


| Basic Information | |
|---|---|
| Family ID | F082399 |
| Family Type | Metagenome |
| Number of Sequences | 113 |
| Average Sequence Length | 43 residues |
| Representative Sequence | LVKMTAVVIVTSPKTQTRKTREEAKVVRSMNFPVPISVLITGS |
| Number of Associated Samples | 108 |
| Number of Associated Scaffolds | 113 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.12 % |
| % of genes from short scaffolds (< 2000 bps) | 93.81 % |
| Associated GOLD sequencing projects | 103 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.21 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (83.186 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil (11.504 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.858 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.673 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.07% β-sheet: 0.00% Coil/Unstructured: 54.93% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.21 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 113 Family Scaffolds |
|---|---|---|
| PF09361 | Phasin_2 | 73.45 |
| PF02617 | ClpS | 2.65 |
| PF02861 | Clp_N | 1.77 |
| PF13519 | VWA_2 | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
|---|---|---|---|
| COG2127 | ATP-dependent Clp protease adapter protein ClpS | Posttranslational modification, protein turnover, chaperones [O] | 2.65 |
| COG0542 | ATP-dependent Clp protease, ATP-binding subunit ClpA | Posttranslational modification, protein turnover, chaperones [O] | 1.77 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 83.19 % |
| Unclassified | root | N/A | 16.81 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2065487018|GPINP_F5MS3JC02JR5J3 | Not Available | 520 | Open in IMG/M |
| 2124908045|KansclcFeb2_ConsensusfromContig823521 | Not Available | 526 | Open in IMG/M |
| 3300001686|C688J18823_10188933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1395 | Open in IMG/M |
| 3300002155|JGI24033J26618_1036577 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 674 | Open in IMG/M |
| 3300002568|C688J35102_120117883 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 887 | Open in IMG/M |
| 3300003322|rootL2_10108671 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1732 | Open in IMG/M |
| 3300003322|rootL2_10132756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2061 | Open in IMG/M |
| 3300003911|JGI25405J52794_10048399 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 908 | Open in IMG/M |
| 3300004082|Ga0062384_100784696 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 664 | Open in IMG/M |
| 3300005575|Ga0066702_10394290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 844 | Open in IMG/M |
| 3300005576|Ga0066708_10187640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1290 | Open in IMG/M |
| 3300005578|Ga0068854_102195712 | Not Available | 511 | Open in IMG/M |
| 3300005843|Ga0068860_100373567 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1406 | Open in IMG/M |
| 3300006031|Ga0066651_10198254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1062 | Open in IMG/M |
| 3300006047|Ga0075024_100028654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2272 | Open in IMG/M |
| 3300006047|Ga0075024_100465975 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 656 | Open in IMG/M |
| 3300006052|Ga0075029_100344321 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 959 | Open in IMG/M |
| 3300006102|Ga0075015_100100645 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1450 | Open in IMG/M |
| 3300006800|Ga0066660_10459166 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1066 | Open in IMG/M |
| 3300009088|Ga0099830_11008381 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 690 | Open in IMG/M |
| 3300009092|Ga0105250_10461539 | Not Available | 571 | Open in IMG/M |
| 3300009143|Ga0099792_10533828 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 739 | Open in IMG/M |
| 3300009143|Ga0099792_10561660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 723 | Open in IMG/M |
| 3300009148|Ga0105243_11327856 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 737 | Open in IMG/M |
| 3300009545|Ga0105237_11588105 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 661 | Open in IMG/M |
| 3300009551|Ga0105238_11536761 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 695 | Open in IMG/M |
| 3300009627|Ga0116109_1135694 | Not Available | 554 | Open in IMG/M |
| 3300009635|Ga0116117_1157804 | Not Available | 586 | Open in IMG/M |
| 3300009700|Ga0116217_10079292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2284 | Open in IMG/M |
| 3300009824|Ga0116219_10159064 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1304 | Open in IMG/M |
| 3300010038|Ga0126315_10533037 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 752 | Open in IMG/M |
| 3300010166|Ga0126306_11050075 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 665 | Open in IMG/M |
| 3300010375|Ga0105239_10240799 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2030 | Open in IMG/M |
| 3300010397|Ga0134124_10638951 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1047 | Open in IMG/M |
| 3300011003|Ga0138514_100021786 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1155 | Open in IMG/M |
| 3300011269|Ga0137392_11181892 | Not Available | 623 | Open in IMG/M |
| 3300012189|Ga0137388_11439173 | Not Available | 627 | Open in IMG/M |
| 3300012189|Ga0137388_11924045 | Not Available | 521 | Open in IMG/M |
| 3300012202|Ga0137363_10113509 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2079 | Open in IMG/M |
| 3300012207|Ga0137381_11483547 | Not Available | 570 | Open in IMG/M |
| 3300012903|Ga0157289_10167736 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 691 | Open in IMG/M |
| 3300012907|Ga0157283_10189115 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 640 | Open in IMG/M |
| 3300012924|Ga0137413_10722945 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 758 | Open in IMG/M |
| 3300012927|Ga0137416_10028630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3680 | Open in IMG/M |
| 3300012929|Ga0137404_10980837 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 773 | Open in IMG/M |
| 3300012930|Ga0137407_11856446 | Not Available | 574 | Open in IMG/M |
| 3300012961|Ga0164302_10432780 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 908 | Open in IMG/M |
| 3300012986|Ga0164304_11790554 | Not Available | 514 | Open in IMG/M |
| 3300012988|Ga0164306_10056680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2394 | Open in IMG/M |
| 3300014200|Ga0181526_10765174 | Not Available | 608 | Open in IMG/M |
| 3300014326|Ga0157380_10302184 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1475 | Open in IMG/M |
| 3300014497|Ga0182008_10841120 | Not Available | 536 | Open in IMG/M |
| 3300014502|Ga0182021_12078702 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 684 | Open in IMG/M |
| 3300015089|Ga0167643_1035892 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 767 | Open in IMG/M |
| 3300019866|Ga0193756_1036278 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 694 | Open in IMG/M |
| 3300019876|Ga0193703_1056478 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 595 | Open in IMG/M |
| 3300019877|Ga0193722_1037624 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1245 | Open in IMG/M |
| 3300020034|Ga0193753_10151681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1104 | Open in IMG/M |
| 3300021171|Ga0210405_10356795 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1153 | Open in IMG/M |
| 3300022694|Ga0222623_10192379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 792 | Open in IMG/M |
| 3300023079|Ga0247758_1217557 | Not Available | 531 | Open in IMG/M |
| 3300025406|Ga0208035_1059562 | Not Available | 585 | Open in IMG/M |
| 3300025891|Ga0209585_10060484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1405 | Open in IMG/M |
| 3300025900|Ga0207710_10486308 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 640 | Open in IMG/M |
| 3300025912|Ga0207707_11309765 | Not Available | 582 | Open in IMG/M |
| 3300025916|Ga0207663_10354811 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1111 | Open in IMG/M |
| 3300025924|Ga0207694_10559796 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 960 | Open in IMG/M |
| 3300025939|Ga0207665_10151378 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1662 | Open in IMG/M |
| 3300026035|Ga0207703_11083683 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 769 | Open in IMG/M |
| 3300026041|Ga0207639_10761773 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 901 | Open in IMG/M |
| 3300026089|Ga0207648_11011562 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 778 | Open in IMG/M |
| 3300026142|Ga0207698_11517477 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 685 | Open in IMG/M |
| 3300026273|Ga0209881_1111665 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 681 | Open in IMG/M |
| 3300026308|Ga0209265_1181705 | Not Available | 557 | Open in IMG/M |
| 3300026340|Ga0257162_1003254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1806 | Open in IMG/M |
| 3300026377|Ga0257171_1019766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1133 | Open in IMG/M |
| 3300026475|Ga0257147_1024885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 847 | Open in IMG/M |
| 3300026508|Ga0257161_1065768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 740 | Open in IMG/M |
| 3300026530|Ga0209807_1126143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1031 | Open in IMG/M |
| 3300026542|Ga0209805_1222578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 789 | Open in IMG/M |
| 3300026552|Ga0209577_10249562 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1340 | Open in IMG/M |
| 3300026880|Ga0209623_1005573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 752 | Open in IMG/M |
| 3300027381|Ga0208983_1009968 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1798 | Open in IMG/M |
| 3300027480|Ga0208993_1034248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 906 | Open in IMG/M |
| 3300027524|Ga0208998_1024974 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 944 | Open in IMG/M |
| 3300027530|Ga0209216_1092925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 528 | Open in IMG/M |
| 3300027535|Ga0209734_1038160 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 902 | Open in IMG/M |
| 3300027535|Ga0209734_1039954 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 881 | Open in IMG/M |
| 3300027587|Ga0209220_1027503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1526 | Open in IMG/M |
| 3300027625|Ga0208044_1056680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1233 | Open in IMG/M |
| 3300027663|Ga0208990_1113201 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 743 | Open in IMG/M |
| 3300027674|Ga0209118_1140347 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 670 | Open in IMG/M |
| 3300027750|Ga0209461_10052262 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 835 | Open in IMG/M |
| 3300027894|Ga0209068_10235431 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1015 | Open in IMG/M |
| 3300027895|Ga0209624_10958538 | Not Available | 556 | Open in IMG/M |
| 3300027908|Ga0209006_10205440 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1709 | Open in IMG/M |
| 3300028047|Ga0209526_10110562 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1933 | Open in IMG/M |
| 3300028146|Ga0247682_1077748 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 609 | Open in IMG/M |
| 3300028536|Ga0137415_10821846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 739 | Open in IMG/M |
| 3300028780|Ga0302225_10154225 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1113 | Open in IMG/M |
| 3300028785|Ga0302201_10103679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. DOA9 | 1277 | Open in IMG/M |
| 3300028876|Ga0307286_10024060 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1977 | Open in IMG/M |
| 3300029907|Ga0311329_10303742 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1158 | Open in IMG/M |
| 3300029917|Ga0311326_10084913 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1773 | Open in IMG/M |
| 3300030041|Ga0302274_10337338 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 689 | Open in IMG/M |
| 3300030707|Ga0310038_10380698 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 618 | Open in IMG/M |
| 3300031198|Ga0307500_10065779 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 909 | Open in IMG/M |
| 3300031456|Ga0307513_10460741 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 994 | Open in IMG/M |
| 3300031474|Ga0170818_108265870 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 695 | Open in IMG/M |
| 3300031708|Ga0310686_110464757 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 615 | Open in IMG/M |
| 3300031858|Ga0310892_10428924 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 867 | Open in IMG/M |
| 3300031995|Ga0307409_100320426 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1450 | Open in IMG/M |
| 3300032174|Ga0307470_10987395 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium icense | 669 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.50% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 11.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.31% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.42% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.54% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 3.54% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.54% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.65% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.65% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.77% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.77% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.77% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.77% |
| Sugarcane Root And Bulk Soil | Host-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil | 1.77% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.77% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.89% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.89% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.89% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.89% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.89% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.89% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.89% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.89% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.89% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.89% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.89% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.89% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.89% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.89% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.89% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Agave | Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2065487018 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Host-Associated | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003322 | Sugarcane root Sample L2 | Host-Associated | Open in IMG/M |
| 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009627 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_10 | Environmental | Open in IMG/M |
| 3300009635 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300011003 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012903 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1 | Environmental | Open in IMG/M |
| 3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015089 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8A, Adjacent to main proglacial river, end of transect (Watson river)) | Environmental | Open in IMG/M |
| 3300019866 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1m1 | Environmental | Open in IMG/M |
| 3300019876 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3a2 | Environmental | Open in IMG/M |
| 3300019877 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1 | Environmental | Open in IMG/M |
| 3300020034 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2 | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300023079 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L156-409C-4 | Environmental | Open in IMG/M |
| 3300025406 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025891 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-one (SPAdes) | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026273 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193 (SPAdes) | Environmental | Open in IMG/M |
| 3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
| 3300026340 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-A | Environmental | Open in IMG/M |
| 3300026377 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-B | Environmental | Open in IMG/M |
| 3300026475 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-A | Environmental | Open in IMG/M |
| 3300026508 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-A | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300026880 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027381 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027480 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027524 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027530 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027535 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027625 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027663 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027750 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028146 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK23 | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300028785 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_2 | Environmental | Open in IMG/M |
| 3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
| 3300029907 | I_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300029917 | I_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300030041 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_1 | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300031198 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S | Environmental | Open in IMG/M |
| 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Host-Associated | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPINP_02871920 | 2065487018 | Soil | MIAVVIVNNAKTLARRTREEAKVVRSMNFPVPISDLITGS |
| KansclcFeb2_07628990 | 2124908045 | Soil | SVVKMIAVVIVNSARALTRRRREEAKVVRSINFPVPISVLITGS |
| C688J18823_101889331 | 3300001686 | Soil | VNMTAVEAATSPKTQTRKAREEANVVRSINFPVPISVLITGS* |
| JGI24033J26618_10365771 | 3300002155 | Corn, Switchgrass And Miscanthus Rhizosphere | SLEINIAVLKVTSPRAHTRNAREEAKVVRSIYFPVPISVLITGA* |
| C688J35102_1201178831 | 3300002568 | Soil | INIALVKVTSPRAHTRNAREEAKVVRSIYFPVPISVLITGS* |
| rootL2_101086713 | 3300003322 | Sugarcane Root And Bulk Soil | SALSLEIRIVVVKVISPRAHTRKAREEAKVVRSIYFPVPISVLITGP* |
| rootL2_101327561 | 3300003322 | Sugarcane Root And Bulk Soil | SALSLEIRIAAVKVMSPRAHTRNAREEAKVVRSIYFPVPISVLITGL* |
| JGI25405J52794_100483991 | 3300003911 | Tabebuia Heterophylla Rhizosphere | SALSLEISIAVVKVMSPRAHTRKAREEAKVVRSIYFPVPISVLITGS* |
| Ga0062384_1007846962 | 3300004082 | Bog Forest Soil | VSLVKATAVVTVTNPKTQTRKREEAKVVRSMNFPVPISVLITGP* |
| Ga0066702_103942901 | 3300005575 | Soil | VKMAAVVTVVSPRTQTRNTREEAKFVQSMNFPAPISALITGS* |
| Ga0066708_101876401 | 3300005576 | Soil | SAESVVKMIAVVIVNSAKTLTRRTCEEAKIVRSMNFPVPISVLITGS* |
| Ga0068854_1021957122 | 3300005578 | Corn Rhizosphere | VRRASALSLVKMIAVVAVISPKTQTRKVREEANLVRSMNFPVPISVLITGS* |
| Ga0068860_1003735671 | 3300005843 | Switchgrass Rhizosphere | VVKVMSPRAHTRKAREEAKVVRSIYFPVPISVLINGS* |
| Ga0066651_101982541 | 3300006031 | Soil | WRGCWDRRACAASPVKMAAVVTVVSPRTQTRNTREEAKFVQSMNFPAPISALITGS* |
| Ga0075024_1000286541 | 3300006047 | Watersheds | ALSLVKRTAVETVTSPKTQTRKTREEPKVVRSMNFPVPISVLITGS* |
| Ga0075024_1004659753 | 3300006047 | Watersheds | VIKPKAEKRSTRVEAKVLRSMHFPVPISALITGS* |
| Ga0075029_1003443211 | 3300006052 | Watersheds | AVETVTSPKTQTRKTREEPKVVRSMNFPVPISVLITGS* |
| Ga0075015_1001006451 | 3300006102 | Watersheds | VETVTSPKTQTRKTREEPKVVRSMNFPVPISVLITGS* |
| Ga0066660_104591664 | 3300006800 | Soil | ERRASARSLVEMTAVVIVTSPKTQTRKPREEVDIVRSINFPVPISLLITGS* |
| Ga0099830_110083811 | 3300009088 | Vadose Zone Soil | LVKMSVVVIVNSPKMPARRTREDAMVVRSINFPVPISVLITGS* |
| Ga0105250_104615391 | 3300009092 | Switchgrass Rhizosphere | RASALSLVMRIAVVKVASPRTQTRNEREEAKVVRSIYFPVPISVLITGT* |
| Ga0099792_105338281 | 3300009143 | Vadose Zone Soil | ALSLLISIAVVKVMSPRAHTRKAREEAKVVRSIYFPVPISVLITGS* |
| Ga0099792_105616602 | 3300009143 | Vadose Zone Soil | RASAESVVKMIAVVIVNNAKTLARRTREEAKVVRSMNFPVPISLS* |
| Ga0105243_113278561 | 3300009148 | Miscanthus Rhizosphere | RASALSLEIRIAVVKVTSPRAHTRNVREEAKVVRSIYFPVPISVLITGS* |
| Ga0105237_115881052 | 3300009545 | Corn Rhizosphere | SALSLVISIALVKVMSPRAHTRNAREDAKVVRSIYFPVPISVLITGS* |
| Ga0105238_115367612 | 3300009551 | Corn Rhizosphere | ALMVASPKAQARMTREEAKVVRSIDFPVPNFSFITGS* |
| Ga0116109_11356941 | 3300009627 | Peatland | ASAVPDVKASAVVIVTKPKAQTRIREEAKVVRSMNFPVPISVLITGS* |
| Ga0116117_11578042 | 3300009635 | Peatland | AVSLVKATAAVTVTNPKTHTRKREEAKVVRSMNFPVPISVLITGS* |
| Ga0116217_100792921 | 3300009700 | Peatlands Soil | SAVSVVKAAAVVAATNPKTQTRKTREEAKVVRSMNFPVPISALVTGS* |
| Ga0116219_101590641 | 3300009824 | Peatlands Soil | KVAAVVTATNPKKQARKTREEAKVVRSMNFPVPISALVTGS* |
| Ga0126315_105330371 | 3300010038 | Serpentine Soil | SASLVKMTAVVIVTSPKMQTCKTREEALVVRSINFPVPISVLITGS* |
| Ga0126306_110500751 | 3300010166 | Serpentine Soil | SLEIRIAVVKVMSPRAHTRNAREEAKVVRSIYFPVPISVLITGA* |
| Ga0105239_102407992 | 3300010375 | Corn Rhizosphere | VASPKAQARITREEAKVVRSINFPVPNFSFITGS* |
| Ga0134124_106389513 | 3300010397 | Terrestrial Soil | AVVKVMSPRAHTRKAREEAKVVRSIYFPVPISVLINGS* |
| Ga0138514_1000217863 | 3300011003 | Soil | EINIAVVKVTSPRAHTRNAREEAKVVRSIYFPVPISVLITGT* |
| Ga0137392_111818921 | 3300011269 | Vadose Zone Soil | KMIAVVIANSAKTPTRRTREEAKVVRSMNFPVPISVLITGS* |
| Ga0137388_114391732 | 3300012189 | Vadose Zone Soil | SALSLVKMIAVVIVNSPKMPARRTREDAMVVRSINFPVPISVLITGS* |
| Ga0137388_119240451 | 3300012189 | Vadose Zone Soil | ERRASAESVVKMIAVVIANSAKTLTRRTREEAKVVRSMNFLVPISVLITGS* |
| Ga0137363_101135094 | 3300012202 | Vadose Zone Soil | LERRASAESVVKMIAVVIVNSAKTLTRRTREEAKVVRSMNFPVPQFLS* |
| Ga0137381_114835471 | 3300012207 | Vadose Zone Soil | VVKVTSPRTQTRNVREEAKVVRSIYFPVPISILITGS* |
| Ga0157289_101677361 | 3300012903 | Soil | LEINIAVVKVTSPRAHTRNAREEAKVVRSIYFPVPISVLITGA* |
| Ga0157283_101891152 | 3300012907 | Soil | RASALSLVISIALVKVMSPRAHTRNAREDAKVVRSIYFPVPISVLITGA* |
| Ga0137413_107229451 | 3300012924 | Vadose Zone Soil | IAVVKVTSPRTQARNVREEAKVVRSIYFPVPISILITGS* |
| Ga0137416_100286305 | 3300012927 | Vadose Zone Soil | SALSLVITIADVKVANPRTQTRNAREEAKVVRSIYFPVPISILITGS* |
| Ga0137404_109808371 | 3300012929 | Vadose Zone Soil | ATNPKKQTRKTCEEAKVVRSMNFPVPISVLITGS* |
| Ga0137407_118564461 | 3300012930 | Vadose Zone Soil | LVQMIAVVKVTSPRTHTRNAREEAKVVRSIYFPVPISILITGS* |
| Ga0164302_104327802 | 3300012961 | Soil | IENSAKTLTRRTREEAKVVRSMNFPVPISVLITGS* |
| Ga0164304_117905541 | 3300012986 | Soil | LSLEIRIAVVKVMSPRAHTRKAREEAKVVRSIYFPVPISVLITGS* |
| Ga0164306_100566804 | 3300012988 | Soil | LERRASAESVVKMIAVVIVNNAKTLARRTREEAKVVRSMNFPVPISVLITGS* |
| Ga0181526_107651742 | 3300014200 | Bog | STVSVVKAAAVVAATNPKTQTRKTREEAKVVRSMNFPVPISALITGS* |
| Ga0157380_103021841 | 3300014326 | Switchgrass Rhizosphere | IRIAVVKVMSPRAHTRNTREEAKVVRSIYFPVPISVLITGA* |
| Ga0182008_108411201 | 3300014497 | Rhizosphere | ISIAVVKVMSPRAHTRKAREEAKVVRSIYFPVPISVLITAT* |
| Ga0182021_120787021 | 3300014502 | Fen | AVVIVTSPKTQTRKTREEAKVVRSMNFPVPISVLITGS* |
| Ga0167643_10358922 | 3300015089 | Glacier Forefield Soil | ALSVVKMTAVVIVSRPKTPARRTREEAKVVRSMNFPVPISVLITGS* |
| Ga0193756_10362782 | 3300019866 | Soil | LVKMTAAVVVTSPKMQARKIREEAKVVRSMNFPVPISALITGS |
| Ga0193703_10564782 | 3300019876 | Soil | VKVMSPRAHTRKAREEAKVVRSIYFPVPISVLITGS |
| Ga0193722_10376241 | 3300019877 | Soil | SALSVVKMIAVVKVTSPRTQTRKLREEAKVVRSIYFPVPISILITGS |
| Ga0193753_101516813 | 3300020034 | Soil | IVTSPRTHTRNVREEAKVVRSIYFPVPISILITGS |
| Ga0210405_103567951 | 3300021171 | Soil | KVTAVVTATNPKKQARKTREEANVVRSMNFPVPISALITGS |
| Ga0222623_101923791 | 3300022694 | Groundwater Sediment | MIAVVIVNSAKTLTRRTREEAKVVRSMNFPVPISVLITGS |
| Ga0247758_12175573 | 3300023079 | Plant Litter | VSVVKMTAVMMVARPSTQTRRLREEAKVVRSINFPVPISVLITGS |
| Ga0208035_10595622 | 3300025406 | Peatland | AVSLVKATAAVTVTNPKTHTRKREEAKVVRSMNFPVPISVLITGS |
| Ga0209585_100604841 | 3300025891 | Arctic Peat Soil | LVKMTAVVIVTSPKTQTRKTREEAKVVRSMNFPVPISVLITGS |
| Ga0207710_104863082 | 3300025900 | Switchgrass Rhizosphere | SALSLEISIAVVKVMSPRAHTRKAREEAKVVRSIYFPVPISVLITAT |
| Ga0207707_113097651 | 3300025912 | Corn Rhizosphere | AVVAVISPKTQTRKVREEANLVRSMNFPVPISVLITGS |
| Ga0207663_103548111 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | RRASAVLVVKVTAVVTATNPKKQTRKACEEAKVVRSMNFPVPISALITGS |
| Ga0207694_105597961 | 3300025924 | Corn Rhizosphere | RASALSLVVMIAVVKVISPRTHTRKLREEAKVVRSIYFPVPISILITGS |
| Ga0207665_101513781 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | LEINIAVVNVMSPRAHTRNAREEAKVVRSIYFPVPISVLITAT |
| Ga0207703_110836832 | 3300026035 | Switchgrass Rhizosphere | MIAVVKVTSPRTQTRKLREEAKVVRSIYFPVPISILITGS |
| Ga0207639_107617732 | 3300026041 | Corn Rhizosphere | RASALSLLIRIAVVKVMSPRAHTRKAREEAKVVRSIYFPVPISVLITGS |
| Ga0207648_110115621 | 3300026089 | Miscanthus Rhizosphere | LEIRIAVVKVMSPRAHTRKAREEAKVVRSIYFPVPISVLITGS |
| Ga0207698_115174771 | 3300026142 | Corn Rhizosphere | SIAVVKVMSPRAHTRKAREEAKVVRSIYFPVPISVLITGS |
| Ga0209881_11116651 | 3300026273 | Soil | VLKVTSPKTQTRRAREEAKVVRSINFPVPISVLITGS |
| Ga0209265_11817051 | 3300026308 | Soil | RGCWDRRACAASPVKMAAVVTVVSPRTQTRNTREEAKFVQSMNFPAPISALITGS |
| Ga0257162_10032544 | 3300026340 | Soil | RRASAESVVKMIAVVIVNNAKTLARRTREEAKVVRSMNFPVPISVLITGS |
| Ga0257171_10197661 | 3300026377 | Soil | IVNNAKTLARRTREEAKVVRSMNFPVPISVLITGS |
| Ga0257147_10248851 | 3300026475 | Soil | AESVVKMIAVVIVNNAKTLARRTREEAKVVRSMNFPVPISVLITGS |
| Ga0257161_10657682 | 3300026508 | Soil | SAESVVKMIAVVIVNNAKTLARRTREEAKVVRSMNFPVPISVLITGS |
| Ga0209807_11261431 | 3300026530 | Soil | VVKMIAVVIVNSAKTLTRRTCEEAKIVRSMNFPVPISVLITGS |
| Ga0209805_12225782 | 3300026542 | Soil | KMTAVVIVTSPKMQTRKTREEALVVRNINFPVPISVLITGS |
| Ga0209577_102495621 | 3300026552 | Soil | SLVEMTAVVIVTSPKTQTRKPREEVDIVRSINFPVPISLLITGS |
| Ga0209623_10055731 | 3300026880 | Forest Soil | AMSVVKVTAVVAATNPKKQTRKMCEEAKVVRSMNFPVPISLLITGS |
| Ga0208983_10099683 | 3300027381 | Forest Soil | VVKMIAVVTVASPSTHTRKTREETKVVRSMNFPVPISVLITGS |
| Ga0208993_10342482 | 3300027480 | Forest Soil | SLVKMTAVVTVTSPKTQTRKTREYAKVVRSINFPVPISVLITGS |
| Ga0208998_10249741 | 3300027524 | Forest Soil | VVTVTNPKAQTRIREEAKVVRSMNFPVPISVLITGS |
| Ga0209216_10929251 | 3300027530 | Forest Soil | LWRRASAASVVKMIAVLIVASPRTQTRNTREEAKVVRSMNFPVPISVLITGP |
| Ga0209734_10381601 | 3300027535 | Forest Soil | LVIRIAVVKVASPRTQTRNVREKAKVVRSIYFPVPISILITGS |
| Ga0209734_10399542 | 3300027535 | Forest Soil | ASAASVVKMIAVVTVASPSTHTRKTREETKVVRSMNFPVPISVLITGP |
| Ga0209220_10275031 | 3300027587 | Forest Soil | IVTSPKTHTRKLREEAKVVRSINFPVPISVLITGS |
| Ga0208044_10566801 | 3300027625 | Peatlands Soil | AVVTATNPKKQARKTREEAKVVRSMNFPVPISALVTGS |
| Ga0208990_11132011 | 3300027663 | Forest Soil | RASALSLVITIADVKVANPRTQTRNAREEAKVVRSIYFPVPISILITGS |
| Ga0209118_11403471 | 3300027674 | Forest Soil | KVTAVVAATNPKKQTRKTCEEAKVVRSMNFPVPISVLITGS |
| Ga0209461_100522621 | 3300027750 | Agave | ALSLEIRIVVVKVISPRAHTRKAREEAKVVRSIYFPVPISVLITGS |
| Ga0209068_102354311 | 3300027894 | Watersheds | AWALSLVKRTAVETVTSPKTQTRKTREEPKVVRSMNFPVPISVLITGS |
| Ga0209624_109585381 | 3300027895 | Forest Soil | VKMTAVVTVTSPKTQTRTRCEQAKVLRSMNFPVPISVLITGS |
| Ga0209006_102054401 | 3300027908 | Forest Soil | VTVTSPKTQTRTRREQAKVLRSMNFPVPISVLITGS |
| Ga0209526_101105623 | 3300028047 | Forest Soil | SVVKMIAVVTVASPSTHTRKTREETKVVRSMNFPVPISVLITGS |
| Ga0247682_10777482 | 3300028146 | Soil | VKASAVVTVTNPKAQTRIREEAKVVRSMNFPVPISVLITGS |
| Ga0137415_108218461 | 3300028536 | Vadose Zone Soil | VIVNSPKMPARRTREDAMVVRSIDFPVPISVLITGP |
| Ga0302225_101542251 | 3300028780 | Palsa | SLVNATAVVTVTNPNTHTRKREEAKVVRSMNFPVPISVLITGS |
| Ga0302201_101036793 | 3300028785 | Bog | RASALLLVKVTAVVIVTRPKTQTRRTREEAKVVRSMNFPVPISVLITGS |
| Ga0307286_100240604 | 3300028876 | Soil | TVVNVMSPRAHTRNAREEAKVVRSIYFPVPISVLITGS |
| Ga0311329_103037421 | 3300029907 | Bog | LLVKVTAVVIVTRPKTQTRRTREEAKVVRSMNFPVPISVLITGS |
| Ga0311326_100849133 | 3300029917 | Bog | VKVTAVVIVTRPKTQTRKTREEAKVVRSMNFPVPISVLITGS |
| Ga0302274_103373382 | 3300030041 | Bog | LVKVTAVVIVTRPKTQTRRTREEAKVVRSMNFPVPISVLITGS |
| Ga0310038_103806981 | 3300030707 | Peatlands Soil | AAVVTATNPKKQARKTREEAKVVRSMNFPVPISALVTGS |
| Ga0307500_100657791 | 3300031198 | Soil | LLIRIAVVMVTSPSAQTRNAREEAKVVRSIYFPVPISILITGS |
| Ga0307513_104607413 | 3300031456 | Ectomycorrhiza | LISIAVVKVMSPRAHTRKAREEAKVVRSIYFPVPISVLITGS |
| Ga0170818_1082658701 | 3300031474 | Forest Soil | VKITAVVMVTSPKTQTRSGREQAQVVRSIDFPVPISVLITGS |
| Ga0310686_1104647572 | 3300031708 | Soil | VTVTNPKTHTRKREEAKVVRSMNFPVPISVLITGS |
| Ga0310892_104289241 | 3300031858 | Soil | LEIRIAVVKVMSPRAHTRNTREEAKVVRSIYFPVPISVLITGS |
| Ga0307409_1003204261 | 3300031995 | Rhizosphere | SALSLEIRIAVVKVMSPRAHTRNAREEAKVVRSIYFPVPISVLITGA |
| Ga0307470_109873952 | 3300032174 | Hardwood Forest Soil | LTVISPRANARNAREEAKVVRSINFPVPFSVLITGS |
| ⦗Top⦘ |