


| Basic Information | |
|---|---|
| Family ID | F082381 |
| Family Type | Metagenome |
| Number of Sequences | 113 |
| Average Sequence Length | 54 residues |
| Representative Sequence | MKKGGKRKGAGRKPALYQTKTIAFRVRVEWVEVIKSTVKAKVAELSQNSS |
| Number of Associated Samples | 88 |
| Number of Associated Scaffolds | 112 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 24.78 % |
| % of genes near scaffold ends (potentially truncated) | 7.96 % |
| % of genes from short scaffolds (< 2000 bps) | 70.80 % |
| Associated GOLD sequencing projects | 79 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (36.283 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge (19.469 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.628 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (64.602 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 28.21% β-sheet: 0.00% Coil/Unstructured: 71.79% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 112 Family Scaffolds |
|---|---|---|
| PF01555 | N6_N4_Mtase | 2.68 |
| PF03837 | RecT | 2.68 |
| PF11325 | DUF3127 | 1.79 |
| PF03237 | Terminase_6N | 1.79 |
| PF09588 | YqaJ | 1.79 |
| PF14090 | HTH_39 | 0.89 |
| PF12843 | QSregVF_b | 0.89 |
| PF13392 | HNH_3 | 0.89 |
| PF11672 | DUF3268 | 0.89 |
| PF14265 | DUF4355 | 0.89 |
| PF03168 | LEA_2 | 0.89 |
| PF00145 | DNA_methylase | 0.89 |
| PF08800 | VirE_N | 0.89 |
| PF13585 | CHU_C | 0.89 |
| PF06067 | DUF932 | 0.89 |
| PF00436 | SSB | 0.89 |
| PF05014 | Nuc_deoxyrib_tr | 0.89 |
| PF13692 | Glyco_trans_1_4 | 0.89 |
| PF05766 | NinG | 0.89 |
| PF04404 | ERF | 0.89 |
| PF07463 | NUMOD4 | 0.89 |
| PF12957 | DUF3846 | 0.89 |
| PF12161 | HsdM_N | 0.89 |
| PF13231 | PMT_2 | 0.89 |
| PF04466 | Terminase_3 | 0.89 |
| COG ID | Name | Functional Category | % Frequency in 112 Family Scaffolds |
|---|---|---|---|
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 2.68 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 2.68 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 2.68 |
| COG3723 | Recombinational DNA repair protein RecT | Replication, recombination and repair [L] | 2.68 |
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 0.89 |
| COG0629 | Single-stranded DNA-binding protein | Replication, recombination and repair [L] | 0.89 |
| COG1783 | Phage terminase large subunit | Mobilome: prophages, transposons [X] | 0.89 |
| COG2965 | Primosomal replication protein N | Replication, recombination and repair [L] | 0.89 |
| COG3613 | Nucleoside 2-deoxyribosyltransferase | Nucleotide transport and metabolism [F] | 0.89 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 63.72 % |
| Unclassified | root | N/A | 36.28 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2020627001|VrWwAS_contig45636 | Not Available | 510 | Open in IMG/M |
| 2027040003|ASn_FUOFX6F01C2L4K | Not Available | 511 | Open in IMG/M |
| 2222084011|2225757878 | All Organisms → cellular organisms → Bacteria | 40111 | Open in IMG/M |
| 3300002202|metazooDRAFT_1250756 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 605 | Open in IMG/M |
| 3300002203|metazooDRAFT_1285416 | Not Available | 551 | Open in IMG/M |
| 3300003860|Ga0031658_1055083 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 689 | Open in IMG/M |
| 3300005525|Ga0068877_10103159 | All Organisms → Viruses → Predicted Viral | 1788 | Open in IMG/M |
| 3300005525|Ga0068877_10510355 | Not Available | 663 | Open in IMG/M |
| 3300005656|Ga0073902_10225166 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 843 | Open in IMG/M |
| 3300005664|Ga0073685_1089606 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 823 | Open in IMG/M |
| 3300005683|Ga0074432_102787 | All Organisms → Viruses → Predicted Viral | 1539 | Open in IMG/M |
| 3300006802|Ga0070749_10175228 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1237 | Open in IMG/M |
| 3300006802|Ga0070749_10437606 | Not Available | 718 | Open in IMG/M |
| 3300006802|Ga0070749_10776017 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 509 | Open in IMG/M |
| 3300006805|Ga0075464_10395047 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 840 | Open in IMG/M |
| 3300006875|Ga0075473_10022745 | Not Available | 2409 | Open in IMG/M |
| 3300006920|Ga0070748_1107679 | Not Available | 1058 | Open in IMG/M |
| 3300007074|Ga0075110_1002912 | All Organisms → cellular organisms → Bacteria | 6507 | Open in IMG/M |
| 3300007516|Ga0105050_10014411 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 7947 | Open in IMG/M |
| 3300007516|Ga0105050_10018671 | Not Available | 6477 | Open in IMG/M |
| 3300007541|Ga0099848_1023983 | All Organisms → Viruses → Predicted Viral | 2582 | Open in IMG/M |
| 3300007960|Ga0099850_1120654 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Spirosomaceae → Fibrella → Fibrella forsythiae | 1070 | Open in IMG/M |
| 3300008266|Ga0114363_1015693 | All Organisms → Viruses → Predicted Viral | 3436 | Open in IMG/M |
| 3300008266|Ga0114363_1154928 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 756 | Open in IMG/M |
| 3300009084|Ga0105046_10599533 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium | 1017 | Open in IMG/M |
| 3300009095|Ga0079224_101824543 | Not Available | 863 | Open in IMG/M |
| 3300009169|Ga0105097_10108296 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1521 | Open in IMG/M |
| 3300009648|Ga0116175_1079033 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1177 | Open in IMG/M |
| 3300009648|Ga0116175_1079033 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1177 | Open in IMG/M |
| 3300009654|Ga0116167_1131215 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 887 | Open in IMG/M |
| 3300009655|Ga0116190_1190479 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 704 | Open in IMG/M |
| 3300009693|Ga0116141_10125918 | Not Available | 1493 | Open in IMG/M |
| 3300009693|Ga0116141_10295335 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 858 | Open in IMG/M |
| 3300009710|Ga0116192_1075527 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA395 | 1196 | Open in IMG/M |
| 3300009713|Ga0116163_1021895 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → unclassified Bacteroides → Bacteroides sp. 224 | 2909 | Open in IMG/M |
| 3300009768|Ga0116193_1144015 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1050 | Open in IMG/M |
| 3300009772|Ga0116162_10070087 | Not Available | 1649 | Open in IMG/M |
| 3300009870|Ga0131092_10002858 | All Organisms → cellular organisms → Bacteria | 61761 | Open in IMG/M |
| 3300009870|Ga0131092_10098446 | Not Available | 3466 | Open in IMG/M |
| 3300010338|Ga0116245_10038238 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 3420 | Open in IMG/M |
| 3300010340|Ga0116250_10056905 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2789 | Open in IMG/M |
| 3300010342|Ga0116252_10285729 | Not Available | 983 | Open in IMG/M |
| 3300010353|Ga0116236_10539521 | Not Available | 969 | Open in IMG/M |
| 3300010354|Ga0129333_10696142 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 874 | Open in IMG/M |
| 3300010354|Ga0129333_10786187 | Not Available | 812 | Open in IMG/M |
| 3300010354|Ga0129333_10924561 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 737 | Open in IMG/M |
| 3300010354|Ga0129333_11058280 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 679 | Open in IMG/M |
| 3300010356|Ga0116237_11082594 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 670 | Open in IMG/M |
| 3300010941|Ga0138503_101688 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1404 | Open in IMG/M |
| 3300010942|Ga0139176_132054 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 531 | Open in IMG/M |
| 3300010945|Ga0139174_131709 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 605 | Open in IMG/M |
| 3300012956|Ga0154020_10853338 | Not Available | 715 | Open in IMG/M |
| 3300012990|Ga0159060_1002324 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae | 5138 | Open in IMG/M |
| (restricted) 3300013122|Ga0172374_1182332 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 766 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10025900 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 5303 | Open in IMG/M |
| (restricted) 3300013127|Ga0172365_10009664 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 7099 | Open in IMG/M |
| (restricted) 3300013127|Ga0172365_10012388 | Not Available | 6213 | Open in IMG/M |
| (restricted) 3300013127|Ga0172365_10652184 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 599 | Open in IMG/M |
| (restricted) 3300013128|Ga0172366_10115685 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1778 | Open in IMG/M |
| (restricted) 3300013128|Ga0172366_10143046 | Not Available | 1566 | Open in IMG/M |
| (restricted) 3300013128|Ga0172366_10653059 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 620 | Open in IMG/M |
| (restricted) 3300013129|Ga0172364_10350972 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 955 | Open in IMG/M |
| (restricted) 3300013129|Ga0172364_10523326 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 749 | Open in IMG/M |
| (restricted) 3300013129|Ga0172364_10917429 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 537 | Open in IMG/M |
| (restricted) 3300013130|Ga0172363_10414910 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 872 | Open in IMG/M |
| (restricted) 3300013130|Ga0172363_10439761 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 841 | Open in IMG/M |
| (restricted) 3300013130|Ga0172363_10789253 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 591 | Open in IMG/M |
| (restricted) 3300013130|Ga0172363_10863683 | Not Available | 561 | Open in IMG/M |
| (restricted) 3300013132|Ga0172372_10407888 | Not Available | 926 | Open in IMG/M |
| (restricted) 3300013133|Ga0172362_10327592 | Not Available | 1079 | Open in IMG/M |
| 3300013793|Ga0119894_1008689 | Not Available | 1042 | Open in IMG/M |
| 3300013800|Ga0119898_1003512 | Not Available | 2616 | Open in IMG/M |
| 3300013800|Ga0119898_1041728 | Not Available | 587 | Open in IMG/M |
| 3300017788|Ga0169931_10034950 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5823 | Open in IMG/M |
| 3300017991|Ga0180434_10007555 | Not Available | 12215 | Open in IMG/M |
| 3300022198|Ga0196905_1075915 | Not Available | 921 | Open in IMG/M |
| 3300022752|Ga0214917_10053509 | Not Available | 2702 | Open in IMG/M |
| 3300022822|Ga0222646_105918 | Not Available | 1974 | Open in IMG/M |
| 3300022837|Ga0222711_1011000 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Tenacibaculum → unclassified Tenacibaculum → Tenacibaculum sp. MAR_2009_124 | 1411 | Open in IMG/M |
| (restricted) 3300023208|Ga0233424_10003908 | Not Available | 9354 | Open in IMG/M |
| 3300023237|Ga0222650_1042774 | Not Available | 792 | Open in IMG/M |
| (restricted) 3300024054|Ga0233425_10251922 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 817 | Open in IMG/M |
| 3300024490|Ga0255185_1013150 | Not Available | 1186 | Open in IMG/M |
| 3300025587|Ga0208938_1134262 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 540 | Open in IMG/M |
| 3300025611|Ga0209408_1013206 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → unclassified Bacteroides → Bacteroides sp. 224 | 3062 | Open in IMG/M |
| 3300025613|Ga0208461_1052992 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1307 | Open in IMG/M |
| 3300025618|Ga0208693_1012091 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium | 4141 | Open in IMG/M |
| 3300025635|Ga0208147_1011921 | Not Available | 2397 | Open in IMG/M |
| 3300025657|Ga0208823_1167636 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 593 | Open in IMG/M |
| 3300025678|Ga0208695_1021449 | All Organisms → Viruses → Predicted Viral | 2895 | Open in IMG/M |
| 3300025702|Ga0209203_1195321 | Not Available | 608 | Open in IMG/M |
| 3300025889|Ga0208644_1121761 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1244 | Open in IMG/M |
| 3300027721|Ga0209492_1012908 | All Organisms → Viruses → Predicted Viral | 2812 | Open in IMG/M |
| 3300027724|Ga0209582_1017474 | Not Available | 2688 | Open in IMG/M |
| 3300027793|Ga0209972_10001551 | Not Available | 19931 | Open in IMG/M |
| 3300027832|Ga0209491_10009141 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 12260 | Open in IMG/M |
| 3300027899|Ga0209668_10371748 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 931 | Open in IMG/M |
| 3300027976|Ga0209702_10134370 | All Organisms → cellular organisms → Bacteria | 1111 | Open in IMG/M |
| (restricted) 3300028677|Ga0255346_1294770 | Not Available | 586 | Open in IMG/M |
| 3300031539|Ga0307380_11358672 | Not Available | 539 | Open in IMG/M |
| 3300031787|Ga0315900_10024655 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 6854 | Open in IMG/M |
| 3300031787|Ga0315900_10673885 | Not Available | 738 | Open in IMG/M |
| 3300031857|Ga0315909_10140778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 2005 | Open in IMG/M |
| 3300031857|Ga0315909_10479638 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 865 | Open in IMG/M |
| 3300031857|Ga0315909_10837745 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 576 | Open in IMG/M |
| 3300034012|Ga0334986_0282917 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 887 | Open in IMG/M |
| 3300034063|Ga0335000_0000931 | Not Available | 25176 | Open in IMG/M |
| 3300034071|Ga0335028_0563893 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 619 | Open in IMG/M |
| 3300034102|Ga0335029_0116794 | Not Available | 1864 | Open in IMG/M |
| 3300034102|Ga0335029_0292698 | All Organisms → Viruses → Predicted Viral | 1031 | Open in IMG/M |
| 3300034103|Ga0335030_0337378 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 997 | Open in IMG/M |
| 3300034121|Ga0335058_0023617 | Not Available | 3655 | Open in IMG/M |
| 3300034122|Ga0335060_0107430 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1673 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 19.47% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 13.27% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 12.39% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 9.73% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 4.42% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 4.42% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 3.54% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 2.65% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 2.65% |
| Wastewater | Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Wastewater | 2.65% |
| Wastewater | Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Wastewater | 2.65% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.77% |
| Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 1.77% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.77% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.77% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 1.77% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 1.77% |
| Wastewater | Engineered → Wastewater → Nutrient Removal → Dissolved Organics (Aerobic) → Activated Sludge → Wastewater | 1.77% |
| Coastal Lagoon | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Coastal Lagoon | 0.89% |
| Aquatic | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Aquatic | 0.89% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.89% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 0.89% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 0.89% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Agricultural Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.89% |
| Active Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Active Sludge | 0.89% |
| Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 0.89% |
| Lab-Scale Ebpr Bioreactor | Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Lab-Scale Ebpr Bioreactor | 0.89% |
| Wastewater | Engineered → Built Environment → Water Treatment Plant → Unclassified → Unclassified → Wastewater | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2020627001 | Viral communities in wastewater treatment process (AS) | Engineered | Open in IMG/M |
| 2027040003 | Viral communities in wastewater treatment process (AS-no assmebly) | Engineered | Open in IMG/M |
| 2222084011 | Coastal lagoon microbial communities from Albufera, Spain - Sample 1 | Environmental | Open in IMG/M |
| 3300002202 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - SEP 2012 | Environmental | Open in IMG/M |
| 3300002203 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - MAR 2013 | Environmental | Open in IMG/M |
| 3300003860 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL | Environmental | Open in IMG/M |
| 3300005525 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG | Environmental | Open in IMG/M |
| 3300005656 | Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB19-Kit | Engineered | Open in IMG/M |
| 3300005664 | Freshwater viral communities from Emiquon reservoir, Havana, Illinois, USA | Environmental | Open in IMG/M |
| 3300005683 | Enhanced biological phosphorus removal bioreactor viral communities from the University of Queensland, Australia - SBR4-V91802 Phage Sequencing | Engineered | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300007074 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK8 | Environmental | Open in IMG/M |
| 3300007516 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300009084 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-03 (megahit assembly) | Environmental | Open in IMG/M |
| 3300009095 | Agricultural soil microbial communities from Utah to study Nitrogen management - Steer compost 2015 | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009648 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC125_MetaG | Engineered | Open in IMG/M |
| 3300009654 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNMR3_MetaG | Engineered | Open in IMG/M |
| 3300009655 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR4_MetaG | Engineered | Open in IMG/M |
| 3300009693 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC097_MetaG | Engineered | Open in IMG/M |
| 3300009710 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC113_MetaG | Engineered | Open in IMG/M |
| 3300009713 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC107_MetaG | Engineered | Open in IMG/M |
| 3300009768 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC115_MetaG | Engineered | Open in IMG/M |
| 3300009772 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC105_MetaG | Engineered | Open in IMG/M |
| 3300009870 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plant | Engineered | Open in IMG/M |
| 3300010338 | AD_JPMRca | Engineered | Open in IMG/M |
| 3300010340 | AD_USOAca | Engineered | Open in IMG/M |
| 3300010342 | AD_JPNAca1 | Engineered | Open in IMG/M |
| 3300010353 | AD_USCAca | Engineered | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010356 | AD_USDEca | Engineered | Open in IMG/M |
| 3300010941 | Wastewater viral communities and vesicles from water purifying plant in Alicante,Spain - replicate Ab3 | Engineered | Open in IMG/M |
| 3300010942 | Wastewater viral communities and vesicles from water purifying plant in Alicante,Spain - replicate C3 | Engineered | Open in IMG/M |
| 3300010945 | Wastewater viral communities and vesicles from water purifying plant in Alicante,Spain - replicate C2 | Engineered | Open in IMG/M |
| 3300012956 | Active sludge microbial communities from wastewater, Klosterneuburg, Austria - Klosneuvirus_20160825_MG | Engineered | Open in IMG/M |
| 3300012990 | Tailings pond microbial communities from Northern Alberta -TP6_2010 BML May 2015 | Engineered | Open in IMG/M |
| 3300013122 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10.3m | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300013127 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 48cm | Environmental | Open in IMG/M |
| 3300013128 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 69cm | Environmental | Open in IMG/M |
| 3300013129 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 10cm | Environmental | Open in IMG/M |
| 3300013130 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment s2_kivu2a2 | Environmental | Open in IMG/M |
| 3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
| 3300013133 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment s1_kivu2a2 | Environmental | Open in IMG/M |
| 3300013793 | Wastewater microbial communities from municipal sewage treatment plant in Nanjing, China - WX_AS_meta | Engineered | Open in IMG/M |
| 3300013800 | Wastewater microbial communities from municipal sewage treatment plant in Nanjing, China - ZZ_EW_meta | Engineered | Open in IMG/M |
| 3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
| 3300017991 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_2 metaG | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300022822 | Saline water microbial communities from Ace Lake, Antarctica - #293 | Environmental | Open in IMG/M |
| 3300022837 | Saline water microbial communities from Ace Lake, Antarctica - #1699 | Environmental | Open in IMG/M |
| 3300023208 (restricted) | Freshwater microbial communities from Lake Towuti, South Sulawesi, Indonesia - Watercolumn_Towuti2014_125_MG | Environmental | Open in IMG/M |
| 3300023237 | Saline water microbial communities from Ace Lake, Antarctica - #367 | Environmental | Open in IMG/M |
| 3300024054 (restricted) | Freshwater microbial communities from Lake Towuti, South Sulawesi, Indonesia - Watercolumn_Towuti2014_140_MG | Environmental | Open in IMG/M |
| 3300024490 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepB_0h | Environmental | Open in IMG/M |
| 3300025587 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC125_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025611 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC107_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025613 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR4_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025618 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC071_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025635 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025657 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC075_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025678 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC111_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025702 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC109_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027724 | Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB5-Kit (SPAdes) | Engineered | Open in IMG/M |
| 3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027832 | Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
| 3300027976 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 (SPAdes) | Environmental | Open in IMG/M |
| 3300028677 (restricted) | Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant22 | Engineered | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034063 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053 | Environmental | Open in IMG/M |
| 3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034103 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119 | Environmental | Open in IMG/M |
| 3300034121 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174 | Environmental | Open in IMG/M |
| 3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AS_214010 | 2020627001 | Wastewater | MGKENIKLKRGGKRPFSGRKKADYQTKTIAFRVRVQWVEAIKSMVKDKIADLSQNSS |
| AS_na_2435650 | 2027040003 | Wastewater | MGKENIKLKRGGKRPFSGRKKADYQTKTIAFRVRVQWVEAIKSMVKDKIADLSQKCS |
| 2225167884 | 2222084011 | Coastal Lagoon | MTNAKKETRGGKRPLSGRKKAPYQTKTISFRVREEYVDEIKATVKAKLAELSQNKTPTFAGRG |
| metazooDRAFT_12507561 | 3300002202 | Lake | MEWGLNNYEKIIKQGGKRKGAGRKPAPYQTKTIAFRVRLEWVEVIKSMVKSKVAELSQNSS* |
| metazooDRAFT_12854163 | 3300002203 | Lake | MRKTNLDKITKGGKRIGSGRKKANYQTKTIAFRVRLEWVEVIKSTVKAKVAELSQNSS* |
| Ga0031658_10550832 | 3300003860 | Freshwater Lake Sediment | MASKIKNGKKETRGGKRPLSGRKKAPYQTKTIAFRVRVEWIEEIKQLVKNKIQQLTP* |
| Ga0068877_101031592 | 3300005525 | Freshwater Lake | MQAKQGGKRKGAGRKPALYQTKTIAFRVRVEWIKEIKQLVKNKIQQLTP* |
| Ga0068877_105103552 | 3300005525 | Freshwater Lake | MEHKKTKRILKETRGGKRPLSGRKKADYKTKTIAFRVRVEWVEVIKSAVKAKVAELSQNSS* |
| Ga0073902_102251662 | 3300005656 | Activated Sludge | MKKTKGGKRIGSGRKKANYQTKTIAFRVRVEWVQEIKSTVKAKVAELAQNSS* |
| Ga0073685_10896061 | 3300005664 | Aquatic | MEELEVRKGGKRKGAGRKPAPYKTKTIAFRVRVEWIEVIKSTVKAKVAELSQNSS* |
| Ga0074432_1027873 | 3300005683 | Lab-Scale Ebpr Bioreactor | MKKKKENRGGKRDASGRKKADYKTKTIAFRVRVEWVETIKSMVKAKVAELSQNSS* |
| Ga0070749_101752282 | 3300006802 | Aqueous | MTNAKKETRGGKRPLSGRKKAPYQTKTISFRVREEYVDEIKATVKAKLAELSQNKTPTFAGRG* |
| Ga0070749_104376061 | 3300006802 | Aqueous | MKSKTQKEMRGGKRPLSGRKKADYQTKTIAFRVRVEWIAVVKSTVKDKVAELSQNSS* |
| Ga0070749_107760171 | 3300006802 | Aqueous | MVKKVGGKRKGAGRKPAPYQTKTIAFRVRVEWVEVIKSTVKAKIAECSK* |
| Ga0075464_103950473 | 3300006805 | Aqueous | MKQNNKGGKRKGAGRKPAPYQTKTIAFRIRVEWVEVIKSTVKAKVSELSQNSS* |
| Ga0075473_100227454 | 3300006875 | Aqueous | MRKGGKRKGAGRKPAPYQTKTIAFRVRSEWVDIIKLTVKDKVKQLNAHPV* |
| Ga0070748_11076792 | 3300006920 | Aqueous | MEVKKGGKRVGSGRKKADYQTKTIAFRVRVEWVDVIKSTVKAKVAELSQNSR* |
| Ga0075110_100291212 | 3300007074 | Saline Lake | MKKGGKRKGSGRKPALYETKTIAFRVRLEWVEVIKSMVKTKVSELSQNSS* |
| Ga0105050_100144112 | 3300007516 | Freshwater | MKIKNKGGKRENSGRKKANYQTKTIAFRIRLEWIEVIKAMVKAKVSELSQNSS* |
| Ga0105050_100186718 | 3300007516 | Freshwater | MQIKNKKGGKRIGAGRKKADYQTKTISFRVRKEYVDHIKNLVKDAVAQLSINDY* |
| Ga0099848_10239832 | 3300007541 | Aqueous | MRKGGKRKGAGRKPASYQTTTISFRVRVEWVDEIKQMVKDKVAEKKQIK* |
| Ga0099850_11206541 | 3300007960 | Aqueous | MQKILKQGGKRKGAGRKPAPYQTKTIAFRIRVEWVEVIKSTVKAKVAELSQNSS* |
| Ga0114363_10156933 | 3300008266 | Freshwater, Plankton | MGKLKGGKRKGAGRKPAPYQTKTIAFRVRSEWVDIIKLTVKDKVKQLNAHPI* |
| Ga0114363_11549283 | 3300008266 | Freshwater, Plankton | MNKKKETRGGKRPFSGRKKAPYQTKTIAFRVRIEWVEEIKLMVKNKIKELSK* |
| Ga0105046_105995334 | 3300009084 | Freshwater | MKKLIKNKGGSRVGSGRKKATYETKTIAFRVRLEWVEVIKSMVKDKMSELSQNSS |
| Ga0079224_1018245433 | 3300009095 | Agricultural Soil | MKHTKKGGKRIGSGRKKADYQTKTIAFRVRVEWIEFIKSTVKAKVAELSQNSS* |
| Ga0105097_101082963 | 3300009169 | Freshwater Sediment | MGVKKLKGGKRKGAGRKPAPYQTKTIAFRVRVEWVEVIKSTVKAKVAELSQNSS* |
| Ga0116175_10790332 | 3300009648 | Anaerobic Digestor Sludge | MKKKKETRGGKRPLSGRKKADYETKTIAFRVRVEWVEIIKSTVKAKVAELSKNSS* |
| Ga0116175_10790334 | 3300009648 | Anaerobic Digestor Sludge | MEELEVRKGGKRKGAGRKPAPYKTKTIAFRVRVEWIEVIKSTVKAKVAELSKNSS* |
| Ga0116167_11312151 | 3300009654 | Anaerobic Digestor Sludge | GGKRKGAGRKPAPYLTKTIAFRVRLEWVEVIKSTVKAKVAELSQNSS* |
| Ga0116190_11904792 | 3300009655 | Anaerobic Digestor Sludge | MKSQNNKGGKRIGSGRKPAPYQTKTIAFRVRVEWVETIKSMVKSKVAELSQNSS* |
| Ga0116141_101259185 | 3300009693 | Anaerobic Digestor Sludge | MKQKNKGGKRVGSGRKKADYETKTIAFRVRVEWVEEIKSTVKAKIAELSQNSS* |
| Ga0116141_102953353 | 3300009693 | Anaerobic Digestor Sludge | MKQNTKGGKRKGAGRKPAPYQTKTIAFRVRVEWIEVIKSTVKAKVAELSQNSSQQQINEIAPLP* |
| Ga0116192_10755274 | 3300009710 | Anaerobic Digestor Sludge | MVVLEGKKGGKRKGAGRKPAPYQTKTIAFRIRVEWAEVIKSTVKAKVAELSQNSS* |
| Ga0116163_10218955 | 3300009713 | Anaerobic Digestor Sludge | MQNKSLKKQKSKGGKRVGSGRKKANYQTKTIAFRVRVEWIDVIKSTVKAKVAELSQNSR* |
| Ga0116193_11440153 | 3300009768 | Anaerobic Digestor Sludge | MKNTRGGKRPLSGRKKADYQTKTIAFRVRVEWLDVIKSTVKDKIAELSQNSS* |
| Ga0116162_100700874 | 3300009772 | Anaerobic Digestor Sludge | LKKQKSKGGKRVGSGRKKANYQTKTIAFRVRVEWIDVIKSTVKAKVAELSQNSR* |
| Ga0131092_1000285855 | 3300009870 | Activated Sludge | MKLQRKNKGGKRKGAGRKPAPYQTKTFAFRVRVEWLETVKATVKAKIAELSQNSS* |
| Ga0131092_100984461 | 3300009870 | Activated Sludge | VGGKRKGAGRKPALYKTKTIAFRVRVELAEVIKSIVKAKVSELSQNIA* |
| Ga0116245_100382381 | 3300010338 | Anaerobic Digestor Sludge | MKQNIRGGKRVGSGRKKADYQTKTIAFRVRVEWVEAIKSTVKAKVAELSQNSS* |
| Ga0116250_100569058 | 3300010340 | Anaerobic Digestor Sludge | MEVKKGGKRKGAGRKKANYQTKTIAFRVRVEWVEVIKSTVKAKVAELSQNSS* |
| Ga0116252_102857292 | 3300010342 | Anaerobic Digestor Sludge | MKPKKKKETRGGKRPLSGRKKADYETKTIAFRVRVEWIEAIKSTVKAKVAELSQNSS* |
| Ga0116236_105395215 | 3300010353 | Anaerobic Digestor Sludge | MKQNTKGGKRKGAGRKPAPYQTKTIAFRVRVEWIEVIKSTVKAKVAELSQNSS* |
| Ga0129333_106961422 | 3300010354 | Freshwater To Marine Saline Gradient | MAKKVGGKRKGAGRKLAPYQTKTIAFRVRVEWVEVIKTTVKTKVAELSK* |
| Ga0129333_107861872 | 3300010354 | Freshwater To Marine Saline Gradient | MKKGGKRKDSGRKPVSYQTKTIAFRVRLEWVEAIKSTVKGKIIELQMFN* |
| Ga0129333_109245612 | 3300010354 | Freshwater To Marine Saline Gradient | MKKYMYSDKKKERGGKRPFSGRKPAPYQTKTISFRVRIEWVDDIKAIIKKRIAELKSLD* |
| Ga0129333_110582801 | 3300010354 | Freshwater To Marine Saline Gradient | MKQGGKRKGAGRKAAPYQTKTIAFRVRVEWVEVIKSTVKAKIAECSK* |
| Ga0116237_110825943 | 3300010356 | Anaerobic Digestor Sludge | MKNKKETKGGKRKGAGRKPAPYHTKTISFRVREKWVEEIKVIVKNKLQELLNAENCKNE* |
| Ga0138503_1016883 | 3300010941 | Wastewater | MEKNTQKKKIGRGGTRQGSGRKPAPYQTKTIAFRVRVEWIEVIKSTVKAKVAELSQNSS* |
| Ga0139176_1320542 | 3300010942 | Wastewater | MGGIKLKGGKRKGAGRKPAPYKTKTISFRVRVEWIDVIKSMLKAKVAELSQNSS* |
| Ga0139174_1317092 | 3300010945 | Wastewater | MKHTKKGGKRIGSGRKHAAYQTKTIAFRVRVEWVEDIKLMVKAKVAELSQNSS* |
| Ga0154020_108533382 | 3300012956 | Active Sludge | MKKNKGGKRIGSGRKKADYQTKTIAFRVRVEWVEVIKLTVKDKVAELSQNSS* |
| Ga0159060_100232411 | 3300012990 | Hydrocarbon Resource Environments | MKTEKRGGKRLNAGRKKAPYQTKTISFRVRIELVDEIKRLVKEFLNGKVK* |
| (restricted) Ga0172374_11823321 | 3300013122 | Freshwater | MAVLEAKKGGKRKGAGRKPAPYQTKTIAFRVRAEWVEVIKSTVKAKVAELSQNSS* |
| (restricted) Ga0172367_100259002 | 3300013126 | Freshwater | MKKKISNRGGKRIGSGRKKANYQTKTIAFRVRVEWSEVIKSTVKAKVAELSQNSS* |
| (restricted) Ga0172365_1000966415 | 3300013127 | Sediment | MNKKETRGGKRKGAGRKPAPYQTKIIAFRVHVEWEEVIRLTVKAKVAELSQNSS* |
| (restricted) Ga0172365_1001238810 | 3300013127 | Sediment | MKKGGKRKGAGRKPALYQTKTIAFRVRVEWVEVIKSTVKAKVAELSQNSS* |
| (restricted) Ga0172365_106521842 | 3300013127 | Sediment | KKMKKGGKRKGAGRKPALYQTKTIAFRVRVEWVEAVKKAVQTTVAELSSHQ* |
| (restricted) Ga0172366_101156852 | 3300013128 | Sediment | MKKGGKRKGAGRKPALYQTKTIAFRVRVEWVEAVKKAVQTTVAELSSHQ* |
| (restricted) Ga0172366_101430461 | 3300013128 | Sediment | VKKMKKGGKRKGAGRKPALYQTKTIAFRVRVEWVEVIKSTVKAKVAELSQNSS* |
| (restricted) Ga0172366_106530592 | 3300013128 | Sediment | MKQFKDIDKQGGKRKGAGRKPALYQTKTIAFRVRVEWSEVIKSTVKAKVAELSQNSS* |
| (restricted) Ga0172364_103509721 | 3300013129 | Sediment | MKKGGKRKGAGRKPALYQTKTIAFRVRVEWVELIKSTVKAKVAIY* |
| (restricted) Ga0172364_105233262 | 3300013129 | Sediment | MKQLKDIVKQGGKRKGAGRKPAPYQTKTIAFRVRVEWVEVIKSTVKAKVAELSQNSS* |
| (restricted) Ga0172364_109174291 | 3300013129 | Sediment | MKNKKDARGGKRKGAGRKPAPYQTKTIAFRVRVEWVELIKSTVKAKVAELSQNSS* |
| (restricted) Ga0172363_104149102 | 3300013130 | Sediment | MTGHSKKKTKQGGTRQGAGRKPAPYQTKTIAFRVRVEWVELIKSTVKAKVAIY* |
| (restricted) Ga0172363_104397612 | 3300013130 | Sediment | MKNKKDARGGKRKGAGRKPAPYQTKTIAFRVRTEWVEAVKKAVQTTVAELSSHQ* |
| (restricted) Ga0172363_107892532 | 3300013130 | Sediment | SKKKTKQGGTRQGAGRKPAPYQTITIAFRVRVEWVEEIKAMVKAKVAELSQNSS* |
| (restricted) Ga0172363_108636832 | 3300013130 | Sediment | MEVKKGGKRIGSGRKKANYQTKTIAFRVRVEWVELIKSTVKAKVAELSQNSR* |
| (restricted) Ga0172372_104078882 | 3300013132 | Freshwater | MEVKKGGKRIGSGRKKANYQTKTIAFRVRVEWVELIKSTVKAKVAELSQNSS* |
| (restricted) Ga0172362_103275921 | 3300013133 | Sediment | MTGHSKKKTKQGGTRQGAGRKPAPYQTITIAFRVRVEWVEEIKAMVKAKVAELSQNSS* |
| Ga0119894_10086892 | 3300013793 | Wastewater | LDKIKKGGKRIGSGRKKAEYQTKTIAFRVRIEWVEVIKSMVKDKVSELSQNSS* |
| Ga0119898_10035126 | 3300013800 | Wastewater | MKKTKGGKRIGSGRKKAEYETKTIAFRVRVEWVESIKSTVKAKVAELSQNSS* |
| Ga0119898_10417282 | 3300013800 | Wastewater | MRKTNLDKIKQGGKRVGSGRKKADYQTKTIAFRVRLEWVEVIRSMVKAKVSELSQNSS* |
| Ga0169931_100349506 | 3300017788 | Freshwater | MAELEAKKGGKRKGAGRKPAPYQTKTIAFRVRVEWVEVIKSTVKAKVAELSQNSS |
| Ga0180434_1000755524 | 3300017991 | Hypersaline Lake Sediment | MKDSKRGGKRDGAGRKPAPYQTKTISFRVRIEWEKIIKDIVKKKLLELSEENT |
| Ga0196905_10759153 | 3300022198 | Aqueous | MRKGGKRKGAGRKPASYQTTTISFRVRVEWVDEIKQMVKDKVAEKKQIK |
| Ga0214917_100535095 | 3300022752 | Freshwater | MANKKKHGGKRKGAGRKPAPYKTKTIAFRVRVEWVEVVKSTVKAKVKELSQNSS |
| Ga0222646_1059183 | 3300022822 | Saline Water | MKKGGKRKGSGRKPALYETKTIAFRVRLEWVEVIKSMVKTKVSELSQNSS |
| Ga0222711_10110004 | 3300022837 | Saline Water | MKKLIKNSGGKRIGSGRKKADYETKTVSFRLRVEWLETIKTTVKAKVSELSQNSS |
| (restricted) Ga0233424_1000390816 | 3300023208 | Freshwater | MTTKRGGKRKGAGRKPAPYKTKTIAFRVRVEWAETIKTMVKDKINELLKSNH |
| Ga0222650_10427741 | 3300023237 | Saline Water | MKKGGKRKGSGRKPALYETKTIAFRVRLEWVEVIKSMVKTKVSE |
| (restricted) Ga0233425_102519222 | 3300024054 | Freshwater | MQTKRGGKRKGAGRKPAPYKTKTIAFRVRVEWAETIKAMVKDKINELFKSNH |
| Ga0255185_10131504 | 3300024490 | Freshwater | MKQNTKGGKRVGSGRKKANYQTKTIAFRVRVEWVEVIKSTVKGKIIELQMFN |
| Ga0208938_11342622 | 3300025587 | Anaerobic Digestor Sludge | MEELEVRKGGKRKGAGRKPAPYKTKTIAFRVRVEWIEVIKSTVKAKVAELSKNSS |
| Ga0209408_10132069 | 3300025611 | Anaerobic Digestor Sludge | MQNKSLKKQKSKGGKRVGSGRKKANYQTKTIAFRVRVEWIDVIKSTVKAKVAELSQNSR |
| Ga0208461_10529924 | 3300025613 | Anaerobic Digestor Sludge | MKSQNNKGGKRIGSGRKPAPYQTKTIAFRVRVEWVETIKSMVKSKVAELSQNSS |
| Ga0208693_10120916 | 3300025618 | Anaerobic Digestor Sludge | MEVKKGGKRVGSGRKKADYQTKTIAFRVRVEWVDVIKSTVKAKVAELSQNSR |
| Ga0208147_10119215 | 3300025635 | Aqueous | MRKGGKRKGAGRKPAPYQTKTIAFRVRSEWVDIIKLTVKDKVKQLNAHPV |
| Ga0208823_11676361 | 3300025657 | Anaerobic Digestor Sludge | MEELEVRKGGKRKGAGRKPAPYKTKTIAFRVRVEWVDVIKSTVKAKVAELSQNSR |
| Ga0208695_10214492 | 3300025678 | Anaerobic Digestor Sludge | MVVLEGKKGGKRKGAGRKPAPYQTKTIAFRIRVEWAEVIKSTVKAKVAELSQNSS |
| Ga0209203_11953213 | 3300025702 | Anaerobic Digestor Sludge | LKKQKSKGGKRVGSGRKKANYQTKTIAFRVRVEWIDVIKSTVKAKVAELSQNSR |
| Ga0208644_11217613 | 3300025889 | Aqueous | MVKKVGGKRKGAGRKPAPYQTKTIAFRVRVEWVEVIKSTVKAKIAECSK |
| Ga0209492_10129084 | 3300027721 | Freshwater Sediment | MGVKKLKGGKRKGAGRKPAPYQTKTIAFRVRVEWVEVIKSTVKAKVAELSQNSS |
| Ga0209582_10174744 | 3300027724 | Activated Sludge | MKKTKGGKRIGSGRKKANYQTKTIAFRVRVEWVQEIKSTVKAKVAELAQNSS |
| Ga0209972_1000155134 | 3300027793 | Freshwater Lake | MQAKQGGKRKGAGRKPALYQTKTIAFRVRVEWIKEIKQLVKNKIQQLTP |
| Ga0209491_1000914112 | 3300027832 | Freshwater | MKIKNKGGKRENSGRKKANYQTKTIAFRIRLEWIEVIKAMVKAKVSELSQNSS |
| Ga0209668_103717483 | 3300027899 | Freshwater Lake Sediment | MASKIKNGKKETRGGKRPLSGRKKAPYQTKTIAFRVRVEWIEEIKQLVKNKIQQLTP |
| Ga0209702_101343702 | 3300027976 | Freshwater | MQIKNKKGGKRIGAGRKKADYQTKTISFRVRKEYVDHIKNLVKDAVAQLSINDY |
| (restricted) Ga0255346_12947701 | 3300028677 | Wastewater | MKNKKETRGGKRPLSGRKKADYETKTIAFRVRVEWVEIIKSTVKAKVAELSKNSSV |
| Ga0307380_113586721 | 3300031539 | Soil | MKQGGKRKGAGRKSAPYKTKTIAFRVRVEWVEAIKSTVKAKISELSQNSS |
| Ga0315900_100246557 | 3300031787 | Freshwater | MEHKKTKRILKETRGGKRPLSGRKKADYKTKTIAFRVRVEWVEVIKSAVKAKVAELSQNS |
| Ga0315900_106738853 | 3300031787 | Freshwater | MPKNKKETRGGKRPLSGRKKANYQTKTIAFRVRVEWIEVIKSTVKAKVAELSQNSS |
| Ga0315909_101407785 | 3300031857 | Freshwater | MNKKKETRGGKRPFSGRKKAPYQTKTIAFRVRIEWVEEIKLMVKNKIKELSK |
| Ga0315909_104796381 | 3300031857 | Freshwater | MNKGGKRKGAGRKPAPYQTKTIAFRVRVEWVESIKSTVKTKIAELSQNSS |
| Ga0315909_108377451 | 3300031857 | Freshwater | MGKLKGGKRKGAGRKPAPYQTKTIAFRVRSEWVDIIKLTVKDKVKQLNAHPI |
| Ga0334986_0282917_566_727 | 3300034012 | Freshwater | MAKSKKETRGGKRPFSGRKKAPYQTKTIAFRVRIEWVEEIKLMVKNKIKEFSK |
| Ga0335000_0000931_23869_24027 | 3300034063 | Freshwater | MNNKKETRGGKRPFSGRKKAPYQTKTIAFRVRIEWVEEIKLMVKNKIKEFSK |
| Ga0335028_0563893_170_328 | 3300034071 | Freshwater | MNNKKETRGGKRPFSGRKKAPYQTKTIAFRVRIEWVEEIKLMVKNKIKELSK |
| Ga0335029_0116794_1178_1339 | 3300034102 | Freshwater | VAKSKKETRGGKRPFSGRKKAPYQTKTIAFRVRIEWVEEIKLMVKNKIKEFSK |
| Ga0335029_0292698_639_791 | 3300034102 | Freshwater | MKQKNKGGKRVGSGRKPAPYQTKTISFRVRIEWVEEIKLMVKNKIKEFSK |
| Ga0335030_0337378_121_282 | 3300034103 | Freshwater | MAKSKKETRGGKRPFSGRKKAPYQTKTIAFRVRIEWVEEIKLMVKNKIKELSK |
| Ga0335058_0023617_1367_1528 | 3300034121 | Freshwater | MSKKETRGGKRPNAGRKKVDYKTETIAFRVREQWVDEIKLLVKEKVKSLAAEL |
| Ga0335060_0107430_10_165 | 3300034122 | Freshwater | MKKKETRGGKRPFSGRKKSTYQTKTISFRVRIEWVEEIKLMVKNKIKELSK |
| ⦗Top⦘ |