


| Basic Information | |
|---|---|
| Family ID | F082417 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 113 |
| Average Sequence Length | 44 residues |
| Representative Sequence | QDIGHAHGAYKPPRESMSRTLLSLAGFQVILIGRFWVIAEAK |
| Number of Associated Samples | 76 |
| Number of Associated Scaffolds | 113 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 97.35 % |
| % of genes from short scaffolds (< 2000 bps) | 51.33 % |
| Associated GOLD sequencing projects | 67 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (79.646 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland (27.434 % of family members) |
| Environment Ontology (ENVO) | Unclassified (60.177 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (52.212 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.24% β-sheet: 4.76% Coil/Unstructured: 50.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 113 Family Scaffolds |
|---|---|---|
| PF03400 | DDE_Tnp_IS1 | 8.85 |
| PF07508 | Recombinase | 4.42 |
| PF02922 | CBM_48 | 3.54 |
| PF07238 | PilZ | 3.54 |
| PF00589 | Phage_integrase | 3.54 |
| PF13374 | TPR_10 | 2.65 |
| PF03358 | FMN_red | 2.65 |
| PF08238 | Sel1 | 1.77 |
| PF12831 | FAD_oxidored | 1.77 |
| PF00704 | Glyco_hydro_18 | 1.77 |
| PF00078 | RVT_1 | 1.77 |
| PF02163 | Peptidase_M50 | 1.77 |
| PF03729 | DUF308 | 1.77 |
| PF03992 | ABM | 1.77 |
| PF13517 | FG-GAP_3 | 1.77 |
| PF00239 | Resolvase | 1.77 |
| PF13481 | AAA_25 | 0.88 |
| PF13470 | PIN_3 | 0.88 |
| PF00196 | GerE | 0.88 |
| PF13426 | PAS_9 | 0.88 |
| PF03551 | PadR | 0.88 |
| PF10546 | P63C | 0.88 |
| PF14514 | TetR_C_9 | 0.88 |
| PF00899 | ThiF | 0.88 |
| PF16576 | HlyD_D23 | 0.88 |
| PF13545 | HTH_Crp_2 | 0.88 |
| PF01451 | LMWPc | 0.88 |
| PF07799 | DUF1643 | 0.88 |
| PF13620 | CarboxypepD_reg | 0.88 |
| PF01165 | Ribosomal_S21 | 0.88 |
| PF12770 | CHAT | 0.88 |
| PF12728 | HTH_17 | 0.88 |
| PF00563 | EAL | 0.88 |
| PF01850 | PIN | 0.88 |
| PF08299 | Bac_DnaA_C | 0.88 |
| PF16499 | Melibiase_2 | 0.88 |
| PF00154 | RecA | 0.88 |
| PF00871 | Acetate_kinase | 0.88 |
| PF00296 | Bac_luciferase | 0.88 |
| PF02915 | Rubrerythrin | 0.88 |
| PF01654 | Cyt_bd_oxida_I | 0.88 |
| PF00990 | GGDEF | 0.88 |
| PF02797 | Chal_sti_synt_C | 0.88 |
| PF02518 | HATPase_c | 0.88 |
| PF13440 | Polysacc_synt_3 | 0.88 |
| PF02899 | Phage_int_SAM_1 | 0.88 |
| PF08447 | PAS_3 | 0.88 |
| PF01797 | Y1_Tnp | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
|---|---|---|---|
| COG1662 | Transposase and inactivated derivatives, IS1 family | Mobilome: prophages, transposons [X] | 8.85 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 6.19 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 1.77 |
| COG3247 | Acid resistance membrane protein HdeD, DUF308 family | General function prediction only [R] | 1.77 |
| COG0468 | RecA/RadA recombinase | Replication, recombination and repair [L] | 0.88 |
| COG0593 | Chromosomal replication initiation ATPase DnaA | Replication, recombination and repair [L] | 0.88 |
| COG0828 | Ribosomal protein S21 | Translation, ribosomal structure and biogenesis [J] | 0.88 |
| COG1271 | Cytochrome bd-type quinol oxidase, subunit 1 | Energy production and conversion [C] | 0.88 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.88 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.88 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.88 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.88 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.88 |
| COG2200 | EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant) | Signal transduction mechanisms [T] | 0.88 |
| COG3426 | Butyrate kinase | Energy production and conversion [C] | 0.88 |
| COG3434 | c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domains | Signal transduction mechanisms [T] | 0.88 |
| COG4333 | Uncharacterized conserved protein, DUF1643 domain | Function unknown [S] | 0.88 |
| COG4943 | Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domains | Signal transduction mechanisms [T] | 0.88 |
| COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 0.88 |
| COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 0.88 |
| COG5001 | Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domain | Signal transduction mechanisms [T] | 0.88 |
| COG0282 | Acetate kinase | Energy production and conversion [C] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 79.65 % |
| Unclassified | root | N/A | 20.35 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001356|JGI12269J14319_10012869 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6532 | Open in IMG/M |
| 3300001356|JGI12269J14319_10100661 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1420 | Open in IMG/M |
| 3300005537|Ga0070730_10342253 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales | 974 | Open in IMG/M |
| 3300005554|Ga0066661_10222270 | Not Available | 1170 | Open in IMG/M |
| 3300005557|Ga0066704_10328759 | Not Available | 1028 | Open in IMG/M |
| 3300005561|Ga0066699_10308429 | Not Available | 1127 | Open in IMG/M |
| 3300005561|Ga0066699_10311139 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1122 | Open in IMG/M |
| 3300006797|Ga0066659_10241599 | All Organisms → cellular organisms → Bacteria | 1347 | Open in IMG/M |
| 3300009012|Ga0066710_100030558 | All Organisms → cellular organisms → Bacteria | 6257 | Open in IMG/M |
| 3300009518|Ga0116128_1014750 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2727 | Open in IMG/M |
| 3300009518|Ga0116128_1079878 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 987 | Open in IMG/M |
| 3300009519|Ga0116108_1006425 | All Organisms → cellular organisms → Bacteria | 4862 | Open in IMG/M |
| 3300009524|Ga0116225_1003075 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 10870 | Open in IMG/M |
| 3300009524|Ga0116225_1291063 | Not Available | 730 | Open in IMG/M |
| 3300009547|Ga0116136_1008428 | All Organisms → cellular organisms → Bacteria | 3957 | Open in IMG/M |
| 3300009547|Ga0116136_1009904 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3546 | Open in IMG/M |
| 3300009616|Ga0116111_1009362 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 59-55 | 4155 | Open in IMG/M |
| 3300009616|Ga0116111_1012103 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 3432 | Open in IMG/M |
| 3300009631|Ga0116115_1023824 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 1729 | Open in IMG/M |
| 3300009632|Ga0116102_1005690 | All Organisms → cellular organisms → Bacteria | 4743 | Open in IMG/M |
| 3300009632|Ga0116102_1065582 | Not Available | 1102 | Open in IMG/M |
| 3300009636|Ga0116112_1001103 | All Organisms → cellular organisms → Bacteria | 18780 | Open in IMG/M |
| 3300009636|Ga0116112_1005438 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6092 | Open in IMG/M |
| 3300009762|Ga0116130_1005951 | All Organisms → cellular organisms → Bacteria | 4857 | Open in IMG/M |
| 3300010341|Ga0074045_10502819 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 779 | Open in IMG/M |
| 3300010343|Ga0074044_10352696 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 965 | Open in IMG/M |
| 3300010379|Ga0136449_100032919 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 12434 | Open in IMG/M |
| 3300010379|Ga0136449_100140201 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4782 | Open in IMG/M |
| 3300010379|Ga0136449_100173646 | All Organisms → cellular organisms → Bacteria | 4164 | Open in IMG/M |
| 3300012205|Ga0137362_11011101 | Not Available | 708 | Open in IMG/M |
| 3300012205|Ga0137362_11496072 | Not Available | 562 | Open in IMG/M |
| 3300012210|Ga0137378_10399996 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1274 | Open in IMG/M |
| 3300012350|Ga0137372_11085101 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300012354|Ga0137366_10269509 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1259 | Open in IMG/M |
| 3300012354|Ga0137366_10270521 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1256 | Open in IMG/M |
| 3300012357|Ga0137384_10460162 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1047 | Open in IMG/M |
| 3300012971|Ga0126369_13433197 | Not Available | 519 | Open in IMG/M |
| 3300014156|Ga0181518_10036020 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3128 | Open in IMG/M |
| 3300014169|Ga0181531_10132955 | Not Available | 1499 | Open in IMG/M |
| 3300014491|Ga0182014_10022283 | All Organisms → cellular organisms → Bacteria | 5282 | Open in IMG/M |
| 3300014491|Ga0182014_10026486 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4643 | Open in IMG/M |
| 3300014491|Ga0182014_10087179 | Not Available | 1930 | Open in IMG/M |
| 3300014491|Ga0182014_10108289 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1654 | Open in IMG/M |
| 3300014492|Ga0182013_10144917 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1508 | Open in IMG/M |
| 3300014638|Ga0181536_10092831 | All Organisms → cellular organisms → Bacteria | 1742 | Open in IMG/M |
| 3300016702|Ga0181511_1011576 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300017925|Ga0187856_1012036 | All Organisms → cellular organisms → Bacteria | 4882 | Open in IMG/M |
| 3300017925|Ga0187856_1040438 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2121 | Open in IMG/M |
| 3300017929|Ga0187849_1105907 | All Organisms → cellular organisms → Bacteria | 1186 | Open in IMG/M |
| 3300017935|Ga0187848_10028316 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2856 | Open in IMG/M |
| 3300017996|Ga0187891_1001201 | All Organisms → cellular organisms → Bacteria | 22895 | Open in IMG/M |
| 3300017996|Ga0187891_1001398 | All Organisms → cellular organisms → Bacteria | 20699 | Open in IMG/M |
| 3300017996|Ga0187891_1005007 | All Organisms → cellular organisms → Bacteria | 8361 | Open in IMG/M |
| 3300017996|Ga0187891_1301424 | Not Available | 523 | Open in IMG/M |
| 3300018001|Ga0187815_10096317 | Not Available | 1247 | Open in IMG/M |
| 3300018002|Ga0187868_1252632 | Not Available | 594 | Open in IMG/M |
| 3300018003|Ga0187876_1048180 | Not Available | 1773 | Open in IMG/M |
| 3300018016|Ga0187880_1255487 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_2_60_3 | 771 | Open in IMG/M |
| 3300018016|Ga0187880_1414933 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300018019|Ga0187874_10011133 | All Organisms → cellular organisms → Bacteria | 5180 | Open in IMG/M |
| 3300018019|Ga0187874_10361370 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 587 | Open in IMG/M |
| 3300018022|Ga0187864_10323250 | Not Available | 682 | Open in IMG/M |
| 3300018026|Ga0187857_10001933 | All Organisms → cellular organisms → Bacteria | 19632 | Open in IMG/M |
| 3300018026|Ga0187857_10010833 | All Organisms → cellular organisms → Bacteria | 5657 | Open in IMG/M |
| 3300018035|Ga0187875_10601016 | Not Available | 580 | Open in IMG/M |
| 3300018037|Ga0187883_10622509 | Not Available | 561 | Open in IMG/M |
| 3300018040|Ga0187862_10054653 | Not Available | 2888 | Open in IMG/M |
| 3300018057|Ga0187858_10100827 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1972 | Open in IMG/M |
| 3300018057|Ga0187858_10107251 | All Organisms → cellular organisms → Bacteria | 1901 | Open in IMG/M |
| 3300018057|Ga0187858_10614525 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300018057|Ga0187858_10918311 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 514 | Open in IMG/M |
| 3300022872|Ga0224526_1035406 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus → unclassified Terriglobus → Terriglobus sp. TAA 43 | 1047 | Open in IMG/M |
| 3300023090|Ga0224558_1004203 | All Organisms → cellular organisms → Bacteria | 11354 | Open in IMG/M |
| 3300023090|Ga0224558_1056765 | All Organisms → cellular organisms → Bacteria | 1557 | Open in IMG/M |
| 3300025406|Ga0208035_1024532 | Not Available | 969 | Open in IMG/M |
| 3300025432|Ga0208821_1003899 | All Organisms → cellular organisms → Bacteria | 4862 | Open in IMG/M |
| 3300025432|Ga0208821_1004964 | All Organisms → cellular organisms → Bacteria | 3967 | Open in IMG/M |
| 3300025432|Ga0208821_1005672 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3568 | Open in IMG/M |
| 3300025442|Ga0208034_1005971 | All Organisms → cellular organisms → Bacteria | 4856 | Open in IMG/M |
| 3300025442|Ga0208034_1007335 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 59-55 | 4147 | Open in IMG/M |
| 3300025442|Ga0208034_1008612 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 3650 | Open in IMG/M |
| 3300025442|Ga0208034_1033027 | Not Available | 1224 | Open in IMG/M |
| 3300025453|Ga0208455_1002836 | All Organisms → cellular organisms → Bacteria | 4928 | Open in IMG/M |
| 3300025453|Ga0208455_1002939 | All Organisms → cellular organisms → Bacteria | 4823 | Open in IMG/M |
| 3300025459|Ga0208689_1001421 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 12613 | Open in IMG/M |
| 3300025459|Ga0208689_1003379 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7094 | Open in IMG/M |
| 3300025459|Ga0208689_1005645 | All Organisms → cellular organisms → Bacteria | 4887 | Open in IMG/M |
| 3300025460|Ga0208562_1046067 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
| 3300025480|Ga0208688_1001083 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 12447 | Open in IMG/M |
| 3300025480|Ga0208688_1004189 | All Organisms → cellular organisms → Bacteria | 4895 | Open in IMG/M |
| 3300025496|Ga0208191_1005941 | All Organisms → cellular organisms → Bacteria | 3953 | Open in IMG/M |
| 3300025506|Ga0208937_1003299 | All Organisms → cellular organisms → Bacteria | 4881 | Open in IMG/M |
| 3300026313|Ga0209761_1274734 | Not Available | 611 | Open in IMG/M |
| 3300027625|Ga0208044_1001826 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 11095 | Open in IMG/M |
| 3300027812|Ga0209656_10418821 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 597 | Open in IMG/M |
| 3300027824|Ga0209040_10099684 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1647 | Open in IMG/M |
| 3300027824|Ga0209040_10190048 | All Organisms → cellular organisms → Bacteria | 1074 | Open in IMG/M |
| 3300027857|Ga0209166_10234646 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales | 977 | Open in IMG/M |
| 3300028882|Ga0302154_10048977 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2421 | Open in IMG/M |
| 3300029914|Ga0311359_10937792 | Not Available | 590 | Open in IMG/M |
| 3300029916|Ga0302148_1001756 | All Organisms → cellular organisms → Bacteria | 6460 | Open in IMG/M |
| 3300029919|Ga0302141_1039766 | All Organisms → cellular organisms → Bacteria | 1286 | Open in IMG/M |
| 3300029920|Ga0302142_1030565 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1726 | Open in IMG/M |
| 3300029922|Ga0311363_10663894 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1000 | Open in IMG/M |
| 3300029956|Ga0302150_10357723 | Not Available | 541 | Open in IMG/M |
| 3300029994|Ga0302283_1013438 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4975 | Open in IMG/M |
| 3300030041|Ga0302274_10059892 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2190 | Open in IMG/M |
| 3300030518|Ga0302275_10292983 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidisarcina → Acidisarcina polymorpha | 899 | Open in IMG/M |
| 3300031233|Ga0302307_10034387 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2764 | Open in IMG/M |
| 3300032160|Ga0311301_10041512 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 11065 | Open in IMG/M |
| 3300032160|Ga0311301_10130899 | All Organisms → cellular organisms → Bacteria | 4662 | Open in IMG/M |
| 3300033158|Ga0335077_10011439 | All Organisms → cellular organisms → Bacteria | 11094 | Open in IMG/M |
| 3300033818|Ga0334804_024926 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2002 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 27.43% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 22.12% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 8.85% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 7.08% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.19% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.42% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 4.42% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 3.54% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.65% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.65% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.77% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.77% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.77% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.77% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.89% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.89% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
| 3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009547 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40 | Environmental | Open in IMG/M |
| 3300009616 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 | Environmental | Open in IMG/M |
| 3300009631 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 | Environmental | Open in IMG/M |
| 3300009632 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 | Environmental | Open in IMG/M |
| 3300009636 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150 | Environmental | Open in IMG/M |
| 3300009762 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014491 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaG | Environmental | Open in IMG/M |
| 3300014492 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaG | Environmental | Open in IMG/M |
| 3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
| 3300016702 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017925 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40 | Environmental | Open in IMG/M |
| 3300017929 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100 | Environmental | Open in IMG/M |
| 3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
| 3300017996 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_40 | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018002 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_40 | Environmental | Open in IMG/M |
| 3300018003 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_40 | Environmental | Open in IMG/M |
| 3300018016 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40 | Environmental | Open in IMG/M |
| 3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
| 3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
| 3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
| 3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300022872 | Peat soil microbial communities from Stordalen Mire, Sweden - C.B.S.T-25 | Environmental | Open in IMG/M |
| 3300023090 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24 | Environmental | Open in IMG/M |
| 3300025406 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025432 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025442 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025453 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025459 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025460 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025480 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025496 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025506 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027625 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028882 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_3 | Environmental | Open in IMG/M |
| 3300029914 | III_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300029916 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_1 | Environmental | Open in IMG/M |
| 3300029919 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_2 | Environmental | Open in IMG/M |
| 3300029920 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_3 | Environmental | Open in IMG/M |
| 3300029922 | III_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029956 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_2 | Environmental | Open in IMG/M |
| 3300029994 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_4 | Environmental | Open in IMG/M |
| 3300030041 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_1 | Environmental | Open in IMG/M |
| 3300030518 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_2 | Environmental | Open in IMG/M |
| 3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033818 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 S-3-M | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12269J14319_100128691 | 3300001356 | Peatlands Soil | AYKPPRDSMSRTLLSLAGFQVIITGRFWVIAEGLTRQTFEQ* |
| JGI12269J14319_101006613 | 3300001356 | Peatlands Soil | AYKPPRDSMSRTLLSLAGFQVIITGRFWVIAEEKKLS* |
| Ga0070730_103422531 | 3300005537 | Surface Soil | DIGHALGGYKPLRASMSRTLFSLAGFQVITIGRFWVIAEA* |
| Ga0066661_102222702 | 3300005554 | Soil | IGHAHGGYKPPRVSMSQTPLSLAGFQVILIGRFWVIAEAE* |
| Ga0066704_103287593 | 3300005557 | Soil | DIGHAHGGYKPPRVSMSQTPLSLAGFQVILIGRFWVIAEVHVEIW* |
| Ga0066699_103084293 | 3300005561 | Soil | YKPPRVSMSQTPLSLAGFQVILIGRFWVIAEVKPLIT* |
| Ga0066699_103111393 | 3300005561 | Soil | DIGHAHGGYKPPRVSMSQTPLSLAGFQVILIGRFWVIAEAQTSCFGGVPPAW* |
| Ga0066659_102415993 | 3300006797 | Soil | HAHGGYKPPRVSMSQTPLSLAGFQVILIGRFWVIAEGCATMAV* |
| Ga0066710_10003055813 | 3300009012 | Grasslands Soil | QDIGHAHGGYKPPRVSMSQTPLSLAGFQVILIGRFWVIAEDPSRG |
| Ga0116128_10147505 | 3300009518 | Peatland | QDIGHAHGAYKPPRESMSRTLLSLAGFQVILIGRFCVIAEA* |
| Ga0116128_10798781 | 3300009518 | Peatland | GHGPGAYKPPRESMSRTLLSLAGFQVILIGRFWVIAEAKDRDRAN* |
| Ga0116108_100642512 | 3300009519 | Peatland | QDIGHAHGAYKPPRESMSRTLLSLAGFQVILIGRFCVIAEDNGA* |
| Ga0116225_10030758 | 3300009524 | Peatlands Soil | MGDRSHAHGGYMSTWESMSWTLLSLAGFQVILSGRFWVIAEPSIVLV* |
| Ga0116225_12910631 | 3300009524 | Peatlands Soil | DIGHAHGAYKPPRDSMSRTLLSFAGFQVISIGRFWVIAEAT* |
| Ga0116136_10084285 | 3300009547 | Peatland | QDIGHGPGAYKPPRESMSRTLLSLAGFQVILIGRFWVIAEAKDRDRAN* |
| Ga0116136_10099043 | 3300009547 | Peatland | QDIGHGPGAYKPPRESMSRTLLSLAGFQVILIGRFWVIAEAMM* |
| Ga0116111_10093627 | 3300009616 | Peatland | QDIGHAHGAYKPPRESMSRTPLSLAGFQVILIGRFWVIAEGIRLEKVSS* |
| Ga0116111_10121031 | 3300009616 | Peatland | QDIGHAHGAYKPPRESMSRTPLSLAGFQVILIGRFWVIAEVQIVNELVL* |
| Ga0116115_10238244 | 3300009631 | Peatland | GPGAYKPPRESMSRTLLSLAGFQVILIGRFWVIAEAKDRDRAN* |
| Ga0116102_10056901 | 3300009632 | Peatland | AYKPPRESMSRTLLSLAGFQVILIGRFCVIAEDNGA* |
| Ga0116102_10655821 | 3300009632 | Peatland | GHAHGAYKPPPASMSQTLLSLAGFQVILIGRFWVIAEGLGGSPNNPD* |
| Ga0116112_100110324 | 3300009636 | Peatland | QDIGHAHGAYKPPRDSMSRTLLSLAGFQVIITGRFWVIAEADPPSS* |
| Ga0116112_10054381 | 3300009636 | Peatland | GAYKPPRDSMSRTLLSLAGFQVIITGRFWVIAEDGGPRRLLV* |
| Ga0116130_10059511 | 3300009762 | Peatland | GAYKPPRESMSRTLLSLAGFQVILIGRFCVIAEDNGA* |
| Ga0074045_105028192 | 3300010341 | Bog Forest Soil | GHAHGAYKPPPASMSQTLLSLAGFQVILIGRFWVIAEALSRVVLP* |
| Ga0074044_103526961 | 3300010343 | Bog Forest Soil | GAYKPPRESMSRTLLSLAGFQVIISGRFWVIAEGGTLA* |
| Ga0136449_10003291913 | 3300010379 | Peatlands Soil | QDIGHAHGAYKPPRDSMSRTLLSLAGFQVIITGRFWVIAEEKKLS* |
| Ga0136449_1001402019 | 3300010379 | Peatlands Soil | GAYKPPPDSMSRTLLSLAGFQVIISGRFWVIAED* |
| Ga0136449_1001736465 | 3300010379 | Peatlands Soil | QDIGHAHGAYKPPRESMSRTLLSLAGFQVILIGRFWVIAEAK* |
| Ga0137362_110111011 | 3300012205 | Vadose Zone Soil | DIGHAHGAYKPPRESMSRTLPWLGGFQVILIGRVLSDR* |
| Ga0137362_114960721 | 3300012205 | Vadose Zone Soil | DIGHAHGGYKPPRVSMSRTLLSLAGFQVILIGRF* |
| Ga0137378_103999961 | 3300012210 | Vadose Zone Soil | QDIGHAHGGHKPPRVSMSQTPLSLAGFQVILIGRFLLIAED* |
| Ga0137372_110851012 | 3300012350 | Vadose Zone Soil | QDIGHAPGGYKPPRASMSRTLFSLAGFQVILIGRFWVIAEAKSS* |
| Ga0137366_102695093 | 3300012354 | Vadose Zone Soil | QDIGHAPGGYKPPRASMSRTLFSLAGFQVILIGRFWVIAEGTRMFR* |
| Ga0137366_102705211 | 3300012354 | Vadose Zone Soil | QDIGHAPGGYKPPRASMSRTLFSLAGFQVILIGRFWVIAEVG* |
| Ga0137384_104601621 | 3300012357 | Vadose Zone Soil | HGGHKPPRVSMSQTPLSLAGFQVILIGRFLLIAEETLKWY* |
| Ga0126369_134331972 | 3300012971 | Tropical Forest Soil | LLFVQDIGHAHGGYKTSQVSMSRTLFSLAGFQVITIGWFCVIAEGEHRYNGSFIATQ* |
| Ga0181518_100360201 | 3300014156 | Bog | QDIGHAHGAYKPPRDSMSRTLLSLAGFQVIITGRFWVIAEDGGPRRLLV* |
| Ga0181531_101329553 | 3300014169 | Bog | QDIGHAHGAYKPPRDSMSRTLLSLAGFQVIISGRFWVIAEGVQHASM* |
| Ga0182014_100222836 | 3300014491 | Bog | QDIGHAHGAYKPLRESMSRTLFSLAGFQVILIGRFWVIAEVATRPAIR* |
| Ga0182014_100264868 | 3300014491 | Bog | QDIGHAHGAYKPLRESMSRTLFSLAGFQVILIGRFWVIAEAQKSEL* |
| Ga0182014_100871791 | 3300014491 | Bog | QDIGHAHGAYKPPRESMSRTLFSLAGFQVIISGRFWVIAEASGTEL* |
| Ga0182014_101082891 | 3300014491 | Bog | QDIGHAHGAYKPLRESMSRTLFSLAGFQVILIGRFWVIAEVMNTIF* |
| Ga0182013_101449173 | 3300014492 | Bog | QDIGHAHGAYKPPRDSMSRALLSLAGFQVIISGRFWVIAEG* |
| Ga0181536_100928311 | 3300014638 | Bog | DIGHAHGAYKPPRDSMSRTLLSLAGFQVIITGRFWVIAEADPPSS* |
| Ga0181511_10115761 | 3300016702 | Peatland | DIGHAHGAYKPPRDSMSRTLLSLAGFQVIITGRFWVIAEDGGPRRLLV |
| Ga0187856_101203613 | 3300017925 | Peatland | QDIGHAHGAYKPPRESMSRTLLSLAGFQVILIGRFCVIAEDNGA |
| Ga0187856_10404382 | 3300017925 | Peatland | QDIGHGPGAYKPPRESMSRTLLSLAGFQVILIGRFWVIAEAMM |
| Ga0187849_11059073 | 3300017929 | Peatland | QDIGHAHGAYKPPRESMSRTLLSLAGFQVILIGRFCVIAEG |
| Ga0187848_100283165 | 3300017935 | Peatland | QDIGHAHGAYKPPRESMSRTLLSLAGFQVILIGRFCVIAEA |
| Ga0187891_10012011 | 3300017996 | Peatland | QDIGHGPGAYKPPRESMSRTLLSLAGFQVILIGRFWVIAEG |
| Ga0187891_100139817 | 3300017996 | Peatland | QDIGHGPGAYKPPRESMSRTLLSLAGFQVILIGRFWVIAEVRETISEGRQQSS |
| Ga0187891_100500714 | 3300017996 | Peatland | QDIGHGPGAYKPPRESMSRTLLSLAGFQVILIGRFWVIAEVQNV |
| Ga0187891_13014241 | 3300017996 | Peatland | QDIGHGPGAYKPPRESMSRTLLSLAGFQVILIGRFWVIAEAKDRDRAN |
| Ga0187815_100963171 | 3300018001 | Freshwater Sediment | DIGHAPGGYKLPRASMSRTPFSLAGFQVITIGRFWVIAEGSA |
| Ga0187868_12526321 | 3300018002 | Peatland | QDIGHGPGAYKPPRESMSRTLLSLAGFQVILIGRLWVIAEAMM |
| Ga0187876_10481801 | 3300018003 | Peatland | DIGHGPGAYKPPRESMSRTLLSLAGFQVILIGRFWVIAEGVECPII |
| Ga0187880_12554872 | 3300018016 | Peatland | LFLLFVQDIGHAHGAYKPPRESMSRTLLSLAGFQVIITGRFWVIAEAEH |
| Ga0187880_14149332 | 3300018016 | Peatland | LFVQDIGHAHGAYKPPPASMSRTLFSLAGFQVIISGRFWVIAEE |
| Ga0187874_100111331 | 3300018019 | Peatland | IGHGPGAYKPPRESMSRTLLSLAGFQVILIGRFWVIAEAKDRDRAN |
| Ga0187874_103613701 | 3300018019 | Peatland | IGHGPGAYKPPRESMSRTLLSLAGFQVILIGRFWVIAEAMM |
| Ga0187864_103232502 | 3300018022 | Peatland | QDIGHAHGAYKPPPASMSQTLLSLAGFQVILIGRFWVIAEA |
| Ga0187857_100019331 | 3300018026 | Peatland | QDIGHAHGAYKPPRDSMSRTLLSLAGFQVIITGRFWVIAEADPPSS |
| Ga0187857_100108331 | 3300018026 | Peatland | QDIGHAHGAYKPPRDSMSRTLLSLAGFQVIITGRFWVIAEDGGPRRLLV |
| Ga0187875_106010162 | 3300018035 | Peatland | HAHGAYKPPRDSMSRTLLSLAGFQVILSGRFWVIAEATGTMR |
| Ga0187883_106225092 | 3300018037 | Peatland | HGAYKPPPASMSQTLLSLAGFQVIINGRFWVIAEVISFLTHWL |
| Ga0187862_100546535 | 3300018040 | Peatland | QDIGHAHGAYKPPRDSMSRTLLSLAGFQVIITGRFWVIAEAPQKQQTAQAPR |
| Ga0187858_101008271 | 3300018057 | Peatland | QDIGHAHGAYKPPRESMSRTPLSLAGFQVILIGRFWVIAEVQIVNELVL |
| Ga0187858_101072511 | 3300018057 | Peatland | QDIGHALGGYRPLRASTSRTLFSLAGFQVITIGRFWVIAEGPAAAS |
| Ga0187858_106145251 | 3300018057 | Peatland | DIGHGPGAYKPPRESMSRTLLSLAGFQVILIGRFWVIAEAKDRDRAN |
| Ga0187858_109183112 | 3300018057 | Peatland | AHGAYKPPRDSMSRTLFSLAGFQVIITGRFWVIAEANQP |
| Ga0224526_10354061 | 3300022872 | Soil | AHGAYKPPRDSTSRTLFSLAGFQVIITGRFWVIAED |
| Ga0224558_100420311 | 3300023090 | Soil | FVQDIGHAHGAYKPLRESMSRTLFSLAGFQVILIGRFWVIAEAQKSEL |
| Ga0224558_10567651 | 3300023090 | Soil | FVQDIGHAHGAYKPLRESMSRTLFSLAGFQVILIGRFWVIAEVATRPAIR |
| Ga0208035_10245322 | 3300025406 | Peatland | VQDIGHAHGAYKPPRDSMSRTLFSLAGFQVIISGRFWVIAEALVRVNE |
| Ga0208821_100389913 | 3300025432 | Peatland | DIGHAHGAYKPPRESMSRTLLSLAGFQVILIGRFCVIAEDNGA |
| Ga0208821_10049641 | 3300025432 | Peatland | FVQDIGHGPGAYKPPRESMSRTLLSLAGFQVILIGRFWVIAEAKDRDRAN |
| Ga0208821_10056723 | 3300025432 | Peatland | FVQDIGHGPGAYKPPRESMSRTLLSLAGFQVILIGRFWVIAEAMM |
| Ga0208034_100597113 | 3300025442 | Peatland | HGAYKPPRESMSRTLLSLAGFQVILIGRFCVIAEDNGA |
| Ga0208034_10073351 | 3300025442 | Peatland | IGHAHGAYKPPRESMSRTPLSLAGFQVILIGRFWVIAEGIRLEKVSS |
| Ga0208034_10086121 | 3300025442 | Peatland | FVQDIGHAHGAYKPPRESMSRTPLSLAGFQVILIGRFWVIAEVQIVNELVL |
| Ga0208034_10330271 | 3300025442 | Peatland | FVQDIGHAHGAYKPPRESMSRTLLSLAGFQVILIGRFCVIAEA |
| Ga0208455_10028361 | 3300025453 | Peatland | AHGAYKPPRESMSRTLLSLAGFQVILIGRFCVIAEG |
| Ga0208455_10029391 | 3300025453 | Peatland | AYKPPRESMSRTLLSLAGFQVILIGRFCVIAEDNGA |
| Ga0208689_10014211 | 3300025459 | Peatland | VQDIGHAHGAYKPPRESMSRTLLSLAGFQVILIGRFCVIAEG |
| Ga0208689_10033791 | 3300025459 | Peatland | GAYKPPRDSMSRTLLSLAGFQVIITGRFWVIAEDGGPRRLLV |
| Ga0208689_100564513 | 3300025459 | Peatland | VQDIGHAHGAYKPPRESMSRTLLSLAGFQVILIGRFCVIAEDNGA |
| Ga0208562_10460672 | 3300025460 | Peatland | GHGPGAYKPPRESMSRTLLSLAGFQVILIGRFWVIAEAKDRDRAN |
| Ga0208688_10010831 | 3300025480 | Peatland | FVQDIGHAHGAYKPPRESMSRTLLSLAGFQVILIGRFCVIAEG |
| Ga0208688_100418913 | 3300025480 | Peatland | FVQDIGHAHGAYKPPRESMSRTLLSLAGFQVILIGRFCVIAEDNGA |
| Ga0208191_10059415 | 3300025496 | Peatland | VQDIGHGPGAYKPPRESMSRTLLSLAGFQVILIGRFWVIAEAKDRDRAN |
| Ga0208937_100329913 | 3300025506 | Peatland | GHAHGAYKPPRESMSRTLLSLAGFQVILIGRFCVIAEDNGA |
| Ga0209761_12747342 | 3300026313 | Grasslands Soil | VQDIGHARGGYKPPRASMSRTLFSLAGFQVILIGRFWVIAEV |
| Ga0208044_10018265 | 3300027625 | Peatlands Soil | MGDRSHAHGGYMSTWESMSWTLLSLAGFQVILSGRFWVIAEPSIVLV |
| Ga0209656_104188211 | 3300027812 | Bog Forest Soil | GHAHGAYKPPPASMSQTLLSLAGFQVILIGRFWVIAEALSRVVLP |
| Ga0209040_100996843 | 3300027824 | Bog Forest Soil | AYKPPPASMSQTLLSLAGFQVILIGRFWVIAEAGFRN |
| Ga0209040_101900484 | 3300027824 | Bog Forest Soil | AYKPPPASMSQTLLSLAGFQVILIGRFWVIAEAVKVRP |
| Ga0209166_102346461 | 3300027857 | Surface Soil | QDIGHALGGYKPLRASMSRTLFSLAGFQVITIGRFWVIAEA |
| Ga0302154_100489773 | 3300028882 | Bog | HAHGAYKPPRDSTSRTLFSLAGFQVIITGRFWVIAEAERSSYQKYD |
| Ga0311359_109377921 | 3300029914 | Bog | HGAYKPPRDSMSRALLSLAGFQVIISGRFWVIAEAKPKNDAA |
| Ga0302148_10017561 | 3300029916 | Bog | IGHAHGAYKPPRDSTSRTLFSLAGFQVIITGRFWVIAEAERSSYQKYD |
| Ga0302141_10397663 | 3300029919 | Bog | HAHGAYKPPRDSTSRTLFSLAGFQVIITGRFWVIAED |
| Ga0302142_10305653 | 3300029920 | Bog | QDIGHAHGAYKPPRDSTSRTLFSLAGFQVIITGRFWVIAEAVSA |
| Ga0311363_106638941 | 3300029922 | Fen | VQDIGHAHGAYKPPRDSMSRALLSLAGFQVIISGRFWVIAEAKPKNDAA |
| Ga0302150_103577232 | 3300029956 | Bog | QDIGHAHGAYKPPRDSTSRTLFSLAGFQVIITGRFWVIAEAERSSYQKYD |
| Ga0302283_10134381 | 3300029994 | Fen | RDSTSRTLFSLAGFQVIITGRFWVIAEAERSSYQKYD |
| Ga0302274_100598921 | 3300030041 | Bog | FVQDIGHAHGAYKPPRDSTSRTLFSLAGFQVIITGRFWVIAEAERSSYQKYD |
| Ga0302275_102929833 | 3300030518 | Bog | VQDIGHAHGAYKPPRDSTSRTLFSLAGFQVIITGRFWVIAEAVSA |
| Ga0302307_100343878 | 3300031233 | Palsa | PPRDSMSRTLLSLAGFQVILSGRFWVIAEEMEAPD |
| Ga0311301_1004151211 | 3300032160 | Peatlands Soil | FVQDIGHAHGAYKPPRDSMSRTLLSLAGFQVIITGRFWVIAEEKKLS |
| Ga0311301_101308998 | 3300032160 | Peatlands Soil | IGHAHGAYKPPRESMSRTLLSLAGFQVILIGRFWVIAEVRGTG |
| Ga0335077_1001143911 | 3300033158 | Soil | MKKIFGADIGHALGGYKRLRASMSQTLFSLAGFQVITIGRFWVIAEVDG |
| Ga0334804_024926_3_131 | 3300033818 | Soil | VQDIGHAHGAYKPPRDSMSRALLSLAGFQVIISGRFWVIAEG |
| ⦗Top⦘ |