


| Basic Information | |
|---|---|
| Family ID | F082415 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 113 |
| Average Sequence Length | 46 residues |
| Representative Sequence | KNGNPAGRLNKIILADGSELHDTQLGGDAGGKTRYDPDADVKK |
| Number of Associated Samples | 101 |
| Number of Associated Scaffolds | 113 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.68 % |
| % of genes near scaffold ends (potentially truncated) | 95.58 % |
| % of genes from short scaffolds (< 2000 bps) | 92.92 % |
| Associated GOLD sequencing projects | 97 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.26 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.115 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil (9.735 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.743 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (38.938 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 8.45% Coil/Unstructured: 91.55% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.26 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 113 Family Scaffolds |
|---|---|---|
| PF13531 | SBP_bac_11 | 7.96 |
| PF13620 | CarboxypepD_reg | 0.88 |
| PF01799 | Fer2_2 | 0.88 |
| PF00005 | ABC_tran | 0.88 |
| PF06594 | HCBP_related | 0.88 |
| PF02276 | CytoC_RC | 0.88 |
| PF02738 | MoCoBD_1 | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
|---|---|---|---|
| COG2931 | Ca2+-binding protein, RTX toxin-related | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.12 % |
| Unclassified | root | N/A | 0.88 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000550|F24TB_11629275 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300000559|F14TC_101039783 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300000559|F14TC_101039861 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300000956|JGI10216J12902_106262157 | All Organisms → cellular organisms → Bacteria | 934 | Open in IMG/M |
| 3300000956|JGI10216J12902_120550170 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300004157|Ga0062590_102322788 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300004479|Ga0062595_101844402 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300004635|Ga0062388_101187051 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300004803|Ga0058862_12541210 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300005328|Ga0070676_10712063 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300005331|Ga0070670_101246603 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300005365|Ga0070688_100212128 | All Organisms → cellular organisms → Bacteria | 1360 | Open in IMG/M |
| 3300005406|Ga0070703_10022293 | All Organisms → cellular organisms → Bacteria | 1858 | Open in IMG/M |
| 3300005440|Ga0070705_100006513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Novosphingobium → unclassified Novosphingobium → Novosphingobium sp. Rr 2-17 | 5731 | Open in IMG/M |
| 3300005440|Ga0070705_100027434 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3109 | Open in IMG/M |
| 3300005445|Ga0070708_100218702 | All Organisms → cellular organisms → Bacteria | 1786 | Open in IMG/M |
| 3300005518|Ga0070699_101356771 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300005529|Ga0070741_11370725 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300005535|Ga0070684_100366639 | All Organisms → cellular organisms → Bacteria | 1326 | Open in IMG/M |
| 3300005545|Ga0070695_100664212 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300005545|Ga0070695_100866371 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300005546|Ga0070696_100332886 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1171 | Open in IMG/M |
| 3300005546|Ga0070696_101201798 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300005555|Ga0066692_10987851 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300005556|Ga0066707_10671911 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300005564|Ga0070664_100139125 | All Organisms → cellular organisms → Bacteria | 2137 | Open in IMG/M |
| 3300005713|Ga0066905_100718869 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
| 3300005713|Ga0066905_101656613 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300005764|Ga0066903_103888953 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300005842|Ga0068858_101535330 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300006049|Ga0075417_10742590 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300006797|Ga0066659_10244114 | All Organisms → cellular organisms → Bacteria | 1341 | Open in IMG/M |
| 3300006806|Ga0079220_10604963 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
| 3300006852|Ga0075433_11253803 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300006853|Ga0075420_100007580 | All Organisms → cellular organisms → Bacteria | 9584 | Open in IMG/M |
| 3300006903|Ga0075426_10378549 | All Organisms → cellular organisms → Bacteria | 1043 | Open in IMG/M |
| 3300007004|Ga0079218_11193342 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300009012|Ga0066710_103061910 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300009090|Ga0099827_10127580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2056 | Open in IMG/M |
| 3300009100|Ga0075418_10661521 | All Organisms → cellular organisms → Bacteria | 1125 | Open in IMG/M |
| 3300009100|Ga0075418_12718330 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300009100|Ga0075418_13105891 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300009156|Ga0111538_10643905 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1344 | Open in IMG/M |
| 3300009162|Ga0075423_11733144 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300009409|Ga0114993_10523879 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
| 3300009609|Ga0105347_1387395 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300009610|Ga0105340_1558884 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300009804|Ga0105063_1054373 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300010358|Ga0126370_11373299 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300010362|Ga0126377_12388733 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300010373|Ga0134128_12292358 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300010400|Ga0134122_11673912 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300010401|Ga0134121_12117876 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300010403|Ga0134123_11025323 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300010403|Ga0134123_12693347 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300011405|Ga0137340_1065685 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300011434|Ga0137464_1120301 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300012189|Ga0137388_11884596 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300012228|Ga0137459_1167019 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300012672|Ga0137317_1025742 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300012907|Ga0157283_10284700 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300012922|Ga0137394_10234802 | All Organisms → cellular organisms → Bacteria | 1567 | Open in IMG/M |
| 3300012922|Ga0137394_10901476 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300012944|Ga0137410_10633981 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
| 3300013297|Ga0157378_11208855 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300014166|Ga0134079_10176347 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
| 3300014864|Ga0180068_1067240 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300014875|Ga0180083_1017810 | All Organisms → cellular organisms → Bacteria | 1313 | Open in IMG/M |
| 3300014878|Ga0180065_1122547 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300014880|Ga0180082_1005003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2598 | Open in IMG/M |
| 3300015373|Ga0132257_102745791 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300015374|Ga0132255_101267856 | All Organisms → cellular organisms → Bacteria | 1111 | Open in IMG/M |
| 3300017822|Ga0187802_10436975 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300018071|Ga0184618_10229643 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300018429|Ga0190272_12509570 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300018468|Ga0066662_12024404 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300018469|Ga0190270_11440985 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300019229|Ga0180116_1335423 | All Organisms → cellular organisms → Bacteria | 1017 | Open in IMG/M |
| 3300020065|Ga0180113_1206225 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
| 3300020583|Ga0210401_11253251 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300021081|Ga0210379_10135449 | All Organisms → cellular organisms → Bacteria | 1041 | Open in IMG/M |
| 3300021082|Ga0210380_10518179 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| (restricted) 3300024059|Ga0255040_10474706 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300025917|Ga0207660_11341605 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300025922|Ga0207646_10201468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1798 | Open in IMG/M |
| 3300025925|Ga0207650_11854029 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300025936|Ga0207670_10900931 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300025945|Ga0207679_10121928 | All Organisms → cellular organisms → Bacteria | 2077 | Open in IMG/M |
| 3300025949|Ga0207667_12144846 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300027533|Ga0208185_1095429 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300027835|Ga0209515_10284963 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
| 3300027835|Ga0209515_10288359 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
| 3300027842|Ga0209580_10200717 | All Organisms → cellular organisms → Bacteria | 989 | Open in IMG/M |
| 3300027880|Ga0209481_10208089 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
| 3300028381|Ga0268264_12054527 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300028713|Ga0307303_10195545 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300028784|Ga0307282_10519406 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300028863|Ga0302218_10119097 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
| 3300029944|Ga0311352_10648267 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300031236|Ga0302324_101570852 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
| 3300031548|Ga0307408_100670932 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
| 3300031719|Ga0306917_11483103 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300031824|Ga0307413_11371455 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300031912|Ga0306921_11430568 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300031940|Ga0310901_10140721 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
| 3300031949|Ga0214473_11236996 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300031954|Ga0306926_12821276 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300032119|Ga0316051_1006747 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
| 3300032126|Ga0307415_101118425 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300032205|Ga0307472_102395598 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300033004|Ga0335084_12324131 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300033433|Ga0326726_11812594 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 9.73% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.85% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 8.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.31% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.31% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 4.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.42% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 3.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.65% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.65% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.65% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.65% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.65% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 1.77% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.77% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.77% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.77% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.77% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.77% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.77% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.77% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.77% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.77% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.77% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.89% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.89% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.89% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 0.89% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.89% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.89% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.89% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.89% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.89% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009409 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 | Environmental | Open in IMG/M |
| 3300009609 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 | Environmental | Open in IMG/M |
| 3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
| 3300009804 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_30_40 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011405 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT400_2 | Environmental | Open in IMG/M |
| 3300011434 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT814_2 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012228 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT700_2 | Environmental | Open in IMG/M |
| 3300012672 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT266_2 | Environmental | Open in IMG/M |
| 3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014864 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231A'_16_10D | Environmental | Open in IMG/M |
| 3300014875 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_1_16_10D | Environmental | Open in IMG/M |
| 3300014878 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200A_16_10D | Environmental | Open in IMG/M |
| 3300014880 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_16_10D | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300019229 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_1_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020065 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT499_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
| 3300024059 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_2 | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027533 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 (SPAdes) | Environmental | Open in IMG/M |
| 3300027835 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW60B uncontaminated upgradient, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028713 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028863 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031940 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2 | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032119 | Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSE5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F24TB_116292751 | 3300000550 | Soil | AKNGNPAGRLQKIILADGSELRDTQLGGDAPKTRFDPEAGR* |
| F14TC_1010397831 | 3300000559 | Soil | YVAKNGNPAGRLNKIILADGSELHDTQLGGDAGGKTRYDPDADTSKK* |
| F14TC_1010398612 | 3300000559 | Soil | VAKNGNPAGRLQKIILADGSELRDTQLGGDAPKTRFDPEAGR* |
| JGI10216J12902_1062621572 | 3300000956 | Soil | PGDVITVRMYVAKNGNPAGRLQKIILADGSELHDTQLGGDEGGKSRYDPFAGK* |
| JGI10216J12902_1205501702 | 3300000956 | Soil | VRMYVAKNGNPAGRLQKIVLADGSELRDTQLGGDAPKTRYDPFAEPEKK* |
| Ga0062590_1023227882 | 3300004157 | Soil | VTISMYATTNGNPVGRLNKITLADGTVLHDTQLGGDAGNKTSYDPNAEPTKK* |
| Ga0062595_1018444022 | 3300004479 | Soil | TVRMYLAKNGNPAGRLNKIILADGSELHDTQLGGDSGGKSRYDPDAK* |
| Ga0062388_1011870511 | 3300004635 | Bog Forest Soil | SVFLYPSKSGSPAGRLNKLVLADGTILHDTQLGGDGGGKTRYDPNADKAAPKQ* |
| Ga0058862_125412101 | 3300004803 | Host-Associated | AAGDKITVRMYLAKNGNPAGRLQKIVLADGSELHDTQLGGDEGGKSRYDPDAAPKK* |
| Ga0070676_107120631 | 3300005328 | Miscanthus Rhizosphere | AGDKITVRMYLAKNGNPAGRLQKIVLADGSELHDTQLGGDEGGKSRYDPDAAPKK* |
| Ga0070670_1012466032 | 3300005331 | Switchgrass Rhizosphere | RMYVAKNGNPAGRLNKIILADGSELHDTQLGGDAGGKTRYDPDADTSKK* |
| Ga0070688_1002121283 | 3300005365 | Switchgrass Rhizosphere | MYLAKNGNPAGRLNKIVLADGSELHDTQLGGDAGGKSRYDPDADVKK* |
| Ga0070703_100222931 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | ITVRMYVAKNGNAAGRLQKIILADGSELHDTQLGGDEGGKSRYDPDAAPKK* |
| Ga0070705_1000065139 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | RMYVSKNGNPAGRLNKIILADGTELHDTQLGGDEGGKTRYDPDAKK* |
| Ga0070705_1000274344 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | RMYVAKNGNPAGRLNKFILADGSELHDTQLGGDAGGKSRYDPDADTKK* |
| Ga0070708_1002187023 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | GDVVTVRMYVAKNGNPAGRLNKIILADGSELHDTQLGGDAGGKSRYDPDAESGKK* |
| Ga0070699_1013567711 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | VTVRMYVAKNGNPAGRLNKIIFADGSELHDTQLGGDAGGKTRYDPDAK* |
| Ga0070741_113707251 | 3300005529 | Surface Soil | RLNKIIMKDGTELHDTQLGGDAGGKTRYDPDAAK* |
| Ga0070684_1003666393 | 3300005535 | Corn Rhizosphere | MYLAKNGNPAGRLNKIILADGSELHDTQLGGDAGGKSRYDPDAEKK* |
| Ga0070695_1006642121 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | SLAPGDEVTLRVYMAKTGNPAGRLNKIILKDGTELHDTQLGGDADGKTSYTIPSQ* |
| Ga0070695_1008663711 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | NPAGRLKKIVLADSSELHDMQLGGDTGGKTRYDPDPDVTK* |
| Ga0070696_1003328861 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MTGNRRVTFVAKNRNPAGRLKKIVLADSSELHDMQLGGDTGGKTRYDPDPDVKK* |
| Ga0070696_1012017982 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | RMYVAKNGNPAGRLQKIILADGSELHDTQLGGDAGGKTRYDPDVK* |
| Ga0066692_109878511 | 3300005555 | Soil | AAKNGNPAGRLNKIVLADGTVLHDTQLGGDAGNKTGYDPNADPKNK* |
| Ga0066707_106719111 | 3300005556 | Soil | MPGDVITVRMYVAKNGNPAGRLQKIILADGSELHDTQLGGDAGGKTRYDPDADTGKK* |
| Ga0070664_1001391254 | 3300005564 | Corn Rhizosphere | LQKIILADGSELHDTQLGGDEGGKTRYDPDAAPKK* |
| Ga0066905_1007188691 | 3300005713 | Tropical Forest Soil | TVRMYVAKNGNPAGRLNKIILADGSELHDTQLGGDEGGKTRYDPDAAKK* |
| Ga0066905_1016566131 | 3300005713 | Tropical Forest Soil | ITVRMYVAKNGNPAGRLNKIILADGSELHDTQLGGDAGGKSRYDPDAESTKK* |
| Ga0066903_1038889532 | 3300005764 | Tropical Forest Soil | GRLNKIVLSDGSELHDTQLGGDGGNKSGYGPDAGPRNR* |
| Ga0068858_1015353302 | 3300005842 | Switchgrass Rhizosphere | SVAPGDMITVRMYLAKNGNPAGRLNKIVLADGSELHDTQLGGDAGGKSRYDPDADVKK* |
| Ga0075417_107425901 | 3300006049 | Populus Rhizosphere | ITVRMYVSKNGNPAGRLNKIILADGSELHDTQLGGDAGGKTRYDPDAGK* |
| Ga0066659_102441141 | 3300006797 | Soil | KNGNPAGRLQKIILADGTELHDTQLGGDAGGKTRFDPDADSGKK* |
| Ga0079220_106049631 | 3300006806 | Agricultural Soil | TPGDVVSVTMYAAKNGNPAGRLNKIILADGSVLHDTQLGGDEGNKTGYGPDAGSRNR* |
| Ga0075433_112538032 | 3300006852 | Populus Rhizosphere | MITVRMYVAKNGNPAGRLNKIILADGSELHDTQLGGDEGGKSRYDPDAAKK* |
| Ga0075420_10000758011 | 3300006853 | Populus Rhizosphere | NGNPAGRLQKIILADGSELRDTQLGGEAPKTRFDPEAGK* |
| Ga0075426_103785491 | 3300006903 | Populus Rhizosphere | RMYVAKTGNPVGRLNKIILADRSELHDTQLGGDAGGKSRYDPDADVKK* |
| Ga0079218_111933422 | 3300007004 | Agricultural Soil | ITVFMYVAKNGNPAGRLQKLVLADGSELRDTQLGGDAPKTRYDPDAGK* |
| Ga0066710_1030619101 | 3300009012 | Grasslands Soil | VRMYVAKNGNPAGRLQKIILADGSELHDTQLGGDAGGKTRFDPDADSGKK |
| Ga0099827_101275801 | 3300009090 | Vadose Zone Soil | DAIAPGDVITVRMYVAKNGNPAGRLNKIILADGSELHDTQLGGDAGGKSRYDPDAK* |
| Ga0075418_106615211 | 3300009100 | Populus Rhizosphere | PGDVITVRMYVSKNGNPAGRLQKIILADGSELHDTQLGGDEGGKSRYDPDAESGKK* |
| Ga0075418_127183301 | 3300009100 | Populus Rhizosphere | AKNGNPAGRLQKIILADGSELHDTQLGGDEGGKTRYDPDAAPKK* |
| Ga0075418_131058912 | 3300009100 | Populus Rhizosphere | NKIILADGSELHDTQLGGDAGGKTRYDPDADTGKK* |
| Ga0111538_106439051 | 3300009156 | Populus Rhizosphere | PAGRLNKIILADGSELHDTQLGGDAGGKSRYDPDAETGKK* |
| Ga0075423_117331442 | 3300009162 | Populus Rhizosphere | GNPAGRLQKIILADGSELHDTQLGGDAGGKTRFNPDADSGKK* |
| Ga0114993_105238791 | 3300009409 | Marine | VITVRMYVAKNGNPAGRLQKVVFADGTELHDTQLGGDEGGKSRYDPYGFRG* |
| Ga0105347_13873952 | 3300009609 | Soil | AGRLNKIILADGSELHDTQLGGDAGGKTRYDPDADVKK* |
| Ga0105340_15588841 | 3300009610 | Soil | GNPAGRLNKIVLKDGTVLRDTQLGGEAGNKTGYDPNADPTKK* |
| Ga0105063_10543731 | 3300009804 | Groundwater Sand | KNGNPAGRLQKIILADGSELRDTQLGGDAPKTRFDPEAGR* |
| Ga0126370_113732992 | 3300010358 | Tropical Forest Soil | KNGNPAGRLNKIVLSDGSELHDTQLGGDGGNKTGYGPDAGQRNR* |
| Ga0126377_123887332 | 3300010362 | Tropical Forest Soil | GRLNKIILKDGTELHDTQLGGDADGKTSYDPPSQ* |
| Ga0134128_122923582 | 3300010373 | Terrestrial Soil | MHRSIAAPGRLNKIILADGSELHDTQLGGDAGGKTRYDPDADVKK* |
| Ga0134122_116739122 | 3300010400 | Terrestrial Soil | GRLNKIIMADGSELHDTQLGGDSGGKSRYDPDAK* |
| Ga0134121_121178761 | 3300010401 | Terrestrial Soil | KNGNPAGRLQKIILADGSELHDTQLGGDEGGKTRFVPGAESGQK* |
| Ga0134123_110253232 | 3300010403 | Terrestrial Soil | MYVSKNGNPAGRLNKIILADGSELHDTQLGGDAGGKTRYDPDVK* |
| Ga0134123_126933471 | 3300010403 | Terrestrial Soil | MYLAKNGNPAGRLQKIILADGSELHDTQLGGDEGGKTRYDPDAAPKK* |
| Ga0137340_10656852 | 3300011405 | Soil | WRLPKIILADGSELNDTQLGGDAAGKTRYDPDADVKK* |
| Ga0137464_11203011 | 3300011434 | Soil | KNGNPAGRLNKIILADGSELHDTQLGGDAGGKTRYDPDADVKK* |
| Ga0137388_104306151 | 3300012189 | Vadose Zone Soil | IYAAKTGNPAGRLNRVVLADGTTLHDTQLGGDAGNKTGYGHDTGANRGNEGK* |
| Ga0137388_118845961 | 3300012189 | Vadose Zone Soil | GNPAGRLQKIILADGSELHDTQLGGDAGGKTRYDPDADTGKK* |
| Ga0137459_11670192 | 3300012228 | Soil | ITVRMYVSKNGNPAGRLNKIILADGSELHDTQLGGDAGGKTRYDPDADVKK* |
| Ga0137317_10257421 | 3300012672 | Soil | RMYVSKNGNPAGRLQKIIFADGTDLHDTQLGGDEGGKTRYDPLAGK* |
| Ga0157283_102847001 | 3300012907 | Soil | RLQKIVLADGSELHDTQLGGDEGGKSRYDPDAAPKK* |
| Ga0137394_102348023 | 3300012922 | Vadose Zone Soil | TVMPGDVITVRMYVAKNGNPAGRLQKIILADGSELHDTQLGGDAGGKTRFDPDADSGKK* |
| Ga0137394_109014761 | 3300012922 | Vadose Zone Soil | NPAGRLNKIILADGSELHDTQLGGDEGGKTRYDPDAKK* |
| Ga0137410_106339812 | 3300012944 | Vadose Zone Soil | PGDVVTVRMYLAKNGNPAGRLNKIILADGSELHDTQLGGDAGGKTRYDPDAEPKK* |
| Ga0157378_112088552 | 3300013297 | Miscanthus Rhizosphere | VVTVRMYVAKNGNPAGRLNKIILKDGSELHDTQLGGDEGGKTRYDPDAVKK* |
| Ga0134079_101763472 | 3300014166 | Grasslands Soil | VTVRMYVAKNGNPAGRLNKIILADGSELHDTQLGGDAGGKTRYDPDAK* |
| Ga0180068_10672401 | 3300014864 | Soil | TVRMYVSKNGNPAGRLQKIIFADGTDLHDTQLGGDEGGKTRYDPLAGK* |
| Ga0180083_10178101 | 3300014875 | Soil | GRLNKIILADGSELHDTQLGGDAGGKTRYNPDADVKK* |
| Ga0180065_11225472 | 3300014878 | Soil | IILADGSDLHDTQLGGDAGGKTRYDPEADPDNKK* |
| Ga0180082_10050034 | 3300014880 | Soil | NKIILADGSELHDTQLGGDAGGKTRYDPDADVKK* |
| Ga0132257_1027457911 | 3300015373 | Arabidopsis Rhizosphere | NPAGRLNKIILEDGSELHDTQLGGDKGGKSRYDPDAESKK* |
| Ga0132255_1012678562 | 3300015374 | Arabidopsis Rhizosphere | YVSKNGNPAGRLNKIILADGTELHDTQLGGDEGGKTRYDPDAKK* |
| Ga0187802_104369752 | 3300017822 | Freshwater Sediment | PAGRMNKIVLPDGTTLHDTQLGGDGGKSRYNPDADSKSQKPNQ |
| Ga0184618_102296431 | 3300018071 | Groundwater Sediment | KNGNPAGRLQKIILADGSELHDTQLGGDAGGKTRYDPDADIGKK |
| Ga0190272_125095702 | 3300018429 | Soil | VVKNGNNAGRLQKIVLADGSELRDTQLGGDAPKTRFDPFAEKEKK |
| Ga0066662_120244041 | 3300018468 | Grasslands Soil | NGNPAGRLNKVVLSDGSVLHDTQLGGDAGNKSDYRPDDYSKEKK |
| Ga0190270_114409851 | 3300018469 | Soil | PGDVITVRMYVAKNGNPAGRLQKIILADGSELRDTQLGGDAPKTRFDPEAVK |
| Ga0180116_13354231 | 3300019229 | Groundwater Sediment | WRLQKIILADGSELNDTQLGGDAAGKTRYDPDADVKK |
| Ga0180113_12062251 | 3300020065 | Groundwater Sediment | PAGRLNKIILADGSELHDTQLGGDAGGKTRYDPDADVKK |
| Ga0210401_112532511 | 3300020583 | Soil | IYPAKSGNPAGRLNRIVLPDGTTLHDTQLGGEGGKGRYNPGGDADSKKAKP |
| Ga0210379_101354491 | 3300021081 | Groundwater Sediment | SKNGNPAGRLNKIILADGSELHDTQLGGDAGGKTRYDPDADVKK |
| Ga0210380_105181792 | 3300021082 | Groundwater Sediment | MYVAKNGNPAGRLNKITLADGTELRDTQLGGEEGGKTRYDPFAESGK |
| (restricted) Ga0255040_104747061 | 3300024059 | Seawater | GRLNKIIFADGTELHDTQLGGDEGGKSRYDPHGFRN |
| Ga0207660_113416051 | 3300025917 | Corn Rhizosphere | ITVRMYVSKNDNPAGRLQKIVLADGSELRDTQLGGDAPKSRYDPDAGK |
| Ga0207646_102014682 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MTGNRRVTFVAKNRNPAGRLKKIVLADSSELHDMQLGGDTGGKTRYDPDPDVKK |
| Ga0207650_118540292 | 3300025925 | Switchgrass Rhizosphere | LAKNGNPAGRLQKIILADGSELHDTQLGGDEGGKTRYDPDAAPKK |
| Ga0207670_109009311 | 3300025936 | Switchgrass Rhizosphere | ASVAPGDMITVRMYLAKNGNPAGRLNKIVLADGSELHDTQLGGDAGGKSRYDPDADVKK |
| Ga0207679_101219284 | 3300025945 | Corn Rhizosphere | AGRLQKIILADGSELHDTQLGGDEGGKTRYDPDAAPKK |
| Ga0207667_121448462 | 3300025949 | Corn Rhizosphere | KNGNPAGRLQKIVLADGSELHDTQLGGDEGGKSRYDPDAAPKK |
| Ga0208185_10954291 | 3300027533 | Soil | VITVRMYVSKNGNPAGRLNKIILADGSELHDTQLGGDAGGKTRYDPDADVKK |
| Ga0209515_102849632 | 3300027835 | Groundwater | MYAAKNGNPAGRLNKIVLADGTVLHDTQLGGDAGGKTGYDPDADPKKK |
| Ga0209515_102883592 | 3300027835 | Groundwater | AKNGNPAGRLNKIILADGNELHDTQLGGDAGGKSRYDPDAK |
| Ga0209580_102007172 | 3300027842 | Surface Soil | MYCSKNGNPAGRLNKIVLADGTELHDTVLGGESGGKTGYRPDDEPNGKK |
| Ga0209481_102080892 | 3300027880 | Populus Rhizosphere | NGNPAGRLNKIILADGSELHDTQLGGDAGGKSRYDPDAETGKK |
| Ga0268264_120545272 | 3300028381 | Switchgrass Rhizosphere | AGRLNKIILADGTELHDTQLGGDEGGKTRYDPDAKK |
| Ga0307303_101955451 | 3300028713 | Soil | GRLQKIILADGSELHDTQLGGDAGGKTRFDPDADSGKK |
| Ga0307282_105194061 | 3300028784 | Soil | DVVTVRMYVAKNGNPAGRLNKIILADGSELHDTQLGGDAGGKSRYDPDAK |
| Ga0302218_101190972 | 3300028863 | Palsa | DVITVDMYVAKNGNPVGRLQKIVRADGTELHDTLLGGDAGGKTKYDPDGGK |
| Ga0311352_106482671 | 3300029944 | Palsa | PGDVITVDMYVAKNGNPVGRLQKIVRADGTELHDTLLGGDAGGKTKYDPDGGK |
| Ga0302324_1015708522 | 3300031236 | Palsa | NKIVRADGTELHDTILGGDAGGKTKYDPDAGKTDGGK |
| Ga0307408_1006709322 | 3300031548 | Rhizosphere | PGDVITVRMYVSKNGNPAGRLQKIILADGSELHDTQLGGDEGGKSRYDPDADSGKK |
| Ga0306917_114831031 | 3300031719 | Soil | AYMSKNGNPAGRLNKIVLSDGTELHDTQLGGDGGNKTGYGPDAGQRNR |
| Ga0307413_113714552 | 3300031824 | Rhizosphere | KNGNNAGRLQKIVLADGTELRDTQLGGEAGGKTRFDPFAEKEKK |
| Ga0306921_114305681 | 3300031912 | Soil | GNPAGRLNKVVLADGTVLHDTQLGGDSGGKTRYDPDAEPKKR |
| Ga0310901_101407211 | 3300031940 | Soil | RMYLAKNGNPAGRLQKIILADGSELHDTQLGGDEGGKTRYDPDAAPKK |
| Ga0214473_112369962 | 3300031949 | Soil | GNPAGRLNRIVLADGTILRDTQLGGDAGGKTRYDPDAEPSGQK |
| Ga0306926_128212761 | 3300031954 | Soil | NGNPAGRLNKIVLADGTVLHDTQLGGDSGGKTRYDPDAEPKKK |
| Ga0316051_10067471 | 3300032119 | Soil | LNKIVLTDGTTLHDTQLGGESGKARYNPDADSKSQKNNQ |
| Ga0307415_1011184252 | 3300032126 | Rhizosphere | GDVITVRMYVAKNGNPAGRLQKIVLADGSELRDTQLGGDAPKTRFDPDAGK |
| Ga0307472_1023955981 | 3300032205 | Hardwood Forest Soil | GNPAGRLNKIILSDGSELHDTQLGGDAGGKSRYDPDAETGKK |
| Ga0335084_123241311 | 3300033004 | Soil | KNGNPAGRLNKIIMKDGTELHDTQLGGDAGGKTRYDPDAAK |
| Ga0326726_118125942 | 3300033433 | Peat Soil | KNGNPAGRLNKIILADGSELHDTQLGGDEGGKTGYGPDAK |
| ⦗Top⦘ |