


| Basic Information | |
|---|---|
| Family ID | F082411 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 113 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MTAHKFAVGQTVRFSPDRNQGVEVRGSFKIVRLLPEAASVLQ |
| Number of Associated Samples | 95 |
| Number of Associated Scaffolds | 113 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 98.23 % |
| % of genes near scaffold ends (potentially truncated) | 99.12 % |
| % of genes from short scaffolds (< 2000 bps) | 95.58 % |
| Associated GOLD sequencing projects | 92 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (56.637 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (37.168 % of family members) |
| Environment Ontology (ENVO) | Unclassified (43.363 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.788 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.29% β-sheet: 11.43% Coil/Unstructured: 84.29% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 113 Family Scaffolds |
|---|---|---|
| PF00313 | CSD | 44.25 |
| PF01165 | Ribosomal_S21 | 40.71 |
| PF03600 | CitMHS | 0.88 |
| PF00171 | Aldedh | 0.88 |
| PF10237 | N6-adenineMlase | 0.88 |
| PF03928 | HbpS-like | 0.88 |
| PF01048 | PNP_UDP_1 | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
|---|---|---|---|
| COG0828 | Ribosomal protein S21 | Translation, ribosomal structure and biogenesis [J] | 40.71 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.88 |
| COG0775 | Nucleoside phosphorylase/nucleosidase, includes 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase MtnN and futalosine hydrolase MqnB | Nucleotide transport and metabolism [F] | 0.88 |
| COG0813 | Purine-nucleoside phosphorylase | Nucleotide transport and metabolism [F] | 0.88 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.88 |
| COG2820 | Uridine phosphorylase | Nucleotide transport and metabolism [F] | 0.88 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 56.64 % |
| Unclassified | root | N/A | 43.36 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004633|Ga0066395_10105933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1363 | Open in IMG/M |
| 3300004635|Ga0062388_101248424 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 738 | Open in IMG/M |
| 3300005184|Ga0066671_10893438 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 563 | Open in IMG/M |
| 3300005186|Ga0066676_10402688 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 923 | Open in IMG/M |
| 3300005337|Ga0070682_101842655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 529 | Open in IMG/M |
| 3300005341|Ga0070691_10523151 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 689 | Open in IMG/M |
| 3300005561|Ga0066699_10137187 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 1657 | Open in IMG/M |
| 3300005602|Ga0070762_10660134 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 699 | Open in IMG/M |
| 3300005764|Ga0066903_107790020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 551 | Open in IMG/M |
| 3300006028|Ga0070717_10130641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 2159 | Open in IMG/M |
| 3300006028|Ga0070717_10186462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1811 | Open in IMG/M |
| 3300006031|Ga0066651_10319998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 832 | Open in IMG/M |
| 3300006046|Ga0066652_100285393 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 1460 | Open in IMG/M |
| 3300006797|Ga0066659_10832920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 766 | Open in IMG/M |
| 3300010048|Ga0126373_10470653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 1294 | Open in IMG/M |
| 3300010048|Ga0126373_12506400 | Not Available | 575 | Open in IMG/M |
| 3300010061|Ga0127462_199245 | Not Available | 689 | Open in IMG/M |
| 3300010100|Ga0127440_1073826 | Not Available | 948 | Open in IMG/M |
| 3300010358|Ga0126370_11767532 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 597 | Open in IMG/M |
| 3300010359|Ga0126376_11094095 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 805 | Open in IMG/M |
| 3300010359|Ga0126376_11959532 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 627 | Open in IMG/M |
| 3300010359|Ga0126376_13064038 | Not Available | 517 | Open in IMG/M |
| 3300010360|Ga0126372_11584195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 693 | Open in IMG/M |
| 3300010362|Ga0126377_12331756 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 611 | Open in IMG/M |
| 3300010376|Ga0126381_102507454 | Not Available | 739 | Open in IMG/M |
| 3300010398|Ga0126383_12622019 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 587 | Open in IMG/M |
| 3300011120|Ga0150983_11144540 | Not Available | 663 | Open in IMG/M |
| 3300011120|Ga0150983_11433318 | Not Available | 961 | Open in IMG/M |
| 3300011332|Ga0126317_10214539 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 552 | Open in IMG/M |
| 3300012376|Ga0134032_1172697 | Not Available | 1017 | Open in IMG/M |
| 3300012379|Ga0134058_1025229 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 522 | Open in IMG/M |
| 3300012924|Ga0137413_10219602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1288 | Open in IMG/M |
| 3300012987|Ga0164307_10783369 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 756 | Open in IMG/M |
| 3300013296|Ga0157374_11598983 | Not Available | 676 | Open in IMG/M |
| 3300015264|Ga0137403_10152344 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2277 | Open in IMG/M |
| 3300015374|Ga0132255_104685456 | Not Available | 579 | Open in IMG/M |
| 3300015374|Ga0132255_105751511 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 525 | Open in IMG/M |
| 3300016294|Ga0182041_10768704 | Not Available | 859 | Open in IMG/M |
| 3300016319|Ga0182033_10817872 | Not Available | 822 | Open in IMG/M |
| 3300016341|Ga0182035_10330484 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1260 | Open in IMG/M |
| 3300016341|Ga0182035_10672232 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 900 | Open in IMG/M |
| 3300016387|Ga0182040_11713154 | Not Available | 537 | Open in IMG/M |
| 3300016404|Ga0182037_10654111 | Not Available | 896 | Open in IMG/M |
| 3300016422|Ga0182039_10547672 | Not Available | 1005 | Open in IMG/M |
| 3300016422|Ga0182039_11768407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 566 | Open in IMG/M |
| 3300020581|Ga0210399_10654409 | Not Available | 866 | Open in IMG/M |
| 3300021476|Ga0187846_10110313 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1179 | Open in IMG/M |
| 3300021560|Ga0126371_10466462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1409 | Open in IMG/M |
| 3300022525|Ga0242656_1048326 | Not Available | 732 | Open in IMG/M |
| 3300022531|Ga0242660_1251173 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 504 | Open in IMG/M |
| 3300022533|Ga0242662_10150640 | Not Available | 703 | Open in IMG/M |
| 3300022724|Ga0242665_10098126 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 865 | Open in IMG/M |
| 3300022724|Ga0242665_10153157 | Not Available | 730 | Open in IMG/M |
| 3300025926|Ga0207659_11744572 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 530 | Open in IMG/M |
| 3300026041|Ga0207639_11785297 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 576 | Open in IMG/M |
| 3300026088|Ga0207641_12252749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 545 | Open in IMG/M |
| 3300026304|Ga0209240_1104268 | Not Available | 1008 | Open in IMG/M |
| 3300026308|Ga0209265_1163113 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 580 | Open in IMG/M |
| 3300026325|Ga0209152_10075576 | Not Available | 1229 | Open in IMG/M |
| 3300027698|Ga0209446_1109968 | Not Available | 709 | Open in IMG/M |
| 3300030730|Ga0307482_1179080 | Not Available | 633 | Open in IMG/M |
| 3300030829|Ga0308203_1011938 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1021 | Open in IMG/M |
| 3300030839|Ga0073999_11171330 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 599 | Open in IMG/M |
| 3300030902|Ga0308202_1078748 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 651 | Open in IMG/M |
| 3300030903|Ga0308206_1027761 | Not Available | 1007 | Open in IMG/M |
| 3300031022|Ga0138301_1861343 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 595 | Open in IMG/M |
| 3300031091|Ga0308201_10054803 | Not Available | 1014 | Open in IMG/M |
| 3300031446|Ga0170820_15733335 | Not Available | 744 | Open in IMG/M |
| 3300031543|Ga0318516_10263052 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 997 | Open in IMG/M |
| 3300031545|Ga0318541_10864698 | Not Available | 504 | Open in IMG/M |
| 3300031564|Ga0318573_10350610 | Not Available | 792 | Open in IMG/M |
| 3300031564|Ga0318573_10590130 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 598 | Open in IMG/M |
| 3300031564|Ga0318573_10746530 | Not Available | 526 | Open in IMG/M |
| 3300031572|Ga0318515_10083446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1659 | Open in IMG/M |
| 3300031590|Ga0307483_1022309 | Not Available | 626 | Open in IMG/M |
| 3300031640|Ga0318555_10510079 | Not Available | 652 | Open in IMG/M |
| 3300031720|Ga0307469_11473132 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 651 | Open in IMG/M |
| 3300031724|Ga0318500_10360774 | Not Available | 719 | Open in IMG/M |
| 3300031744|Ga0306918_10737624 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 770 | Open in IMG/M |
| 3300031747|Ga0318502_10554611 | Not Available | 690 | Open in IMG/M |
| 3300031748|Ga0318492_10269268 | Not Available | 883 | Open in IMG/M |
| 3300031751|Ga0318494_10451859 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 747 | Open in IMG/M |
| 3300031753|Ga0307477_10902754 | Not Available | 583 | Open in IMG/M |
| 3300031763|Ga0318537_10286838 | Not Available | 609 | Open in IMG/M |
| 3300031770|Ga0318521_10139715 | Not Available | 1368 | Open in IMG/M |
| 3300031771|Ga0318546_10526117 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 830 | Open in IMG/M |
| 3300031779|Ga0318566_10114052 | All Organisms → cellular organisms → Bacteria | 1331 | Open in IMG/M |
| 3300031860|Ga0318495_10212546 | Not Available | 870 | Open in IMG/M |
| 3300031890|Ga0306925_10958594 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 875 | Open in IMG/M |
| 3300031897|Ga0318520_10194457 | Not Available | 1194 | Open in IMG/M |
| 3300031910|Ga0306923_11513404 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 701 | Open in IMG/M |
| 3300031912|Ga0306921_10040489 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 5257 | Open in IMG/M |
| 3300031945|Ga0310913_11270722 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 511 | Open in IMG/M |
| 3300031954|Ga0306926_12192149 | Not Available | 615 | Open in IMG/M |
| 3300031954|Ga0306926_12392960 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 582 | Open in IMG/M |
| 3300031954|Ga0306926_12412381 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 579 | Open in IMG/M |
| 3300031981|Ga0318531_10493608 | Not Available | 554 | Open in IMG/M |
| 3300031981|Ga0318531_10595967 | Not Available | 501 | Open in IMG/M |
| 3300032035|Ga0310911_10363495 | Not Available | 836 | Open in IMG/M |
| 3300032035|Ga0310911_10568881 | Not Available | 657 | Open in IMG/M |
| 3300032041|Ga0318549_10521721 | Not Available | 534 | Open in IMG/M |
| 3300032042|Ga0318545_10249642 | Not Available | 637 | Open in IMG/M |
| 3300032043|Ga0318556_10148954 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1207 | Open in IMG/M |
| 3300032054|Ga0318570_10040179 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1902 | Open in IMG/M |
| 3300032059|Ga0318533_10094104 | All Organisms → cellular organisms → Bacteria | 2064 | Open in IMG/M |
| 3300032065|Ga0318513_10416178 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 656 | Open in IMG/M |
| 3300032066|Ga0318514_10336608 | Not Available | 799 | Open in IMG/M |
| 3300032094|Ga0318540_10198536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 966 | Open in IMG/M |
| 3300032094|Ga0318540_10578671 | Not Available | 541 | Open in IMG/M |
| 3300033290|Ga0318519_10009137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 3968 | Open in IMG/M |
| 3300033290|Ga0318519_10503477 | Not Available | 730 | Open in IMG/M |
| 3300033290|Ga0318519_10650608 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 642 | Open in IMG/M |
| 3300034448|Ga0370540_03625 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales | 793 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 37.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.27% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.08% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.31% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.54% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.54% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.65% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.77% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.77% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.77% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.77% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.77% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.89% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.89% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.89% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.89% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010061 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010100 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_5_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011332 | Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012376 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012379 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022525 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030829 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_357 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030839 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil TCEFB (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030902 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_356 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030903 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_369 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031022 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300031091 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031590 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300034448 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_115 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0066395_101059331 | 3300004633 | Tropical Forest Soil | MSAHKFSVGQTVHFSPDRGQEVAIRGRFTVVTLLPEAFGA |
| Ga0062388_1012484243 | 3300004635 | Bog Forest Soil | MIAHKFAVGQTVRFSPDRNQGVTVRGSFKVVRLLPEAASVLQYRVKSQL |
| Ga0066671_108934381 | 3300005184 | Soil | MSLHRFTVGQSVRFSPDRLQDSASRGRFKVVRLLPESANVLQ |
| Ga0066676_104026881 | 3300005186 | Soil | MTAHKFSVGQTVRFSPDRNQESTRRGSFKVLRLLPEEASV |
| Ga0070682_1018426551 | 3300005337 | Corn Rhizosphere | MQPPKFAVGQTVRFSPDRRQLSSARGEFKIVRLLPEEASVFQY |
| Ga0070691_105231513 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | MMSPHKYAIGQTVRFSPDRNQGATVRGSFKITRLLPEAASVLQYRVK |
| Ga0066699_101371871 | 3300005561 | Soil | MAARKFAVGQTVRFSPDRVQLRSARGQFEVLRLLPEDASIFQYR |
| Ga0070762_106601341 | 3300005602 | Soil | MAARKFAVGQTVRFSPDRVQLRSARGQFKVLRLLPEDASIFQYRVKSE |
| Ga0066903_1077900201 | 3300005764 | Tropical Forest Soil | MSAQHKFAVGQTVRYSPGLGQGSAGPGSFKIIRLLPETASV |
| Ga0070717_101306411 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MNAPKYAVGQTVRFSPDRHQLSSARGQFKVVRLLP |
| Ga0070717_101864625 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MLHKFAVGQTVRFSPDRNQDGTRGRGSFKIVRLLPESESIFQYRVKS |
| Ga0066651_103199981 | 3300006031 | Soil | MTRKFAVGQTVRFSPDRHQLSSARGQFKIVRLLPEDASV |
| Ga0066652_1002853935 | 3300006046 | Soil | MTRKFAVGQTVRFSPDRHQLSSARGQFKIVRLLPEDASVFQYRVKS |
| Ga0066659_108329204 | 3300006797 | Soil | MQPPKFAVGQTVRFSPDRRQLSSARGEFKIVRLLP |
| Ga0126373_104706531 | 3300010048 | Tropical Forest Soil | MSAHKFAVGQTVRFSPDRNQEGTARGSFKIVRLLPEEASVFQYRVKSQ |
| Ga0126373_125064003 | 3300010048 | Tropical Forest Soil | MAVHKFAVGQTVRFSPDRNQQGTVRGSFKIVRLLPEEASVL |
| Ga0127462_1992453 | 3300010061 | Grasslands Soil | MTRKFAVGQTVRFSPDRHQLSSARGQFKIVRLLPEDASVFQYRVKSQSD |
| Ga0127440_10738261 | 3300010100 | Grasslands Soil | MQPPKFAVGQTVRFAPDRRQLSSARGEFKIVRLLP |
| Ga0126370_117675321 | 3300010358 | Tropical Forest Soil | MSVHKFAVGQTVRFSPDRNQQGTARGSFKIVRLLPEDAS |
| Ga0126376_110940951 | 3300010359 | Tropical Forest Soil | MMLRATMTTHKFAVGEAVSFSPDKGQEHTGGELFEIVR |
| Ga0126376_119595323 | 3300010359 | Tropical Forest Soil | MAVHKFAVGQTVRFSPDRNQEVTVRGSFKIVRLLPEEASVFQY |
| Ga0126376_130640382 | 3300010359 | Tropical Forest Soil | MSAHKFSVGQTVRFSPDRNQEGATRGSFTVVRLLPEESSVFQYRVKS |
| Ga0126372_115841951 | 3300010360 | Tropical Forest Soil | MSAHKFSVGQTVHFSPDRGQEVAARGRFTIVSLLPEAANGFQYRVKSQTD |
| Ga0126377_123317562 | 3300010362 | Tropical Forest Soil | MSPHKFAVGQTVRFSPDRNQGVEVRGSFKIVRLLPEAASV |
| Ga0126381_1025074541 | 3300010376 | Tropical Forest Soil | VSAHKFGIGQTVRFSPDRNQRVEVRGSFTVVRLLPEAASILQYRVKSQL |
| Ga0126383_126220191 | 3300010398 | Tropical Forest Soil | MSAQHKFAVGQTVRYSPGLGQGSPGPGSFKIVRLLPEAASILQYR |
| Ga0150983_111445401 | 3300011120 | Forest Soil | MMIAHKFAVGQTVRFSPDRNQGVEVRGSFKIVRLLP |
| Ga0150983_114333181 | 3300011120 | Forest Soil | MAARKFAVGQTVRFSPDRVQLRSARGQFKVLRLLPEDASIFQYR |
| Ga0126317_102145391 | 3300011332 | Soil | MTAHKFTVGQTVRFSPDRNQEATGRGSFKIVRLLPEE |
| Ga0134032_11726974 | 3300012376 | Grasslands Soil | MSEHKFAVGQTVRFLPGRYQGGTAPGSFKIVRLMPESASVFQY |
| Ga0134058_10252293 | 3300012379 | Grasslands Soil | MTAHKFSVGQTVRFSPDRNQESTRRGSFKVLRLLP |
| Ga0137413_102196021 | 3300012924 | Vadose Zone Soil | MNARKYAVGQTVRFSPDRHQLSSARGQFKVVRLLPE |
| Ga0164307_107833694 | 3300012987 | Soil | MQPPKFAVGQTVRFSPDRRQLSSARGEFKIVRLLPEEASVFQYRVKSKVD |
| Ga0157374_115989833 | 3300013296 | Miscanthus Rhizosphere | MEAHKFTVGQTVRFSPHRNELSSAQGNFKIVRQLPEAA |
| Ga0137403_101523443 | 3300015264 | Vadose Zone Soil | MSGYKFAIGQSVRFSPDRIQLSSGRGRFKIVRLLPE |
| Ga0132255_1046854561 | 3300015374 | Arabidopsis Rhizosphere | MEAHKFTVGQTVRFSPHRNELSSAQGNFKIVRQLPEAANVYQYRVKSQ |
| Ga0132255_1057515113 | 3300015374 | Arabidopsis Rhizosphere | MQAPKFAVGQTVRFSPDRHQLSSAGGQFKVVRLLPEDAS |
| Ga0182041_107687041 | 3300016294 | Soil | MSEHKFGVGQTVRLSPDRNQQVAARGSFKIVRLLPEEASVLQY |
| Ga0182033_108178723 | 3300016319 | Soil | MTAHKFAVGQTVRFSPDRNQGVEVRGSFKIVRLLPEAASVLQ |
| Ga0182035_103304843 | 3300016341 | Soil | MTAHKFAVGQTVRFSPDRNQGVEVRGSFKIVRLLPEAASVLQYRV |
| Ga0182035_106722321 | 3300016341 | Soil | MTVHKFAVGQTVRFSPDRNQGVTVRGSFKVVRLLPEAAS |
| Ga0182040_117131542 | 3300016387 | Soil | MSAQHKFAVGQTVRFSPGLGQGSPGSGSFKIVRLLPEAASVLQYRVKSQLDG |
| Ga0182037_106541114 | 3300016404 | Soil | MSEHKFGVGQTVRFSPDRNQQGAARGSFKVVRLLPEEASVLQ |
| Ga0182039_105476721 | 3300016422 | Soil | MATHKFAVGHTVRFSPDRGQEHEKGEFFKIVRLLPEAGGVL |
| Ga0182039_117684072 | 3300016422 | Soil | MATHKFAVGQTVRFSPDPGQEHAKGGLFKIVRLLPEAGNM |
| Ga0210399_106544092 | 3300020581 | Soil | MMIAHKFAVGQTVRFSPDRNQGVEVRGSFKIVRLL |
| Ga0187846_101103133 | 3300021476 | Biofilm | MSPHKFAVGQTVRFSPDRNQGVTVRGSFKVVRLLPEAASVL |
| Ga0126371_104664625 | 3300021560 | Tropical Forest Soil | MSAQHKFAVGQTVRYSPGLGQGAAGPGSFKIIRLLPETASVLQ |
| Ga0242656_10483261 | 3300022525 | Soil | MSPHKFAVGQTVRFSPDRNQGVTVRGGFKVVRLLPEAASVLQYRVK |
| Ga0242660_12511731 | 3300022531 | Soil | MDSHKFTVGQAVQFSPDRQQSAVRGSRFKIVRLLPEAGSVP |
| Ga0242662_101506401 | 3300022533 | Soil | MMIAHKFAVGQTVRFSPDRNQGVEVRGSFKIVRLLPEA |
| Ga0242665_100981261 | 3300022724 | Soil | MSVHKFAVGQTVRFSPDRNQGVTVRGSFKVVRLLPEAASVL |
| Ga0242665_101531571 | 3300022724 | Soil | MSPHKFAVGQTVRFSPDRNQGVTVRGGFKVVRLLPEAASVLQY |
| Ga0207659_117445723 | 3300025926 | Miscanthus Rhizosphere | MMSPHKYAIGQTVRFSPDRNQGATVRGSFKITRLLPE |
| Ga0207639_117852973 | 3300026041 | Corn Rhizosphere | MMSPHKYAIGQTVRFSPDRNQGATVRGSFKITRLLPEAASVLQ |
| Ga0207641_122527491 | 3300026088 | Switchgrass Rhizosphere | MQPPKFAVGQTVRFSPDRRQLSSARGEFKIVRLLPEEASVFQYRVKSKV |
| Ga0209240_11042681 | 3300026304 | Grasslands Soil | MLHKFAVGQTVRFSPDRNQDGTRGRGSFKIVRLLPESESIFQYRV |
| Ga0209265_11631131 | 3300026308 | Soil | MQPPKFAVGQTVRFSPDRRQLSSARGEFKIVRLLPEEASVFQ |
| Ga0209152_100755764 | 3300026325 | Soil | MQPPKFAVGQTVRFSPDRVQLRSARGQFEVLRLLPEDASIFQYRVKSQ |
| Ga0209446_11099681 | 3300027698 | Bog Forest Soil | MSAHKFTIGQTVRFSPDRNQGVTVRGSFKVVRLLPEAASILQYRVKS |
| Ga0307482_11790802 | 3300030730 | Hardwood Forest Soil | MSAHKFAVGQTVRFSPDRNQGITVRGSFKIVRLLPETASILQYRVKS |
| Ga0308203_10119384 | 3300030829 | Soil | MSAHKFAVGQTVRFSPDRNQGTTVRGSFKITRLLPEAASVLQYAKMRDNK |
| Ga0073999_111713303 | 3300030839 | Soil | MNARKYAVGQTVRFSPDRHQLSSARGQFKVVRLLPEDAS |
| Ga0308202_10787483 | 3300030902 | Soil | MSPHKFVIGQTVRFQPDRNQGTTARGQFKITRLLPETASVLQYRVKS |
| Ga0308206_10277611 | 3300030903 | Soil | MSVHKFAVGQTVRFLPGRYQGGTAPGSFKIVRLMPESASVF |
| Ga0138301_18613431 | 3300031022 | Soil | MNAPKYAVGQTVRFSPDRHQLSSARGQFKVVRLLPEDASVFQ |
| Ga0308201_100548031 | 3300031091 | Soil | MMSAHKYAIGQTVRFSPDRNQGTTVRGSFKITRLLPEAASVLQ |
| Ga0170820_157333351 | 3300031446 | Forest Soil | MYAHKFAVGQTVRFSPDRNQGVEVRGSFKIVRLLPETAS |
| Ga0318516_102630521 | 3300031543 | Soil | MATHKFAVGQTVRFSPDRYQEPATKGGLFKIVRPLPEAGGAL |
| Ga0318541_108646981 | 3300031545 | Soil | MSAQHKFAVGQTVRFLPDLGQGVPSSGSFKIVRLL |
| Ga0318573_103506103 | 3300031564 | Soil | MSAQHKFAVGQTVRFLPDLGQGVPSSGSFKIVRLLPEAASALQYRVKSQ |
| Ga0318573_105901302 | 3300031564 | Soil | MSPQHKFAIGQTVRFSPDLGQGNAVPGSFKITRLLPEAASVLQY |
| Ga0318573_107465303 | 3300031564 | Soil | MSPQHKFAIGQTVRFSPGLGQGSPGSGSFKITRLLPEAASVLQY |
| Ga0318515_100834461 | 3300031572 | Soil | MVTHKFAVGQTVRFSPDPGQEHAKGGLFKIVRLLPE |
| Ga0307483_10223091 | 3300031590 | Hardwood Forest Soil | MSAHKFAVGQTVRFSPDRNQGITVRGSFKIVRLLPETASILQYR |
| Ga0318555_105100791 | 3300031640 | Soil | MLAQHKFAVGQTVRFLPDLGQGSPSSGSFKIVRLLPEAASVLQYRVKSQL |
| Ga0307469_114731322 | 3300031720 | Hardwood Forest Soil | MSVCKFAVGQAVRFSPDRYPGGASPGTLKVVRLQPEAASVLQYRVKS |
| Ga0318500_103607741 | 3300031724 | Soil | MSAQHKFAVGQTVRFSADLGQGSPGSASFKIVRLLPEAASVLQY |
| Ga0306918_107376243 | 3300031744 | Soil | MSAQHKFAVGQTVRFLPDLGQGVPSSGSFKIVRLLP |
| Ga0318502_105546111 | 3300031747 | Soil | MSAQHKFAVGQTVRFSADLGQGSPGSASFKIVRLLPE |
| Ga0318492_102692681 | 3300031748 | Soil | MSAHHKFAVGQTVRFLPDLGQGAPSSGSFKIVRLLPEAASALQYRVKSQVDGH |
| Ga0318494_104518591 | 3300031751 | Soil | MSPHKFAVGQTVRFSPDRNQGVTVRGSFKIVRLLPEAASVLQYRVKS |
| Ga0307477_109027541 | 3300031753 | Hardwood Forest Soil | MAPHKFAVGQKVHFSPDRQQLHSGQGWFNVVRMLPEAANVLQYRVKSEVD |
| Ga0318537_102868383 | 3300031763 | Soil | MSAHHKFAVGQTVRFLPDLGQGAPSSGSFKIVRLLPEAAS |
| Ga0318521_101397151 | 3300031770 | Soil | MSAHHKFAVGQTVRFLPDLGQGAPSSGSFKIVRLLPEAASALQYRVKSQV |
| Ga0318546_105261174 | 3300031771 | Soil | VAVHKFAVGQTVRFSPDRNQEGTARGSFKIVRLLPEEASVLQYRVKSQL |
| Ga0318566_101140521 | 3300031779 | Soil | MSVHKFAVGQTVRFSPDRNQGVTVRGSFKVVRLLPEAASVLQYR |
| Ga0318495_102125461 | 3300031860 | Soil | MSAQHKFAVGQTVRFSADLGQGSPGSASFKIVRLLPEAASVLQYRVKSQLDGH |
| Ga0306925_109585941 | 3300031890 | Soil | MLAQHKFAVGQTVRFLPDLGQGSPSSGSFKIVRLLPEAASVLQYRVT |
| Ga0318520_101944575 | 3300031897 | Soil | VAVHKFAVGQTVRFSPDRNQEGTARGSFKIVRLLPEEASVLQYRVKSQLDG |
| Ga0306923_115134043 | 3300031910 | Soil | MSVHKFAVGQTVRFSPDRNQGVTVRGSFKVVRLLPEAASVLQYRV |
| Ga0306921_100404891 | 3300031912 | Soil | MTVRKFAVGQSVRFSPDRNQGVTVRGGFKVVRLLPGAASILQYRVKSQLDGHE |
| Ga0310913_112707221 | 3300031945 | Soil | MLAQHKFAVGQTVRFLPDLGQGSPSSGSFKIVRLLPEAASVLQY |
| Ga0306926_121921493 | 3300031954 | Soil | MSPQHKFAIGQTVRFSPGLGQGSPGSGSFKITRLLPEAASVLQYRVKS |
| Ga0306926_123929601 | 3300031954 | Soil | MLAQHKFAVGQTVRFLPDLGQGSPSSGSFKIVRLLPEAAS |
| Ga0306926_124123812 | 3300031954 | Soil | MSVHKFAVGQTVRFSPDRNQGVTVRGSFKVVRLLPEAA |
| Ga0318531_104936081 | 3300031981 | Soil | MSAQHKFAIGQTVRFSPGLGQGSPGSGSFKIVRLLPESASVLQY |
| Ga0318531_105959671 | 3300031981 | Soil | MSAQHKFAVGQTVRFLPDLGQGTPSSGSFKIVRLLPEAASALQYRVK |
| Ga0310911_103634954 | 3300032035 | Soil | MSAHHKFAVGQTVRFLPDLGQGAPSSGSFKIVRLLPEAASALQYR |
| Ga0310911_105688811 | 3300032035 | Soil | MTVRKFAVGQSVRFSPDRNQGVTVRGGFKVVRLLPGAASILQYRVKSQL |
| Ga0318549_105217212 | 3300032041 | Soil | MSDHKFGVGQTVRFSPDRNQQVAARGSFKIVRLLPEEASVLQY |
| Ga0318545_102496421 | 3300032042 | Soil | MSAQHKFAVGQTVRFLPDLGQGTPSSGSFKIVRLLPEAASALQY |
| Ga0318556_101489541 | 3300032043 | Soil | MSPQHKFAIGQTVRFSPGLGQGSPGSGSFKITRLLPEAAS |
| Ga0318570_100401795 | 3300032054 | Soil | MTVHKFAVGQTVRFSPDRSQGVTVRGSFKVVRLLPEAASVLQYRVKSQLD |
| Ga0318533_100941041 | 3300032059 | Soil | MSAQHKFAVGQTVRFSADLGQGSPGSASFKIVRLLPEAASVLQYRV |
| Ga0318513_104161781 | 3300032065 | Soil | MTVHKFAVGQTVRFSPDRSQGVTVRGSFKVVRLLPEAASVLQYRVKSQLDGH |
| Ga0318514_103366083 | 3300032066 | Soil | MTVHKFAVGQSVRFSPDRNQGVTVRGGFKVVRLLPGAASILQYR |
| Ga0318540_101985363 | 3300032094 | Soil | MSPQHKFAIGQTVRFSPDLGQGNAVPGSFKITRLLPEAASVLQYRVKSQL |
| Ga0318540_105786711 | 3300032094 | Soil | MSAQHKFAVGQTVRFLPDLGQGTPSSGSFKIVRLLPEAASALQYRVKSQ |
| Ga0318519_100091379 | 3300033290 | Soil | VAVHKFAVGQTVRFSPDRNQEGTARGSFKIVRLLP |
| Ga0318519_105034771 | 3300033290 | Soil | MSEHKFGVGQTVRFSPDRNQQVAARGSFKIVRLLPEEASVLQYRVKSQ |
| Ga0318519_106506082 | 3300033290 | Soil | MRRPGEQNMSPHKFAVGQTVRFSPDRNQGVTVRGSFKVVRLLPEAASVLQY |
| Ga0370540_03625_668_793 | 3300034448 | Soil | MPAHKFAVGQTVRFSPDRNQEHTARGSFKIVRLLPEEASVFQ |
| ⦗Top⦘ |