


| Basic Information | |
|---|---|
| Family ID | F082558 |
| Family Type | Metagenome |
| Number of Sequences | 113 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MKTKKLVKNALKHPELYGPAELAFFKRWLDSKKQAKAAKINKDKKKDS |
| Number of Associated Samples | 80 |
| Number of Associated Scaffolds | 113 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 49.11 % |
| % of genes near scaffold ends (potentially truncated) | 30.97 % |
| % of genes from short scaffolds (< 2000 bps) | 62.83 % |
| Associated GOLD sequencing projects | 72 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.56 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (50.442 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (17.699 % of family members) |
| Environment Ontology (ENVO) | Unclassified (38.938 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (53.097 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.26% β-sheet: 0.00% Coil/Unstructured: 44.74% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 113 Family Scaffolds |
|---|---|---|
| PF04014 | MazE_antitoxin | 15.93 |
| PF03237 | Terminase_6N | 11.50 |
| PF01844 | HNH | 1.77 |
| PF13392 | HNH_3 | 0.88 |
| PF13640 | 2OG-FeII_Oxy_3 | 0.88 |
| PF01476 | LysM | 0.88 |
| PF13649 | Methyltransf_25 | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 55.75 % |
| Unclassified | root | N/A | 44.25 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000116|DelMOSpr2010_c10001755 | Not Available | 12974 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10008525 | All Organisms → cellular organisms → Bacteria | 5455 | Open in IMG/M |
| 3300000124|BS_KBA_SWE12_21mDRAFT_c10055885 | Not Available | 1047 | Open in IMG/M |
| 3300000124|BS_KBA_SWE12_21mDRAFT_c10077797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alteromonas/Salinimonas group → Alteromonas → Alteromonas australica | 837 | Open in IMG/M |
| 3300000882|FwDRAFT_10176452 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Nostocaceae → Trichormus → Trichormus variabilis | 3559 | Open in IMG/M |
| 3300001855|JGI2160J19893_10122871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alteromonas/Salinimonas group → Alteromonas → Alteromonas australica | 503 | Open in IMG/M |
| 3300001934|GOS2267_103089 | All Organisms → cellular organisms → Bacteria | 1831 | Open in IMG/M |
| 3300002835|B570J40625_101068899 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300002835|B570J40625_101334359 | Not Available | 594 | Open in IMG/M |
| 3300004240|Ga0007787_10139305 | Not Available | 1158 | Open in IMG/M |
| 3300004369|Ga0065726_16637 | Not Available | 12476 | Open in IMG/M |
| 3300005512|Ga0074648_1001797 | Not Available | 21185 | Open in IMG/M |
| 3300005512|Ga0074648_1053186 | All Organisms → cellular organisms → Bacteria | 1733 | Open in IMG/M |
| 3300005805|Ga0079957_1003247 | Not Available | 13916 | Open in IMG/M |
| 3300005940|Ga0073913_10026116 | Not Available | 863 | Open in IMG/M |
| 3300006734|Ga0098073_1008614 | Not Available | 1822 | Open in IMG/M |
| 3300006734|Ga0098073_1033463 | Not Available | 717 | Open in IMG/M |
| 3300006790|Ga0098074_1034800 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 1453 | Open in IMG/M |
| 3300006802|Ga0070749_10032192 | All Organisms → cellular organisms → Bacteria | 3262 | Open in IMG/M |
| 3300006810|Ga0070754_10008866 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 6468 | Open in IMG/M |
| 3300006810|Ga0070754_10034847 | Not Available | 2775 | Open in IMG/M |
| 3300007212|Ga0103958_1101630 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Nostocaceae → Trichormus → Trichormus variabilis | 4873 | Open in IMG/M |
| 3300007538|Ga0099851_1023562 | Not Available | 2485 | Open in IMG/M |
| 3300007539|Ga0099849_1014056 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 3538 | Open in IMG/M |
| 3300007539|Ga0099849_1264838 | Not Available | 628 | Open in IMG/M |
| 3300007539|Ga0099849_1364761 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alteromonas/Salinimonas group → Alteromonas → Alteromonas australica | 511 | Open in IMG/M |
| 3300007541|Ga0099848_1116759 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alteromonas/Salinimonas group → Alteromonas → Alteromonas australica | 1011 | Open in IMG/M |
| 3300007640|Ga0070751_1096703 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 1224 | Open in IMG/M |
| 3300007735|Ga0104988_10270 | Not Available | 12685 | Open in IMG/M |
| 3300007735|Ga0104988_10574 | Not Available | 18170 | Open in IMG/M |
| 3300007960|Ga0099850_1389224 | Not Available | 517 | Open in IMG/M |
| 3300008055|Ga0108970_10082708 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 2152 | Open in IMG/M |
| 3300009159|Ga0114978_10162419 | Not Available | 1432 | Open in IMG/M |
| 3300009183|Ga0114974_10000063 | Not Available | 82433 | Open in IMG/M |
| 3300009529|Ga0114919_10276414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alteromonas/Salinimonas group → Alteromonas → Alteromonas australica | 1183 | Open in IMG/M |
| 3300010296|Ga0129348_1255033 | Not Available | 589 | Open in IMG/M |
| 3300010296|Ga0129348_1325262 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alteromonas/Salinimonas group → Alteromonas → Alteromonas australica | 512 | Open in IMG/M |
| 3300010297|Ga0129345_1241835 | Not Available | 632 | Open in IMG/M |
| 3300010299|Ga0129342_1071665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alteromonas/Salinimonas group → Alteromonas → Alteromonas australica | 1329 | Open in IMG/M |
| 3300010300|Ga0129351_1190262 | Not Available | 799 | Open in IMG/M |
| 3300010300|Ga0129351_1201473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alteromonas/Salinimonas group → Alteromonas → Alteromonas australica | 772 | Open in IMG/M |
| 3300010318|Ga0136656_1319437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alteromonas/Salinimonas group → Alteromonas → Alteromonas australica | 502 | Open in IMG/M |
| 3300010354|Ga0129333_10027284 | Not Available | 5405 | Open in IMG/M |
| 3300010354|Ga0129333_10190491 | All Organisms → cellular organisms → Bacteria | 1868 | Open in IMG/M |
| 3300010354|Ga0129333_10222781 | Not Available | 1710 | Open in IMG/M |
| 3300010354|Ga0129333_10602542 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
| 3300010354|Ga0129333_10757125 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 831 | Open in IMG/M |
| 3300010370|Ga0129336_10117517 | Not Available | 1552 | Open in IMG/M |
| 3300010370|Ga0129336_10193711 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alteromonas/Salinimonas group → Alteromonas → Alteromonas australica | 1159 | Open in IMG/M |
| 3300010370|Ga0129336_10356435 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alteromonas/Salinimonas group → Alteromonas → Alteromonas australica | 804 | Open in IMG/M |
| 3300013087|Ga0163212_1004468 | Not Available | 5745 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10584926 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| (restricted) 3300013132|Ga0172372_10755087 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| (restricted) 3300014720|Ga0172376_10100556 | All Organisms → cellular organisms → Bacteria | 2061 | Open in IMG/M |
| (restricted) 3300014720|Ga0172376_10771803 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300017707|Ga0181363_1027524 | Not Available | 1085 | Open in IMG/M |
| 3300017788|Ga0169931_10068146 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 3634 | Open in IMG/M |
| 3300017951|Ga0181577_10256969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alteromonas/Salinimonas group → Alteromonas → Alteromonas australica | 1147 | Open in IMG/M |
| 3300017951|Ga0181577_10465738 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alteromonas/Salinimonas group → Alteromonas → Alteromonas australica | 795 | Open in IMG/M |
| 3300017951|Ga0181577_10628076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alteromonas/Salinimonas group → Alteromonas → Alteromonas australica | 660 | Open in IMG/M |
| 3300017967|Ga0181590_10020570 | All Organisms → cellular organisms → Bacteria | 5343 | Open in IMG/M |
| 3300018421|Ga0181592_10006658 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 9489 | Open in IMG/M |
| 3300018421|Ga0181592_10022120 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 5167 | Open in IMG/M |
| 3300019732|Ga0194014_1055038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alteromonas/Salinimonas group → Alteromonas → Alteromonas australica | 562 | Open in IMG/M |
| 3300020055|Ga0181575_10129526 | Not Available | 1537 | Open in IMG/M |
| 3300020074|Ga0194113_10063202 | All Organisms → cellular organisms → Bacteria | 3471 | Open in IMG/M |
| 3300020074|Ga0194113_10074212 | All Organisms → cellular organisms → Bacteria | 3115 | Open in IMG/M |
| 3300020074|Ga0194113_10886378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alteromonas/Salinimonas group → Alteromonas → Alteromonas australica | 604 | Open in IMG/M |
| 3300020179|Ga0194134_10002906 | Not Available | 19309 | Open in IMG/M |
| 3300020179|Ga0194134_10017370 | Not Available | 4964 | Open in IMG/M |
| 3300020179|Ga0194134_10104929 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 1374 | Open in IMG/M |
| 3300020179|Ga0194134_10108182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alteromonas/Salinimonas group → Alteromonas → Alteromonas australica | 1344 | Open in IMG/M |
| 3300020183|Ga0194115_10019457 | Not Available | 5377 | Open in IMG/M |
| 3300020183|Ga0194115_10026159 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 4303 | Open in IMG/M |
| 3300020184|Ga0181573_10380483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alteromonas/Salinimonas group → Alteromonas → Alteromonas australica | 659 | Open in IMG/M |
| 3300020221|Ga0194127_10406883 | Not Available | 897 | Open in IMG/M |
| 3300020442|Ga0211559_10032946 | Not Available | 2587 | Open in IMG/M |
| 3300020498|Ga0208050_1003647 | Not Available | 1959 | Open in IMG/M |
| 3300020518|Ga0208721_1015484 | Not Available | 998 | Open in IMG/M |
| 3300020578|Ga0194129_10220105 | All Organisms → cellular organisms → Bacteria | 1136 | Open in IMG/M |
| 3300021376|Ga0194130_10110175 | Not Available | 1772 | Open in IMG/M |
| 3300021961|Ga0222714_10043797 | Not Available | 3174 | Open in IMG/M |
| 3300021961|Ga0222714_10339834 | Not Available | 810 | Open in IMG/M |
| 3300022190|Ga0181354_1136056 | Not Available | 779 | Open in IMG/M |
| 3300022198|Ga0196905_1024200 | All Organisms → cellular organisms → Bacteria | 1873 | Open in IMG/M |
| 3300022198|Ga0196905_1107982 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alteromonas/Salinimonas group → Alteromonas → Alteromonas australica | 738 | Open in IMG/M |
| 3300022200|Ga0196901_1066132 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alteromonas/Salinimonas group → Alteromonas → Alteromonas australica | 1317 | Open in IMG/M |
| 3300022200|Ga0196901_1102516 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alteromonas/Salinimonas group → Alteromonas → Alteromonas australica | 996 | Open in IMG/M |
| 3300022752|Ga0214917_10045267 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 3055 | Open in IMG/M |
| 3300023176|Ga0255772_10122554 | Not Available | 1595 | Open in IMG/M |
| 3300023176|Ga0255772_10262171 | Not Available | 938 | Open in IMG/M |
| 3300023180|Ga0255768_10211986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alteromonas/Salinimonas group → Alteromonas → Alteromonas australica | 1157 | Open in IMG/M |
| 3300025057|Ga0208018_123059 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alteromonas/Salinimonas group → Alteromonas → Alteromonas australica | 712 | Open in IMG/M |
| 3300025647|Ga0208160_1101156 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 747 | Open in IMG/M |
| 3300025647|Ga0208160_1162429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alteromonas/Salinimonas group → Alteromonas → Alteromonas australica | 532 | Open in IMG/M |
| 3300025687|Ga0208019_1000198 | Not Available | 33616 | Open in IMG/M |
| 3300025828|Ga0208547_1027201 | Not Available | 2217 | Open in IMG/M |
| 3300025840|Ga0208917_1032144 | Not Available | 2170 | Open in IMG/M |
| 3300025853|Ga0208645_1223797 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300027393|Ga0209867_1002885 | Not Available | 2467 | Open in IMG/M |
| 3300027734|Ga0209087_1083790 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alteromonas/Salinimonas group → Alteromonas → Alteromonas australica | 1380 | Open in IMG/M |
| 3300027782|Ga0209500_10454942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alteromonas/Salinimonas group → Alteromonas → Alteromonas australica | 503 | Open in IMG/M |
| 3300027917|Ga0209536_100878158 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alteromonas/Salinimonas group → Alteromonas → Alteromonas australica | 1108 | Open in IMG/M |
| 3300029753|Ga0135224_1014047 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300029930|Ga0119944_1000096 | Not Available | 14004 | Open in IMG/M |
| 3300029930|Ga0119944_1012362 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alteromonas/Salinimonas group → Alteromonas → Alteromonas australica | 1253 | Open in IMG/M |
| 3300031539|Ga0307380_10011370 | Not Available | 11151 | Open in IMG/M |
| 3300031772|Ga0315288_10039306 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 5715 | Open in IMG/M |
| 3300031857|Ga0315909_10453487 | Not Available | 901 | Open in IMG/M |
| 3300032093|Ga0315902_10100307 | Not Available | 3137 | Open in IMG/M |
| 3300034061|Ga0334987_0197885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alteromonas/Salinimonas group → Alteromonas → Alteromonas australica | 1417 | Open in IMG/M |
| 3300034073|Ga0310130_0000226 | Not Available | 47268 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 17.70% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 13.27% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 11.50% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 9.73% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 7.08% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.54% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 3.54% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.65% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 2.65% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.77% |
| Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 1.77% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 1.77% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 1.77% |
| Marine | Environmental → Aquatic → Marine → Wetlands → Sediment → Marine | 1.77% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.77% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 1.77% |
| Marine Harbor | Environmental → Aquatic → Marine → Harbor → Unclassified → Marine Harbor | 1.77% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment | 1.77% |
| Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 1.77% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.89% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.89% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.89% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.89% |
| Freshwater And Marine | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater And Marine | 0.89% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.89% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.89% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.89% |
| Saline | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.89% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.89% |
| Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000124 | Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBA sample SWE 12_21m | Environmental | Open in IMG/M |
| 3300000882 | Freshwater microbial communities from the Columbia River | Environmental | Open in IMG/M |
| 3300001855 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 | Environmental | Open in IMG/M |
| 3300001934 | Estuary microbial communities from Chesapeake Bay, Maryland, USA - MOVE858 | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
| 3300004369 | Saline microbial communities from the South Caspian sea - cas-15 | Environmental | Open in IMG/M |
| 3300005512 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_water | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300005940 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_25-Nov-14 | Environmental | Open in IMG/M |
| 3300006734 | Marine viral communities from the Gulf of Mexico - 31_GoM_OMZ_CsCl metaG | Environmental | Open in IMG/M |
| 3300006790 | Marine viral communities from the Gulf of Mexico - 32_GoM_OMZ_CsCl metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300007212 | Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Bottom layer) 7 sequencing projects | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
| 3300007735 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea ? 2014Oct | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009529 | Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG | Environmental | Open in IMG/M |
| 3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
| 3300010297 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNA | Environmental | Open in IMG/M |
| 3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300010318 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300013087 | Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30L | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
| 3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
| 3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
| 3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
| 3300017951 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018421 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019732 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRC_0-1_MG | Environmental | Open in IMG/M |
| 3300020055 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101411CT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
| 3300020179 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015056 Kigoma Offshore 0m | Environmental | Open in IMG/M |
| 3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
| 3300020184 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101409BT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020221 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100m | Environmental | Open in IMG/M |
| 3300020442 | Marine microbial communities from Tara Oceans - TARA_B100002019 (ERX556121-ERR599162) | Environmental | Open in IMG/M |
| 3300020498 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020518 | Freshwater microbial communities from Lake Mendota, WI - 17AUG2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020578 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015038 Kigoma Deep Cast 35m | Environmental | Open in IMG/M |
| 3300021376 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surface | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300023176 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG | Environmental | Open in IMG/M |
| 3300023180 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG | Environmental | Open in IMG/M |
| 3300025057 | Marine viral communities from the Gulf of Mexico - 31_GoM_OMZ_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025687 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025828 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025840 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300027393 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_4-Nov-14 (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300029635 | Marine harbor viral communities from the Indian Ocean - SMH2 | Environmental | Open in IMG/M |
| 3300029753 | Marine harbor viral communities from the Indian Ocean - SRH3 | Environmental | Open in IMG/M |
| 3300029930 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727 | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSpr2010_100017555 | 3300000116 | Marine | MKTKKLVKNALKHPELYGPAELAFFRKWLDSKKRAKAAKINKDKKENS* |
| DelMOSpr2010_100085256 | 3300000116 | Marine | MKTKKLVKNALKHPELYGPAELAFFKRWLDSKKRAKAAKINKDKKKDS* |
| BS_KBA_SWE12_21mDRAFT_100558851 | 3300000124 | Marine | MKTKKLVKKALKKPELYSQAEIVYFKTWLCLHKKSKTAKIKKDK* |
| BS_KBA_SWE12_21mDRAFT_100777972 | 3300000124 | Marine | MKTKKLVKKALKKPELYSYAELAYFKTWLCLHKKSKTAKIKKAK* |
| FwDRAFT_101764525 | 3300000882 | Freshwater And Marine | MKTKKLVKKALKKPELYSSAELAYFKTWLCLHKKSKTAKIKKAK* |
| JGI2160J19893_101228712 | 3300001855 | Marine Sediment | KHPELYGPAELAFFRKWLDSKKRAKAAKINKDKKENS* |
| GOS2267_1030897 | 3300001934 | Marine | MKTKKLVKNALKHPELYGPAELAFFKRWLDSNKRAKAAKINKDKKKDS* |
| B570J40625_1010688992 | 3300002835 | Freshwater | MKTKKLVKQALNHPELYSSAELVFFDKWLRLKKQAKAAKINKDKKANS* |
| B570J40625_1013343592 | 3300002835 | Freshwater | MKTKKLVKQALHNPELYSSAELVYFGKWLHFKKQAKAAKIESKKKENS* |
| Ga0007787_101393051 | 3300004240 | Freshwater Lake | MKTKKLVKQALHHPELYSSAELVYFGKWLDLKKQAKAAKIESKKKENS* |
| Ga0065726_166376 | 3300004369 | Saline | MKTKKLVKNALKHPELYGPADLAFFKRWLDSKKRAKAAKINKDKKKDS* |
| Ga0074648_100179724 | 3300005512 | Saline Water And Sediment | MKTKKLVKNALKHPELYGPAELVFFKRWLDSKKRTKAAKINKDKKKDS* |
| Ga0074648_10531862 | 3300005512 | Saline Water And Sediment | MKTKKLLKKALKHPELHTEAELIYFQKWLDLKKQAKSAKMYKEKKSNS* |
| Ga0079957_100324715 | 3300005805 | Lake | MKTKKLVKKALKHPELYGPAELAFFERWLASKKRAKAAKINKDKKKDS* |
| Ga0073913_100261162 | 3300005940 | Sand | MKTKKLVKKALKKPELYSQAEIVYFKTWLCLHKKSKTAKIKEAK* |
| Ga0098073_10086142 | 3300006734 | Marine | MMKTKKLIKRALKHPELYTPAELTFFGRWLFTKKQEKKAAKIKKHKEQ* |
| Ga0098073_10334631 | 3300006734 | Marine | MKTKKLVKNALKHPELYGLAELTFFRKWLDSKKRAKAAKINKDKKENS* |
| Ga0098074_10348004 | 3300006790 | Marine | MKTKKLVKNALKHPELYGPAELAFFRRWLDSKKRAKTAKIN |
| Ga0070749_100321928 | 3300006802 | Aqueous | MKTKKLVKNALKHPELYGPAELAFFRRWLASKKQAKAAKINKDKKKDS* |
| Ga0070754_100088667 | 3300006810 | Aqueous | MKTKKLVKNALKHPELYGPAELAFFRRWLDSKKRAKTAKINKDKKSEDR* |
| Ga0070754_100348472 | 3300006810 | Aqueous | MKTKKLVKNALKHPELYGPGELAFFRRWLHSKKQAKAAKINKDKKKDS* |
| Ga0103958_11016302 | 3300007212 | Freshwater Lake | MKTKKLVKRALRHPELYSPAELLFFNKWLRLKKQAKTAKINKDKKTNS* |
| Ga0099851_10235623 | 3300007538 | Aqueous | MKTKKLVKNALKNPSHWTEGDLVFFKRWLDSKKKVKPAKIKTSKTDK* |
| Ga0099849_10140562 | 3300007539 | Aqueous | MKTKKLVKNALKHPELYGPAELAFFRRWLDSKKRAKAAKINKDKKKDS* |
| Ga0099849_12648384 | 3300007539 | Aqueous | MKTKKLVKNALKHPELYGPAELAFFKRWLDSKKRAKAAKINK |
| Ga0099849_13647611 | 3300007539 | Aqueous | KNALKHPELYGPAELAFFRKWLDSKKRAKAAKINKDKKENS* |
| Ga0099848_11167592 | 3300007541 | Aqueous | MKTKKLVKNALKHPELYGPAELAFFRRWLDSKKRAKAAKINKDKKEDS* |
| Ga0070751_10967035 | 3300007640 | Aqueous | MKTKKLVKNALKHPELYGPAELAFFKRWLDSKKRAKAAKINKDKK |
| Ga0104988_1027014 | 3300007735 | Freshwater | MKTKKLVKEALRHPELYSPAEIAFFGKWLRLKKQAKTAKISKDKKANS* |
| Ga0104988_105742 | 3300007735 | Freshwater | MKTKKLVKRALRHPELYSPAELLFFNKWLRLKKQAKTAKINKDKKANS* |
| Ga0099850_13892242 | 3300007960 | Aqueous | MKTKKLVKNALKHPELYGPAELAFFRKWLDSKKRAKAAKIN |
| Ga0108970_100827082 | 3300008055 | Estuary | MKTKKLVKQALHNPELYSSAELVYFGKWLHLKKQAKAAKIESKKKENS* |
| Ga0114978_101624194 | 3300009159 | Freshwater Lake | MKTKKLVKKALKSPELYSSAELAYFKTWLCLHKKSKTAKIKKAK* |
| Ga0114974_1000006356 | 3300009183 | Freshwater Lake | MKTKKLVKKALKSPELYSPAELAYFKTWLCLHKKSKTAKIKKAK* |
| Ga0114919_102764142 | 3300009529 | Deep Subsurface | MLKHPELYGPAELAFFKRWLDSKKRAKAAKINKDKKKDS* |
| Ga0129348_12550333 | 3300010296 | Freshwater To Marine Saline Gradient | MKTKKLVKNALKHPELYGPTELAFFKRWLDSKKRAKAAKINKDKKKDS* |
| Ga0129348_13252622 | 3300010296 | Freshwater To Marine Saline Gradient | TKKLVKNALKHPELYGPAELAFFKRWLDSKKRAKAAKINKDKKKDS* |
| Ga0129345_12418353 | 3300010297 | Freshwater To Marine Saline Gradient | MKTKKLVKNALKHPELYGPAELAFFKRWLDSKKRAKAAKINKDKKENS* |
| Ga0129342_10716651 | 3300010299 | Freshwater To Marine Saline Gradient | TRRKMKTKKLVKNALKHPELYGPAELAFFRRWLDSKKRAKTAKINKDKKSEDR* |
| Ga0129351_11902624 | 3300010300 | Freshwater To Marine Saline Gradient | MKTKKLVKNALKHPELYGPAELAFFRKWLDSKKRAKAAK |
| Ga0129351_12014732 | 3300010300 | Freshwater To Marine Saline Gradient | MKTKKLVKNALKHPELYGPAELAFFRRWLHSKKQAKAAKINKDKKKDS* |
| Ga0136656_13194372 | 3300010318 | Freshwater To Marine Saline Gradient | MKTKKLVKNALKHPELYGPAELAFFKRWLDSKKQAKAAKINKDKKKDS* |
| Ga0129333_100272844 | 3300010354 | Freshwater To Marine Saline Gradient | MKTKKLVKNALKHPELYGPAELAFFRSWLASKKQAKAAKINKDKKKDS* |
| Ga0129333_101904912 | 3300010354 | Freshwater To Marine Saline Gradient | MKTKKLVKRALRHPELYSPAELTFFDKWLRLKKQAKTAKINKDKKANS* |
| Ga0129333_102227812 | 3300010354 | Freshwater To Marine Saline Gradient | MKTKKLVKQALHHPELYSSAELVYFGKWLHLKKQAKAAKIESKKKENS* |
| Ga0129333_106025422 | 3300010354 | Freshwater To Marine Saline Gradient | MKTKKLVKQALSHPELYSSAELVFFDKWLRLKKQAKAAKINKDKKANS* |
| Ga0129333_107571251 | 3300010354 | Freshwater To Marine Saline Gradient | MKTKKLVKRALKHPELYGPAELAFFERWLASKKRAKAAKINKDKKKDS* |
| Ga0129336_101175171 | 3300010370 | Freshwater To Marine Saline Gradient | QMKTKKLVKKALKHPELYGPAELAFFERWLASKKRAKAAKINKDKKKDS* |
| Ga0129336_101937113 | 3300010370 | Freshwater To Marine Saline Gradient | MKTKKLVKQALSHPELYSSAELVFFDKWLHLKKQAKAAKINKDKKANS* |
| Ga0129336_103564353 | 3300010370 | Freshwater To Marine Saline Gradient | MKKNKLVKQALQHPELYTPAELAFFDRWLIEKKQKKTAKINKKKVYS* |
| Ga0163212_10044682 | 3300013087 | Freshwater | MKTKKLVKKALKHPELYTPAELIFFNRWLHLKKQAKTAKISKDKKADG* |
| (restricted) Ga0172367_105849263 | 3300013126 | Freshwater | MKTKKLVKNALKHPELYSPAELIFFNKWLRLKKQAKTAKISKDKKADS* |
| (restricted) Ga0172372_107550873 | 3300013132 | Freshwater | MKTKKLVKKALKHPELYTPAELIFFNRWLHLKKQAK |
| (restricted) Ga0172376_101005562 | 3300014720 | Freshwater | MKTKKLVKNALKHPELYSSAELVFFNKWLRLKKQAKTAKISKDKKADS* |
| (restricted) Ga0172376_107718031 | 3300014720 | Freshwater | MKTKKLVKKALKHPELYTPAELIFFNRWLHLKKQAKTA |
| Ga0181363_10275241 | 3300017707 | Freshwater Lake | MKTKKLVKQALNHPELYSSAELVFFDKWLRLKKQAKAAKINKDKGENS |
| Ga0169931_100681461 | 3300017788 | Freshwater | KALKHPELYTPAELIFFNRWLHLKKQAKTAKISKDKKADG |
| Ga0181577_102569692 | 3300017951 | Salt Marsh | MKTKKLVKNALKHPELYGPAELAFFRKWLDSKKRAKAAKINKDKKENS |
| Ga0181577_104657382 | 3300017951 | Salt Marsh | MKTKKLVKNALKHPELYGPAELAFFRRWLDSKKQAKAAKINKDKKKDS |
| Ga0181577_106280761 | 3300017951 | Salt Marsh | MKTKKLVKNALKHPELYGPAELAFFKRWLDSKKRAKAAKINKDKKKDS |
| Ga0181590_100205702 | 3300017967 | Salt Marsh | MKTKKLVKNALKHPELYGPAELAFFRRWLDSKKRAKTAKINKDKKSEDR |
| Ga0181592_1000665820 | 3300018421 | Salt Marsh | MKTKKLVKNALKHPELYGPAELAFFKRWLDSKKRAKAAKIN |
| Ga0181592_100221206 | 3300018421 | Salt Marsh | MKKKKLVKNALKNPELYSSAEIAYFNMWLKFKKDKKKAAKIKSSS |
| Ga0194014_10550381 | 3300019732 | Sediment | KTKKLVKNALKHPELYGPAELAFFRKWLDSKKRAKAAKINKDKKKDS |
| Ga0181575_101295265 | 3300020055 | Salt Marsh | MKTKKLVKNALKHPELYGPAELAFFRKWLDSKKRAKAAKINKDKKKDS |
| Ga0194113_100632024 | 3300020074 | Freshwater Lake | MKTKKLVKKALKHPELYTPAELIFFNRWLHLKKQAKTAKISKDKKADG |
| Ga0194113_100742123 | 3300020074 | Freshwater Lake | MKTKKLVKKALKHPELYSPAEISFFATWLHKKKRAKAAKINRDNRENS |
| Ga0194113_108863782 | 3300020074 | Freshwater Lake | MKTKKLVKNALKHPELYSSAELVFFNKWLHQKKQAKAAKISKDKKADS |
| Ga0194134_1000290622 | 3300020179 | Freshwater Lake | MKTKKLVKNALKHPELYSPAELIFFSKWLHQKKQTKAAKINKDKKENS |
| Ga0194134_1001737013 | 3300020179 | Freshwater Lake | MKTKKLVKKALKHPELYSPAEISFFATWLHKKKRAKAAKINR |
| Ga0194134_101049292 | 3300020179 | Freshwater Lake | MKTKKLVKNALKHPELYSSAEFIFFNKWLRLKKQAKTAKINKDKGENS |
| Ga0194134_101081822 | 3300020179 | Freshwater Lake | KHPELYSPAEISFFATWLHKKKRAKAAKINRDNRENS |
| Ga0194115_100194576 | 3300020183 | Freshwater Lake | LKHPELYTPAELIFFNRWLHLKKQAKTAKISKDKKADG |
| Ga0194115_100261595 | 3300020183 | Freshwater Lake | MKTKKLVKNALKHPELYSSAELIFFNKWLRLKKQAKTAKISKDKKADS |
| Ga0181573_103804831 | 3300020184 | Salt Marsh | LKHPELYGPAELAFFRKWLDSKKRAKAAKINKDKKENS |
| Ga0194127_104068834 | 3300020221 | Freshwater Lake | MKTKKLIKQALKHPELYTPAELSFFGRWLRKKKEDKKTAKIQ |
| Ga0211559_100329461 | 3300020442 | Marine | MKTKKLVKNALKNPSYWTEGDLAFFKRWLDSKKKVKPAKIKTSKTDK |
| Ga0208050_10036472 | 3300020498 | Freshwater | MKTKKLVKQALHNPELYSSAELVYFGKWLHLKKQAKAAKIESKKKENS |
| Ga0208721_10154842 | 3300020518 | Freshwater | MKTKKLVKQALHHPELYSSAELVYFGKWLDLKKQAKAAKIESKKKENS |
| Ga0194129_102201052 | 3300020578 | Freshwater Lake | MKTKKLVKNALKHPELYSSAEFIFFNKWLRLKKQAKTAKIKKDKRENS |
| Ga0194130_101101754 | 3300021376 | Freshwater Lake | MKTKKLVKKALKHPELYTPAELIFFNRWLHLKKQAKTAKISKDKKA |
| Ga0222714_100437974 | 3300021961 | Estuarine Water | LILEMKTKKLVKKALKHPELYSSADLVFFNKWLQQKKQAKAAKISKDK |
| Ga0222714_103398341 | 3300021961 | Estuarine Water | MKTKKLVKKALKHPELYSSADLVFFNKWLQQKKQAKAAKISKDK |
| Ga0181354_11360563 | 3300022190 | Freshwater Lake | MKTKKLVKQALHHPELYSSAELVYFGKWLDLKKQAKAAKI |
| Ga0196905_10242002 | 3300022198 | Aqueous | MKTKKLVKNALKHPELYGPAELAFFRSWLASKKQAKAAKINKDKKKDS |
| Ga0196905_11079822 | 3300022198 | Aqueous | MKTKKLVKKALKHPELYGPAELAFFERWLASKKRAKAAKINKDKKKDS |
| Ga0196901_10661322 | 3300022200 | Aqueous | KNALKNPSHWTEGDLVFFKRWLDSKKKVKPAKIKTSKTDK |
| Ga0196901_11025163 | 3300022200 | Aqueous | MKTKKLVKNALKHPELYGLAELTFFRKWLDSKKRAKAAKINKDKKENS |
| Ga0214917_100452672 | 3300022752 | Freshwater | MKRKKLVKKALKHPELYALAEIAYFKRWLWQKKQNKKTAKIQLKQEVNS |
| Ga0255772_101225542 | 3300023176 | Salt Marsh | KMKTKKLVKNALKHPELYGPAELAFFRRWLDSKKQAKAAKINKDKKKDS |
| Ga0255772_102621711 | 3300023176 | Salt Marsh | MKTKKLVKNALKHPELYGPAELAFFRRWLDSKKRAKTAKI |
| Ga0255768_102119862 | 3300023180 | Salt Marsh | ALKHPELYGPAELAFFRKWLDSKKRAKAAKINKDKKENS |
| Ga0208018_1230591 | 3300025057 | Marine | WAWLRPLCSAGMMKTKKLIKRALKHPELYTPAELTFFGRWLFTKKQEKKAAKIKKHKEQ |
| Ga0208160_11011562 | 3300025647 | Aqueous | MKTKKLVKNALKHPELYGPAELAFFRRWLDSKKRAKAAKINKDKKKDS |
| Ga0208160_11624292 | 3300025647 | Aqueous | RRKMKTKKLVKNALKHPELYGPAELAFFRRWLDSKKRAKTAKINKDKKSEDR |
| Ga0208019_100019833 | 3300025687 | Aqueous | MKTKKLVKNALKNPSHWTEGDLVFFKRWLDSKKKVKPAKIKTSKTDK |
| Ga0208547_10272011 | 3300025828 | Aqueous | LVKNALKHPELYGPAELAFFRKWLDSKKRAKAAKINKDKKENS |
| Ga0208917_10321442 | 3300025840 | Aqueous | KHPELYGPAELAFFRKWLDSKKRAKAAKINKDKKENS |
| Ga0208645_12237972 | 3300025853 | Aqueous | MKTKKLVKNALKHPELYGPGELAFFRRWLHSKKQAKAAKINKDKKKDS |
| Ga0209867_10028852 | 3300027393 | Sand | MKTKKLVKKALKKPELYSQAEIVYFKTWLCLHKKSKTAKIKEAK |
| Ga0209087_10837902 | 3300027734 | Freshwater Lake | MKTKKLVKKALKSPELYSPAELAYFKTWLCLHKKSKTAKIKKAK |
| Ga0209500_104549421 | 3300027782 | Freshwater Lake | KTKKLVKKALKSPELYSSAELAYFKTWLCLHKKSKTAKIKKAK |
| Ga0209536_1008781582 | 3300027917 | Marine Sediment | LKHPELYGPAELAFFRRWLDSKKRAKTAKINKDKKSEDR |
| Ga0135217_1009462 | 3300029635 | Marine Harbor | VLQDGTKKPMKTKKLVKNALKNPSYWTEGDLAFFKLWLASKKKAKPAKIKTSKTDK |
| Ga0135224_10140472 | 3300029753 | Marine Harbor | MKTKKLVKNALKNPSYWTEGDLAFFKLWLASKKKAKPAKIKTSKTDK |
| Ga0119944_100009618 | 3300029930 | Aquatic | MKRKKLVKKALKQPELYTPAEIAYFKRWLWQKKQDKKTAKIQLKQEANS |
| Ga0119944_10123622 | 3300029930 | Aquatic | GVKMKTKKLVKNALRHPELYTPAELVFFNKWLQLKKQAKTAKISKDKKANS |
| Ga0307380_100113708 | 3300031539 | Soil | MKTKKLVKKALKKPELYSYAELAYFKTWLCLHKKSKTAKIKKAK |
| Ga0315288_100393065 | 3300031772 | Sediment | MKTKKLVKKALKKPEFYSSAELVYFKTWLCLHKKSKTAKIKKAK |
| Ga0315909_104534872 | 3300031857 | Freshwater | MKTKKLVKQALHHPELYSSAELVYFGKWLHFKKQAKAAKIESKKKENS |
| Ga0315902_101003072 | 3300032093 | Freshwater | MKTKKLVQQALQHPELYSPAELVYFGKWLHFKKQAKAAKIESKKKENS |
| Ga0334987_0197885_962_1108 | 3300034061 | Freshwater | MKTKKLVKQALHNPELYSSAELVYFGKWLDLKKQAKAAKIESKKKENS |
| Ga0310130_0000226_15492_15638 | 3300034073 | Fracking Water | MMKTKKLIKRALKHPELYTPAELTFFGRWLFNKKQEKKAAKIKKHKEQ |
| ⦗Top⦘ |