


| Basic Information | |
|---|---|
| Family ID | F082357 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 113 |
| Average Sequence Length | 43 residues |
| Representative Sequence | VANRAETTITLTDAPHDDERAVIADGLRAYNEAQAGYSDS |
| Number of Associated Samples | 91 |
| Number of Associated Scaffolds | 113 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 98.23 % |
| % of genes near scaffold ends (potentially truncated) | 95.58 % |
| % of genes from short scaffolds (< 2000 bps) | 94.69 % |
| Associated GOLD sequencing projects | 88 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (53.097 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (53.097 % of family members) |
| Environment Ontology (ENVO) | Unclassified (61.947 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (49.558 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 26.47% β-sheet: 0.00% Coil/Unstructured: 73.53% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 113 Family Scaffolds |
|---|---|---|
| PF03824 | NicO | 15.93 |
| PF04909 | Amidohydro_2 | 5.31 |
| PF08241 | Methyltransf_11 | 4.42 |
| PF00903 | Glyoxalase | 3.54 |
| PF07690 | MFS_1 | 2.65 |
| PF01812 | 5-FTHF_cyc-lig | 2.65 |
| PF00857 | Isochorismatase | 1.77 |
| PF12833 | HTH_18 | 1.77 |
| PF05425 | CopD | 1.77 |
| PF01042 | Ribonuc_L-PSP | 0.88 |
| PF02771 | Acyl-CoA_dh_N | 0.88 |
| PF01593 | Amino_oxidase | 0.88 |
| PF00676 | E1_dh | 0.88 |
| PF01565 | FAD_binding_4 | 0.88 |
| PF00296 | Bac_luciferase | 0.88 |
| PF04828 | GFA | 0.88 |
| PF03706 | LPG_synthase_TM | 0.88 |
| PF07883 | Cupin_2 | 0.88 |
| PF07813 | LTXXQ | 0.88 |
| PF00171 | Aldedh | 0.88 |
| PF02515 | CoA_transf_3 | 0.88 |
| PF13470 | PIN_3 | 0.88 |
| PF02604 | PhdYeFM_antitox | 0.88 |
| PF01541 | GIY-YIG | 0.88 |
| PF13561 | adh_short_C2 | 0.88 |
| PF04392 | ABC_sub_bind | 0.88 |
| PF13847 | Methyltransf_31 | 0.88 |
| PF00122 | E1-E2_ATPase | 0.88 |
| PF02538 | Hydantoinase_B | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
|---|---|---|---|
| COG3678 | Periplasmic chaperone Spy, Spy/CpxP family | Posttranslational modification, protein turnover, chaperones [O] | 3.54 |
| COG0212 | 5-formyltetrahydrofolate cyclo-ligase | Coenzyme transport and metabolism [H] | 2.65 |
| COG0146 | N-methylhydantoinase B/oxoprolinase/acetone carboxylase, alpha subunit | Amino acid transport and metabolism [E] | 1.77 |
| COG1276 | Putative copper export protein | Inorganic ion transport and metabolism [P] | 1.77 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 1.77 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.77 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.88 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.88 |
| COG0392 | Predicted membrane flippase AglD2/YbhN, UPF0104 family | Cell wall/membrane/envelope biogenesis [M] | 0.88 |
| COG0474 | Magnesium-transporting ATPase (P-type) | Inorganic ion transport and metabolism [P] | 0.88 |
| COG0567 | 2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, and related enzymes | Energy production and conversion [C] | 0.88 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.88 |
| COG1071 | TPP-dependent pyruvate or acetoin dehydrogenase subunit alpha | Energy production and conversion [C] | 0.88 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.88 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.88 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.88 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.88 |
| COG2216 | K+ transport ATPase, ATPase subunit KdpB | Inorganic ion transport and metabolism [P] | 0.88 |
| COG2217 | Cation-transporting P-type ATPase | Inorganic ion transport and metabolism [P] | 0.88 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.88 |
| COG3791 | Uncharacterized conserved protein | Function unknown [S] | 0.88 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.88 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 53.10 % |
| All Organisms | root | All Organisms | 46.90 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300003218|JGI26339J46600_10076868 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
| 3300004080|Ga0062385_10049627 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1808 | Open in IMG/M |
| 3300005439|Ga0070711_101136472 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 674 | Open in IMG/M |
| 3300005536|Ga0070697_101130004 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 698 | Open in IMG/M |
| 3300005937|Ga0081455_10566258 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300006804|Ga0079221_11126078 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 603 | Open in IMG/M |
| 3300006804|Ga0079221_11244076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 581 | Open in IMG/M |
| 3300006847|Ga0075431_100120781 | All Organisms → cellular organisms → Bacteria | 2704 | Open in IMG/M |
| 3300006893|Ga0073928_10341786 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1111 | Open in IMG/M |
| 3300007788|Ga0099795_10251800 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300010047|Ga0126382_11426817 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 633 | Open in IMG/M |
| 3300010048|Ga0126373_11639002 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300010341|Ga0074045_10093029 | Not Available | 2094 | Open in IMG/M |
| 3300010359|Ga0126376_11619644 | Not Available | 680 | Open in IMG/M |
| 3300010361|Ga0126378_10563035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1254 | Open in IMG/M |
| 3300010376|Ga0126381_101095917 | Not Available | 1150 | Open in IMG/M |
| 3300010376|Ga0126381_102299272 | Not Available | 774 | Open in IMG/M |
| 3300010398|Ga0126383_11733793 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300011119|Ga0105246_11162149 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300012203|Ga0137399_11084867 | Not Available | 674 | Open in IMG/M |
| 3300012208|Ga0137376_11333799 | Not Available | 608 | Open in IMG/M |
| 3300012362|Ga0137361_11965439 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300012469|Ga0150984_104075666 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 862 | Open in IMG/M |
| 3300012685|Ga0137397_10449598 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 960 | Open in IMG/M |
| 3300012923|Ga0137359_10472874 | Not Available | 1108 | Open in IMG/M |
| 3300012923|Ga0137359_11354825 | Not Available | 600 | Open in IMG/M |
| 3300012971|Ga0126369_10326971 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → Parvibaculum lavamentivorans → Parvibaculum lavamentivorans DS-1 | 1546 | Open in IMG/M |
| 3300012971|Ga0126369_12084907 | Not Available | 655 | Open in IMG/M |
| 3300012987|Ga0164307_11831550 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300016294|Ga0182041_12193008 | Not Available | 516 | Open in IMG/M |
| 3300016341|Ga0182035_10041868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3048 | Open in IMG/M |
| 3300016341|Ga0182035_11479249 | Not Available | 611 | Open in IMG/M |
| 3300016357|Ga0182032_10702237 | Not Available | 849 | Open in IMG/M |
| 3300016422|Ga0182039_12087485 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 522 | Open in IMG/M |
| 3300016445|Ga0182038_10495462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1041 | Open in IMG/M |
| 3300016445|Ga0182038_12102681 | Not Available | 512 | Open in IMG/M |
| 3300017974|Ga0187777_11403278 | Not Available | 515 | Open in IMG/M |
| 3300018468|Ga0066662_11256011 | Not Available | 755 | Open in IMG/M |
| 3300020581|Ga0210399_11056768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 651 | Open in IMG/M |
| 3300020582|Ga0210395_10296343 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1216 | Open in IMG/M |
| 3300021088|Ga0210404_10311937 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 867 | Open in IMG/M |
| 3300021420|Ga0210394_11631998 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300021478|Ga0210402_10544969 | Not Available | 1076 | Open in IMG/M |
| 3300021560|Ga0126371_12570018 | Not Available | 617 | Open in IMG/M |
| 3300022529|Ga0242668_1016959 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1059 | Open in IMG/M |
| 3300027095|Ga0208606_100402 | Not Available | 1522 | Open in IMG/M |
| 3300027680|Ga0207826_1073264 | Not Available | 944 | Open in IMG/M |
| 3300027889|Ga0209380_10555352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales | 667 | Open in IMG/M |
| 3300031122|Ga0170822_16331925 | Not Available | 508 | Open in IMG/M |
| 3300031544|Ga0318534_10783836 | Not Available | 536 | Open in IMG/M |
| 3300031545|Ga0318541_10603417 | Not Available | 614 | Open in IMG/M |
| 3300031545|Ga0318541_10876757 | Not Available | 501 | Open in IMG/M |
| 3300031546|Ga0318538_10485144 | Not Available | 670 | Open in IMG/M |
| 3300031561|Ga0318528_10388516 | Not Available | 749 | Open in IMG/M |
| 3300031572|Ga0318515_10145768 | All Organisms → cellular organisms → Bacteria | 1260 | Open in IMG/M |
| 3300031573|Ga0310915_10615197 | Not Available | 769 | Open in IMG/M |
| 3300031573|Ga0310915_11195108 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300031640|Ga0318555_10082596 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1675 | Open in IMG/M |
| 3300031679|Ga0318561_10589043 | Not Available | 612 | Open in IMG/M |
| 3300031680|Ga0318574_10099626 | All Organisms → cellular organisms → Bacteria | 1610 | Open in IMG/M |
| 3300031680|Ga0318574_10493808 | Not Available | 717 | Open in IMG/M |
| 3300031680|Ga0318574_10849791 | Not Available | 534 | Open in IMG/M |
| 3300031681|Ga0318572_10879081 | Not Available | 532 | Open in IMG/M |
| 3300031719|Ga0306917_11212952 | Not Available | 585 | Open in IMG/M |
| 3300031723|Ga0318493_10431895 | Not Available | 723 | Open in IMG/M |
| 3300031724|Ga0318500_10124233 | Not Available | 1195 | Open in IMG/M |
| 3300031736|Ga0318501_10523733 | Not Available | 647 | Open in IMG/M |
| 3300031770|Ga0318521_10154937 | All Organisms → cellular organisms → Bacteria | 1303 | Open in IMG/M |
| 3300031770|Ga0318521_10725055 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300031770|Ga0318521_10956628 | Not Available | 524 | Open in IMG/M |
| 3300031777|Ga0318543_10066396 | All Organisms → cellular organisms → Bacteria | 1503 | Open in IMG/M |
| 3300031777|Ga0318543_10467537 | Not Available | 565 | Open in IMG/M |
| 3300031778|Ga0318498_10093913 | All Organisms → cellular organisms → Bacteria | 1358 | Open in IMG/M |
| 3300031793|Ga0318548_10060116 | All Organisms → cellular organisms → Bacteria | 1758 | Open in IMG/M |
| 3300031793|Ga0318548_10391350 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300031796|Ga0318576_10292313 | Not Available | 769 | Open in IMG/M |
| 3300031799|Ga0318565_10462955 | Not Available | 613 | Open in IMG/M |
| 3300031831|Ga0318564_10341806 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 658 | Open in IMG/M |
| 3300031832|Ga0318499_10056429 | Not Available | 1475 | Open in IMG/M |
| 3300031833|Ga0310917_10566994 | Not Available | 771 | Open in IMG/M |
| 3300031835|Ga0318517_10500357 | Not Available | 547 | Open in IMG/M |
| 3300031845|Ga0318511_10414702 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300031893|Ga0318536_10112801 | Not Available | 1370 | Open in IMG/M |
| 3300031893|Ga0318536_10512749 | Not Available | 602 | Open in IMG/M |
| 3300031894|Ga0318522_10026948 | All Organisms → cellular organisms → Bacteria | 1915 | Open in IMG/M |
| 3300031896|Ga0318551_10696807 | Not Available | 588 | Open in IMG/M |
| 3300031897|Ga0318520_10727641 | Not Available | 621 | Open in IMG/M |
| 3300031897|Ga0318520_10894499 | Not Available | 559 | Open in IMG/M |
| 3300031910|Ga0306923_10285885 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Desertifilaceae → Desertifilum → unclassified Desertifilum → Desertifilum sp. IPPAS B-1220 | 1885 | Open in IMG/M |
| 3300031910|Ga0306923_11977237 | Not Available | 593 | Open in IMG/M |
| 3300031910|Ga0306923_12542350 | Not Available | 504 | Open in IMG/M |
| 3300031912|Ga0306921_10312275 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1840 | Open in IMG/M |
| 3300031912|Ga0306921_11152804 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 866 | Open in IMG/M |
| 3300031941|Ga0310912_10780774 | Not Available | 738 | Open in IMG/M |
| 3300031942|Ga0310916_10058465 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2976 | Open in IMG/M |
| 3300031945|Ga0310913_11086412 | Not Available | 559 | Open in IMG/M |
| 3300031947|Ga0310909_10160999 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1850 | Open in IMG/M |
| 3300031962|Ga0307479_10575255 | Not Available | 1109 | Open in IMG/M |
| 3300032001|Ga0306922_10088153 | All Organisms → cellular organisms → Bacteria | 3266 | Open in IMG/M |
| 3300032001|Ga0306922_10102256 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 3032 | Open in IMG/M |
| 3300032010|Ga0318569_10428618 | Not Available | 617 | Open in IMG/M |
| 3300032025|Ga0318507_10274746 | Not Available | 732 | Open in IMG/M |
| 3300032041|Ga0318549_10343354 | Not Available | 673 | Open in IMG/M |
| 3300032044|Ga0318558_10648232 | Not Available | 528 | Open in IMG/M |
| 3300032054|Ga0318570_10257772 | Not Available | 791 | Open in IMG/M |
| 3300032068|Ga0318553_10391108 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300032089|Ga0318525_10625953 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300032090|Ga0318518_10213877 | Not Available | 988 | Open in IMG/M |
| 3300032094|Ga0318540_10391783 | Not Available | 671 | Open in IMG/M |
| 3300032261|Ga0306920_101906357 | Not Available | 835 | Open in IMG/M |
| 3300033289|Ga0310914_10675969 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
| 3300033289|Ga0310914_11364539 | Not Available | 611 | Open in IMG/M |
| 3300033289|Ga0310914_11860352 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. | 506 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 53.10% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.16% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.85% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.19% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.77% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.77% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.77% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.89% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.89% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.89% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.89% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.89% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.89% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.89% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.89% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.89% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300003218 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022529 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300027095 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF020 (SPAdes) | Environmental | Open in IMG/M |
| 3300027680 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI26339J46600_100768682 | 3300003218 | Bog Forest Soil | VANQAETTITLTDAPDDDERAVITDGLRAYNEAQAGYSDA |
| Ga0062385_100496273 | 3300004080 | Bog Forest Soil | VANDAETTVTLTDAPDADAVDVIAGGLRAYNEAQAGYSDWRPLGILVRDPLRPRQ* |
| Ga0070711_1011364722 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | VADRAETTITLTDAPHDDERAVIAEGLRAYNEAQAGYSDSRALAV |
| Ga0070697_1011300042 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | VEGGNAVADRAETTITLTDAPHDDESAVIAEGLRAYNEAQAGYSD |
| Ga0081455_105662581 | 3300005937 | Tabebuia Heterophylla Rhizosphere | VADRAEPTIMLTDAPEDEERAVIAEGLRAYNKGQSGVD |
| Ga0079221_111260781 | 3300006804 | Agricultural Soil | MANQAETKITLTDAPDDDERAVIHDGLRGYNETQA |
| Ga0079221_112440762 | 3300006804 | Agricultural Soil | VADLVETTITLTDAPDDKQHAVIMDGLRTYNEAQAGGSDAHARLSSSSAI |
| Ga0075431_1001207811 | 3300006847 | Populus Rhizosphere | MTPAITLTDAPDAEAAAVIERGLSRYNEEQAGYKD |
| Ga0073928_103417863 | 3300006893 | Iron-Sulfur Acid Spring | VPSRAETTITLTDAPEDSERTVVMDGLRAYNEERAGVSDARQFAIQPT* |
| Ga0099795_102518002 | 3300007788 | Vadose Zone Soil | VANRAETTITLTDAPDDDERTVITDGLRAYNETQAGGSDGRPLAILVRNPETQRW |
| Ga0126382_114268171 | 3300010047 | Tropical Forest Soil | VANRAETTITLTDAPHDDELSMIAEGLRVYNEAQAGY |
| Ga0126373_116390022 | 3300010048 | Tropical Forest Soil | VTNRAGTTITLTDAPNDDECAVITEGLRAYNEAQAGHSDSR |
| Ga0074045_100930291 | 3300010341 | Bog Forest Soil | VANDAETVITLTDAPDDDERAAITDGLRTYNETRAGG |
| Ga0126376_116196441 | 3300010359 | Tropical Forest Soil | VANLAETTITLTDAPDDDESAAITDGLRAYNEAQAGYS |
| Ga0126378_105630351 | 3300010361 | Tropical Forest Soil | VANRPETTITLTDAPHDDERAVIADGLRAYNEAQAGYSDSRALT |
| Ga0126381_1010959171 | 3300010376 | Tropical Forest Soil | VANQAETMITLTDAPDDGERPAITGGLRAYNGAQAGASDSRALAILVPPEPFGLV* |
| Ga0126381_1022992722 | 3300010376 | Tropical Forest Soil | MANRAEITMTLTDAPHDDERAVIADGLRAYNETQAGYSDSRALTVLVSDPET |
| Ga0126383_117337932 | 3300010398 | Tropical Forest Soil | VTNRAGTTITLTDTPNDDECAVITEGLRAYNEAQAG |
| Ga0105246_111621492 | 3300011119 | Miscanthus Rhizosphere | VVNRAETTITLTDVPHDDELAVIAEELRAYNEAQAGYSDSRAL |
| Ga0137399_110848671 | 3300012203 | Vadose Zone Soil | MAVTVREANHAETQITLTDAPDDRERAVIMDGLRAYNEAQAGGSDACPLAV |
| Ga0137376_113337991 | 3300012208 | Vadose Zone Soil | LGDDAVANHAETNITLTDAPGDDELAVITEGLRAYNEAQAGVSDARALAILVRNP |
| Ga0137361_119654391 | 3300012362 | Vadose Zone Soil | VANQAETTITLTDAPHDDESAVIAEGLRAYNEAQAGYSDSRALA |
| Ga0150984_1040756662 | 3300012469 | Avena Fatua Rhizosphere | VANRAETTITLTDAPHDDERAVIADGLRAYNEAQAGYSDS |
| Ga0137397_104495981 | 3300012685 | Vadose Zone Soil | VANRAETTITLTDAPDDDERTVITDGLRAYNETQA |
| Ga0137359_104728741 | 3300012923 | Vadose Zone Soil | VLSRAETTITLTDAPEDGERTVVMDGLRAYNEERAGVSDARQLAIL |
| Ga0137359_113548252 | 3300012923 | Vadose Zone Soil | VPSRAETTITLTDAPEDGERTVVMDGLRAYNEERAGVSDARQLAILA |
| Ga0126369_103269713 | 3300012971 | Tropical Forest Soil | VANQAETTITLTDAPDDGECAVITEGLRAYNEAQAGFSDSRALAILVPEPFGLV* |
| Ga0126369_120849072 | 3300012971 | Tropical Forest Soil | VADRAEAVIALTDAPDDSARAVITDGLRAYNEAWAGTWDARPLA |
| Ga0164307_118315502 | 3300012987 | Soil | VANITLTDAPRDHELAVIAEELRAYNEAQAGYSDSRA |
| Ga0182041_121930081 | 3300016294 | Soil | VANRAETTITLTDAPDDDESAAITDGLRAYNEAQAGHSDSRALA |
| Ga0182035_100418681 | 3300016341 | Soil | VANQAETVITLTDAPDDDERASITDGLRAYNEAQAGGS |
| Ga0182035_114792491 | 3300016341 | Soil | VANRAETTITLSDAPADDERAVITDGLRGYNEEQAGPWDGRPLAI |
| Ga0182032_107022372 | 3300016357 | Soil | VANQAETSITLTDAPDDREGAMITEGLRAYNEAQAGVSDSRALAILVR |
| Ga0182039_120874852 | 3300016422 | Soil | VANGAETTITLTDAPHDDECAVIADGLRAYNEAQAGYSDSRALAVLVS |
| Ga0182038_104954623 | 3300016445 | Soil | VADHAGTTITITDAPDDEERAVITDGLRGYNEQRAGSWDGRPLAILARDPE |
| Ga0182038_121026812 | 3300016445 | Soil | VANRAETTITLTDAPDDAERAVITDGLRAYNEAQAGSWDG |
| Ga0187777_114032782 | 3300017974 | Tropical Peatland | VANRAETTITLTDAPGDDERAVITDGLRAYNEAQAGASDFRPLAILA |
| Ga0066662_112560112 | 3300018468 | Grasslands Soil | VANKAETTITLTDAPEDDESAVITDGLRAYNEKQAGSWDGRPLAIFA |
| Ga0210399_110567682 | 3300020581 | Soil | VPSRAETAITLTDAPEDGERTVVMDGLRTYNEERAGVSDA |
| Ga0210395_102963433 | 3300020582 | Soil | VANKAETTITLTDAPHDEECAVIAEGLRAYNEAQAG |
| Ga0210404_103119372 | 3300021088 | Soil | MADEAETTITLTDAPHDDERAVIAEGLRAYNEAQAGYSDSRALAV |
| Ga0210394_116319981 | 3300021420 | Soil | MADEAETTITLTDAPHDDERAVIAEGLRAYNEAQAGYSDSRALA |
| Ga0210402_105449692 | 3300021478 | Soil | VPCRAETTITLTDAPEDGERTVVMDGLRAYNEERAGVSDAR |
| Ga0126371_125700182 | 3300021560 | Tropical Forest Soil | VANQAGITIALTDSPEDEEHAVITDGLRAYNEARAGSWDGRPLAILARD |
| Ga0242668_10169593 | 3300022529 | Soil | VANKAETTITLTDAPHDDESAVIAEGLRAYNEAQAGYSDSRELAVLVR |
| Ga0208606_1004022 | 3300027095 | Forest Soil | VPSRAETTITLTHAPEDGERTVVMDGLRAYNEERAGVSDARQLAI |
| Ga0207826_10732641 | 3300027680 | Tropical Forest Soil | VANRAETTITLTAAPGDNERAVITDGLRAYNEAQVGRWDGS |
| Ga0209380_105553521 | 3300027889 | Soil | MADEAETTITLTDAPHDDERAVIADGLRAYNEAQAGYSDSRALAV |
| Ga0170822_163319252 | 3300031122 | Forest Soil | VANKPETTIDLTDMPHDDECAVIAEGLRAYNEAQAGYS |
| Ga0318534_107838361 | 3300031544 | Soil | VANRAETTITLTDAPHDDERAVIADGLRAYNEAQAGHSDSRALALLVSDPE |
| Ga0318541_106034171 | 3300031545 | Soil | VANRAETAITLTDAPDDEERAVITDGLRAYNEAQAGPWDGRPLAIFA |
| Ga0318541_108767572 | 3300031545 | Soil | VANRAETTITLTDAPDDAERAVITDGLRAYNEAQAGSW |
| Ga0318538_104851442 | 3300031546 | Soil | VANRAEAVIAMTDAPEDSERAVITDGLRAYNEEWAGSWDGRPLAILAHDPQT |
| Ga0318528_103885162 | 3300031561 | Soil | VANRAETTITLTDAPHDDERAVIAEGLRAYNEAQAGY |
| Ga0318515_101457683 | 3300031572 | Soil | VANQAETVITLTDAPDDDERASITDGLRAYNEAQAGGSDGRPLAI |
| Ga0310915_106151971 | 3300031573 | Soil | VANRAETTITLTDAPDDDERAVITDGLRGYNESQAGPWDGR |
| Ga0310915_111951081 | 3300031573 | Soil | VANRAETTITLTDAPHDDDRAVIADGLRAYNEAQAGYSD |
| Ga0318555_100825961 | 3300031640 | Soil | VANRAETAITLTDAPDDAERAVITDGLRAYNEAQAGSW |
| Ga0318561_105890432 | 3300031679 | Soil | VANRAETTITLTDAPDDAERAVITDGLRAYNEAQAGSWDGRPLAIF |
| Ga0318574_100996263 | 3300031680 | Soil | VADRAQTAITLTDAPHDDECAVIAEGLRAYNEAQAGYSDSRALVV |
| Ga0318574_104938082 | 3300031680 | Soil | VANRAETTITLTDAPHDDERAVIAEGLRAYNEAQAGYTDSRA |
| Ga0318574_108497911 | 3300031680 | Soil | VANQAETVITLTDAPDDDERASITDGLRAYNEAQAG |
| Ga0318572_108790811 | 3300031681 | Soil | VANRAETTITLTDAPHDDERAVIADGLRAYNEAQA |
| Ga0306917_112129522 | 3300031719 | Soil | VANRAETTITLTDAPHDDERAVIADGLRAYNEAQAGSSDSRALALLV |
| Ga0318493_104318951 | 3300031723 | Soil | MASRAETTITLTDAPHDDERAVIADGLRAYNEAQAGSSDSRALALLVSDPE |
| Ga0318500_101242331 | 3300031724 | Soil | MASRAETTITLTDAPHDDERAVIADGLRAYNEAQAGHSDSRALALLVS |
| Ga0318501_105237332 | 3300031736 | Soil | VANRAETTITLTDAPHDDERAVIAEGLRAYNEAQAGYSDSRAL |
| Ga0318521_101549373 | 3300031770 | Soil | VADRAQTAITLTDAPHDDECAVIAEGLRAYNEAQAGYSDSRALAVLV |
| Ga0318521_107250552 | 3300031770 | Soil | VANRAETTVTLTDAPHDDERAVIADGLRTYNEAQAGYSDSRALAI |
| Ga0318521_109566281 | 3300031770 | Soil | VANRAETKITLTEAPDDDERAVITDGLRAYNEAQAG |
| Ga0318543_100663963 | 3300031777 | Soil | VANQAETVITLTDAPDDDERASITDGLRAYNEAQAGGSDGRPLAIFVRNPETK |
| Ga0318543_104675372 | 3300031777 | Soil | VANRAETTITLTDAPHDDERAVIAEGLRAYNEAQAGYTDS |
| Ga0318498_100939133 | 3300031778 | Soil | VANRAETTITLTDAPDADEQAVIADGLRAYNEAQAGYSDSRELAL |
| Ga0318548_100601163 | 3300031793 | Soil | VADRAQTAITLTDAPHDDECAVIAEGLRAYNEAQA |
| Ga0318548_103913501 | 3300031793 | Soil | VANRAETTITLTDAPDADEQAVIADGLRAYNEAQAGYSDSRG |
| Ga0318576_102923132 | 3300031796 | Soil | VANRAETMIAVSDAPDDEERAVITDGLRGYNEEQAGPWDVR |
| Ga0318565_104629551 | 3300031799 | Soil | VANRAETTITLTDAPHDDERAVIADGLRAYNEAQAGSSDSRALALLVSDPET |
| Ga0318564_103418061 | 3300031831 | Soil | VANRAETTITLTDAPDADEQAVIADGLRAYNEAQAGY |
| Ga0318499_100564292 | 3300031832 | Soil | VANQTETTITLTDTPDDDERAVITDGLRAYNEVRAG |
| Ga0310917_105669942 | 3300031833 | Soil | VANQAETSITLTDAPDDREGAMITEGLRAYTEAQAGVSD |
| Ga0318517_105003572 | 3300031835 | Soil | VANRAETTITLTDAPHDDERAVIADGLRAYNEAQAGSSDSRALALL |
| Ga0318511_104147021 | 3300031845 | Soil | VANDAETVTLTDAPDADAVEVIASGLRAYNEAQAGYSD |
| Ga0318536_101128012 | 3300031893 | Soil | VANRAETMIAVSDAPDDEERAVITDGLRGYNEEQAGPWDGRPLAVLA |
| Ga0318536_105127492 | 3300031893 | Soil | VANRAETTITLTDAPHDDDRAVIADGLRAYNEAQAGYSDSRVLALLV |
| Ga0318522_100269481 | 3300031894 | Soil | VANRAETTITLTDAPDADEQAVIADGLRAYNEAQAGYS |
| Ga0318551_106968072 | 3300031896 | Soil | VANRAETTITLTDAPHDDERAVIAEGLRAYNEAQAGYSDSRA |
| Ga0318520_107276411 | 3300031897 | Soil | VANRAETMIAVSDAPDDEERAVITDGLRGYNEEQAGPWDGRP |
| Ga0318520_108944991 | 3300031897 | Soil | VANQAETTITLTDAPDDDERAVIMDGLRTYNEVQAGGSD |
| Ga0306923_102858851 | 3300031910 | Soil | VANDAETVTLTDAPDADAVEVIASGLRAYNEAQAG |
| Ga0306923_119772371 | 3300031910 | Soil | VANQAETAITLTDAPDDGERTVITEGLRTYNEAQAGVSDSRALAIPVPPEPFGLV |
| Ga0306923_125423502 | 3300031910 | Soil | VANQAETTITLTDAPDDDERAVIMDGLRTYNEVQAGGSDTRPLAIL |
| Ga0306921_103122751 | 3300031912 | Soil | VANRAETAITLTDAPDDEERAVITDGLRGYNESQAGPWDGRPLAIVA |
| Ga0306921_111528042 | 3300031912 | Soil | VANGAETTITLTDAPHDDECAVIAEGLRAYNEAQAGYSDSRALALLVSD |
| Ga0310912_107807741 | 3300031941 | Soil | VADRAEAVIALTDAPDDSARAVITDGLRAYNEAWAGTWDAR |
| Ga0310916_100584654 | 3300031942 | Soil | VANRAEAVIAMTDAPEDSERAVITDGLRAYNEEWAGS |
| Ga0310913_110864121 | 3300031945 | Soil | VANRAETAITLTDAPDDEERAVITDGLRAYNEAQAGPWDG |
| Ga0310909_101609991 | 3300031947 | Soil | VANRAEAVIAMTDAPEDSERAVITDGLRAYNEEWAGSWDGRPLAILAHD |
| Ga0307479_105752551 | 3300031962 | Hardwood Forest Soil | VANRAETTITLTDTPHDDDRAAIAEGLRAYNEAQAGYSDSRALALLVSDPESK |
| Ga0306922_100881535 | 3300032001 | Soil | VADRAQTAITLTDAPHDDECAVIAEGLRAYNEAQAGYSD |
| Ga0306922_101022564 | 3300032001 | Soil | VANDAETVTLTDAPDADAVEVIESGLRAYNEAQAGYSD |
| Ga0318569_104286181 | 3300032010 | Soil | MASRAETTITLTDAPHDDERAVIADGLRAYNEAQAGHSDSRAL |
| Ga0318507_102747461 | 3300032025 | Soil | VANRAETTITLTDAPHDDERAVIAEGLRAYNEAQAGYTDSRAL |
| Ga0318549_103433541 | 3300032041 | Soil | MASRAETTITLTDAPHDDERAVIADGLRAYNEAQAGHSDSRALALLV |
| Ga0318558_106482321 | 3300032044 | Soil | VANQTETTITVTDAPDDDERAVIADGLRAYNEAQAGYSDSRALALLV |
| Ga0318570_102577722 | 3300032054 | Soil | MASRAETTITLTDAPHDDERAVIADGLRAYNEAQAGHSDSRA |
| Ga0318553_103911082 | 3300032068 | Soil | VANDAETVTLTDAPDADAVEVIASGLRAYIEAQAGY |
| Ga0318525_106259532 | 3300032089 | Soil | VADRAQTAITLTDAPHDDECAVIAEGLRAYNEAQAG |
| Ga0318518_102138772 | 3300032090 | Soil | VANQAETVITLTDAPDDDERASITDGLRAYNEAQAGGSDGRPLAIFVRNP |
| Ga0318540_103917831 | 3300032094 | Soil | VANRAETTITLTDAPHDDERAVIAEGLRAYNEAQAGYSD |
| Ga0306920_1019063572 | 3300032261 | Soil | VANRAETTITLTDAPGDNERAVITDGLRAYNEAQAGS |
| Ga0310914_106759692 | 3300033289 | Soil | VANDAETVTLTDAPDADAVEVIASGLRAYNEAQAGYS |
| Ga0310914_113645391 | 3300033289 | Soil | VANRAETMITLTDAPDDDERAVITDGLRAYNEAQAGAWDG |
| Ga0310914_118603522 | 3300033289 | Soil | TDGPDDGERAVITEGLRAYDGPQARGSDSRALAILVSPEPFGLV |
| ⦗Top⦘ |