAREPRERHTPQFLQRSTAPQRAGAGAPVDDDDFED* |
| Ga0126379_115501702 | 3300010366 | Tropical Forest Soil | REPRERHTPQFLQHPTAPQPAGAGAPLDDDDDFED* |
| Ga0126381_1020039273 | 3300010376 | Tropical Forest Soil | ERAAREAREPRERHTPQFLQRPTAPQRAGAGAPLDDDDDFED* |
| Ga0126381_1033459041 | 3300010376 | Tropical Forest Soil | AERAAREAREPHDRHTPQFLQRPTAPQPAGAGAPVDDDDDFED* |
| Ga0126383_105294001 | 3300010398 | Tropical Forest Soil | AERAAREPRDRHTPQFLQRPTAPQPAGAGAPLDDDDDFED* |
| Ga0124850_10909712 | 3300010863 | Tropical Forest Soil | EAREPRERHTPQFLQRPAAPQRAGAGAPLDDDDDFED* |
| Ga0137389_104532001 | 3300012096 | Vadose Zone Soil | RELRDRHTPQFLQRSPSPQRAGAGATLEDDDDFED* |
| Ga0137377_113801901 | 3300012211 | Vadose Zone Soil | EAREPHDRHMPQFLQRPTAPQPAGAGAPLDDDDDFED* |
| Ga0137366_101646171 | 3300012354 | Vadose Zone Soil | ERAAREAREPRDRHTPQFLQRPTAPQRAGAGAPLDDDDDFED* |
| Ga0137385_103838981 | 3300012359 | Vadose Zone Soil | REAREPRDRHMPQFLQRPLVPQPAGAGAPLDDDDDFED* |
| Ga0137361_106739873 | 3300012362 | Vadose Zone Soil | AREAREPRERHTPQFLQRPTAPQRAGAGAPLDDDDFED* |
| Ga0164299_109519611 | 3300012958 | Soil | RAAREAREPRERHTPQFLQRPTTPQRAGAGAPIDDDDFED* |
| Ga0164305_114287121 | 3300012989 | Soil | EPRDRHTPQFLQRPTAPQPAGAGAPLDDDDDFED* |
| Ga0134078_101575991 | 3300014157 | Grasslands Soil | AREPRERHTPQFLQRPTVPQRAGAGAGFDDDDDFED* |
| Ga0157379_121022212 | 3300014968 | Switchgrass Rhizosphere | ERAAREAREPRERHTPQFLQRPTTPQRAGAGAPIDDDDFED* |
| Ga0173483_106315431 | 3300015077 | Soil | REAREPRERHTPQFLQRSAAPQRASASAADDDDFDD* |
| Ga0132257_1014995461 | 3300015373 | Arabidopsis Rhizosphere | EPREGRGEREPRQHTPQFLQRPAAAPQRAGVVPDDDEFED* |
| Ga0182041_100152478 | 3300016294 | Soil | AREAREPRERHTPQFLQRPTAPQRAGAGAPLDDDDFED |
| Ga0182032_103885461 | 3300016357 | Soil | AREPRDRHTPQFLQRPTAPQPAGAGAPLDDDDDFED |
| Ga0182032_111385253 | 3300016357 | Soil | EAREPRDRHTPQFLQRPTAPQPAGAGAPLDDDDDFED |
| Ga0182039_101985074 | 3300016422 | Soil | REAREPRERHTPQFLQRPTAPQRAGAGAPLDDDDFED |
| Ga0184611_10721121 | 3300018067 | Groundwater Sediment | REAREPRERHTPQFLQRPAAPQRAGAGAPIDDDDFED |
| Ga0066655_107217162 | 3300018431 | Grasslands Soil | AREPRDRHMPQFLQRPLVPQPAGAGAPLDDGDDFED |
| Ga0190271_129096232 | 3300018481 | Soil | EPREPREPRHVSHTPQFLQRSAAPQRAGAGAHDDDFED |
| Ga0193707_10593793 | 3300019881 | Soil | RAAREAREPRERHTPQFLQRPAAPQRAGAGAPIDDDDFED |
| Ga0193728_11491461 | 3300019890 | Soil | PRESRERHTPQFLHRPAAPQRAGAGAPLDDEDDFED |
| Ga0210382_100510153 | 3300021080 | Groundwater Sediment | SERAAREAREPRERHTPQFLQRPAAPQRAGAGAPIDDDDFED |
| Ga0179596_104305362 | 3300021086 | Vadose Zone Soil | VAREAREPRERHMPQFLQRPTAPQPAGAGAPLDDDDDFED |
| Ga0210408_103065391 | 3300021178 | Soil | REPRERHMPQFLQRPTAPQPAGAGAPLDDDDDFED |
| Ga0210408_110720571 | 3300021178 | Soil | AERAAREAREPRDRHTPQFLQRSAAPQRAGAGAAVDDDDDFED |
| Ga0210384_106830542 | 3300021432 | Soil | REAREPRDRHMPQFLQRPLVPQPAGAGAPLDDDDDFED |
| Ga0210410_109848802 | 3300021479 | Soil | IGRDPAEREAREPRDRHTPQFLQRPTAPQPAGAGAPLDDDDDFED |
| Ga0210409_104700611 | 3300021559 | Soil | ERAAREREPRHTPQFLQRAPAPQRAGAGAEADDDEFDED |
| Ga0207699_103159651 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | TMWPRDRHMPQFLQRPLVPQPAGAGAPLDDDDDFED |
| Ga0207693_110378202 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | AREAREPRERHMPQFLQRPTAPQPAGAGAPLDDDDDFED |
| Ga0207650_101548641 | 3300025925 | Switchgrass Rhizosphere | AREPRERHTPQFLQRPTTPQRAGAGAPIDDDDFED |
| Ga0207639_117301731 | 3300026041 | Corn Rhizosphere | REAREPRERHTPQFLQRPTTPQRAGAGAPIDDDDFED |
| Ga0209236_12708761 | 3300026298 | Grasslands Soil | AAREAREPRERHTPQFLQRPTAPQRAGAGAPLDDDDDFED |
| Ga0209239_11494551 | 3300026310 | Grasslands Soil | DPAERAAREAREPRDHHMPQFLQRPTAPQPAGAGAPLDDDDDFED |
| Ga0209266_12546052 | 3300026327 | Soil | AAREAREPRGDRHTPQFLQRSAVPQRAGAGASADDDDDFED |
| Ga0257176_10899421 | 3300026361 | Soil | EAREPRERHTPQFLQRSTAPQRAGAGAPLDDDDFED |
| Ga0257156_10709103 | 3300026498 | Soil | EAREPRERHMPQFLQRPTAPQPAGAGAPLDDDDDFED |
| Ga0209577_105452571 | 3300026552 | Soil | AERAAREAHEPRERHTPQFLQRPTAPQPAGAGAPLDDDDDFED |
| Ga0209168_101646463 | 3300027986 | Surface Soil | SAREPRDGREGREPRPHTPQFLQRPTAPQRAGAGAPEDDEFENE |
| Ga0137415_112210432 | 3300028536 | Vadose Zone Soil | REAREPRERHTPQFLQRSAAPQRAGAGAAADDDDDFED |
| Ga0307302_105906812 | 3300028814 | Soil | QSKIGRDPAERVAREARHTPQFLQRGAPQHVGAEDDDEFAED |
| Ga0318541_101192393 | 3300031545 | Soil | RKAREPRERHTPQFLQRSTTPQRAGAGAPLDDDDFED |
| Ga0318528_100162191 | 3300031561 | Soil | AERAAREAREPHDRHTPQFLQRPTAPQRAGAGAPLDDDDDFED |
| Ga0318515_102594511 | 3300031572 | Soil | AREAREPRERHTPQFLQRSTAPQRAGAGAPLDDDDFED |
| Ga0318555_104679921 | 3300031640 | Soil | REAREPRERHTPQFLQRAPSPQRAGAGAALDDDDDFDD |
| Ga0318574_107010401 | 3300031680 | Soil | PAERAAREAREPRERHTPQFLQRPTAPQPAGAGAPLDDDDDFED |
| Ga0318560_103152542 | 3300031682 | Soil | REPRERHTPQFLQRSTAPQRAGAGAPLDDDDDFGD |
| Ga0318560_105341311 | 3300031682 | Soil | AREAREPRDRHTPQFLQRPTAPQRAGAGAPLDDDDDFED |
| Ga0318560_106317502 | 3300031682 | Soil | AAREAREPRERHTPQFLQRSTAPQRAGAGAPLDDDDFED |
| Ga0318496_105658932 | 3300031713 | Soil | EAREPRGDRHTPQFLQRSTAPQRAPAGAAVDDDDDFED |
| Ga0306917_109114093 | 3300031719 | Soil | AAREAREPRERHTPQFLQRPTAPQPAGAGAPLDDDDDFED |
| Ga0306918_102898801 | 3300031744 | Soil | RAAREAREPRERHTPQFLQRSTAPQRAGAGAPLDDDDFED |
| Ga0306918_103587773 | 3300031744 | Soil | AREAREPRERHTPQFLQRPAAPQRAGAGAPLDDDDFED |
| Ga0318546_106988041 | 3300031771 | Soil | PAERGTREPHDRHTPQFLQRPTAPQRAGAGAPLDDDDDFED |
| Ga0318546_107979641 | 3300031771 | Soil | AERAAREAREPRDRHMPQFLQRPLAPQPAGAGAPLDDDDDFED |
| Ga0318543_101851451 | 3300031777 | Soil | RAAREAREPRERHTPQFLQRPTAPQRAGAGAPLDDDDFED |
| Ga0318543_104342312 | 3300031777 | Soil | RAAREREPRHTPQFLQRAPAPQRAGAGAEADDDEFDED |
| Ga0318543_105125791 | 3300031777 | Soil | RGTREAREPHDRHTPQFLQRSTAPQRAGAGAPLDDDDDFED |
| Ga0318548_100946993 | 3300031793 | Soil | ERAAREAREPRERHTPQFLQRSTAPQRAGAGAPLDDDDFED |
| Ga0310917_103788231 | 3300031833 | Soil | AREAREPRDRHMPQFLQRPTAPQPAGAGAPLDDDDDCED |
| Ga0306919_106134812 | 3300031879 | Soil | AERAAREAREPRERHTPQFLQRPAAPQRAGAGAAFNDDDDLED |
| Ga0306919_114847011 | 3300031879 | Soil | AERAAREAREPRERHTPQFLQRPTAPQPAGAGAPLDDDDDFED |
| Ga0318544_102423083 | 3300031880 | Soil | REPRDRHTPQFLQRPTAPQRAGAGAPLDDDDDFED |
| Ga0318544_102431011 | 3300031880 | Soil | ERGTREAREPHDRHTPQFLQRPTAPQRAGAGAPLDDDDDFED |
| Ga0306925_118197062 | 3300031890 | Soil | REAREPRDRHMPQFLQRPTAPQPAGAGAPLDDDDDFED |
| Ga0306925_121588402 | 3300031890 | Soil | REPRERHTPQFLQRPTAPQPAGAGAPLDDDDDFED |
| Ga0318522_102477261 | 3300031894 | Soil | DPAERGTREPHDRHTPQFLQRPTAPQRAGAGAPLDDDDDFED |
| Ga0318520_106671462 | 3300031897 | Soil | REPRDRHTPQFLQRPTAPQPAGAGAPLDDDDDFED |
| Ga0306923_100653859 | 3300031910 | Soil | REAREPRDRHTPQFLQRPTAPQPAGAGAPLDDDDDFED |
| Ga0310916_108011541 | 3300031942 | Soil | AERAAREAREPRDRHTPQFLQRPTAPQPAGAGAPLDDDDDFED |
| Ga0310916_108351452 | 3300031942 | Soil | PAERAAREAREPHDRHTPQFLQRPTAPQPASAGAPLDDDDDFED |
| Ga0306926_117701072 | 3300031954 | Soil | ERAAREAREPRERHTPQFLQRPTAPQRAGAGAPLDDDDDFED |
| Ga0306922_105897211 | 3300032001 | Soil | ERAAREAREPRERHTPQFLQRPAAPQRAGAGAPLDDDDDFED |
| Ga0318545_100075051 | 3300032042 | Soil | REPHDRHTPQFLQRPTAPQPAGAGAPLDDDDDFED |
| Ga0318558_102064591 | 3300032044 | Soil | AREPRDRHTPQFLQRPTAPQRAGAGAPLDDDDDFED |
| Ga0318506_100708841 | 3300032052 | Soil | AERAAREAREPRERHTPQFLQRSTAPQRAGAGAPLDDDDFED |
| Ga0318570_105020942 | 3300032054 | Soil | AREPRERHTPQFLQRAPSPQRAGAGAALDDDDDFDD |
| Ga0315551_100996211 | 3300032062 | Salt Marsh Sediment | ARGPRENHRDDGHTPQFLQRPATPQRAGAGAGAPVDDEDEFED |
| Ga0318553_106997751 | 3300032068 | Soil | PAERAAREAREPRDRHTPQFLQRPTAPQPAGAGAPLDDDDDFED |
| Ga0318518_104406302 | 3300032090 | Soil | AREARELRDRHTPQFLQRPTAPQPAGAGAPLDDDDDFED |
| Ga0318577_103298482 | 3300032091 | Soil | ARELRDRHTPQFLQRPTAPQPAGAGAPLDDDDDFED |
| Ga0306920_1043360271 | 3300032261 | Soil | EAREPRERHTPQFLQRSTAPQRAGAGAPLDDDDDFGD |
| Ga0334722_104999033 | 3300033233 | Sediment | REGREPRPHTPQFLQRGPTPQRAPAPAGAADEDFED |
| Ga0318519_107928641 | 3300033290 | Soil | REAREPRERHTPQFLQRSTAPQPAGAGAPLDDDDDFED |
| ⦗Top⦘ |