


| Basic Information | |
|---|---|
| Family ID | F082319 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 113 |
| Average Sequence Length | 49 residues |
| Representative Sequence | MIPQLSIQERDRRYKIVRAEMAKRGIDVLLLPANTGRWEQLQGDSRYL |
| Number of Associated Samples | 107 |
| Number of Associated Scaffolds | 113 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 98.21 % |
| % of genes near scaffold ends (potentially truncated) | 98.23 % |
| % of genes from short scaffolds (< 2000 bps) | 97.35 % |
| Associated GOLD sequencing projects | 104 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.54 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.115 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (12.389 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.628 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (35.398 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 23.68% β-sheet: 13.16% Coil/Unstructured: 63.16% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 113 Family Scaffolds |
|---|---|---|
| PF00903 | Glyoxalase | 6.19 |
| PF04392 | ABC_sub_bind | 4.42 |
| PF12681 | Glyoxalase_2 | 4.42 |
| PF13416 | SBP_bac_8 | 1.77 |
| PF03401 | TctC | 0.88 |
| PF13531 | SBP_bac_11 | 0.88 |
| PF14294 | DUF4372 | 0.88 |
| PF00557 | Peptidase_M24 | 0.88 |
| PF02371 | Transposase_20 | 0.88 |
| PF13343 | SBP_bac_6 | 0.88 |
| PF07878 | RHH_5 | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
|---|---|---|---|
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 4.42 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.88 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.12 % |
| Unclassified | root | N/A | 0.88 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000559|F14TC_101762312 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 940 | Open in IMG/M |
| 3300000953|JGI11615J12901_10001259 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300000956|JGI10216J12902_100850292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1517 | Open in IMG/M |
| 3300000956|JGI10216J12902_104045010 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 756 | Open in IMG/M |
| 3300003987|Ga0055471_10247335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 565 | Open in IMG/M |
| 3300004011|Ga0055460_10059175 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1007 | Open in IMG/M |
| 3300004157|Ga0062590_101742695 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300004480|Ga0062592_101638573 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300005294|Ga0065705_11028146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 540 | Open in IMG/M |
| 3300005295|Ga0065707_10176192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1449 | Open in IMG/M |
| 3300005345|Ga0070692_10378957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 887 | Open in IMG/M |
| 3300005354|Ga0070675_101214521 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 694 | Open in IMG/M |
| 3300005445|Ga0070708_100773188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 903 | Open in IMG/M |
| 3300005471|Ga0070698_101089843 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 747 | Open in IMG/M |
| 3300005518|Ga0070699_101617641 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300005558|Ga0066698_10595654 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300005561|Ga0066699_11138048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 537 | Open in IMG/M |
| 3300005598|Ga0066706_10537609 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
| 3300005713|Ga0066905_100770794 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300005713|Ga0066905_100953078 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300005843|Ga0068860_100868541 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
| 3300005843|Ga0068860_102572636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 528 | Open in IMG/M |
| 3300006844|Ga0075428_100503774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1295 | Open in IMG/M |
| 3300006845|Ga0075421_102051701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 608 | Open in IMG/M |
| 3300006845|Ga0075421_102068340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 605 | Open in IMG/M |
| 3300006847|Ga0075431_101737353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 580 | Open in IMG/M |
| 3300006852|Ga0075433_11067236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 703 | Open in IMG/M |
| 3300006853|Ga0075420_101071504 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300006854|Ga0075425_102590426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 560 | Open in IMG/M |
| 3300006871|Ga0075434_102117632 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 567 | Open in IMG/M |
| 3300006880|Ga0075429_101557911 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 575 | Open in IMG/M |
| 3300006903|Ga0075426_11301548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 552 | Open in IMG/M |
| 3300006904|Ga0075424_102313929 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 564 | Open in IMG/M |
| 3300006914|Ga0075436_101013894 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 623 | Open in IMG/M |
| 3300006918|Ga0079216_11956153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 508 | Open in IMG/M |
| 3300006954|Ga0079219_12481789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 504 | Open in IMG/M |
| 3300009100|Ga0075418_11266238 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 799 | Open in IMG/M |
| 3300009101|Ga0105247_11487787 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 552 | Open in IMG/M |
| 3300009162|Ga0075423_11566759 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 708 | Open in IMG/M |
| 3300009609|Ga0105347_1253830 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 724 | Open in IMG/M |
| 3300010043|Ga0126380_11792327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 555 | Open in IMG/M |
| 3300010047|Ga0126382_12186903 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300010304|Ga0134088_10627645 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300010359|Ga0126376_12562084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 558 | Open in IMG/M |
| 3300011405|Ga0137340_1115095 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300011417|Ga0137326_1084915 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 714 | Open in IMG/M |
| 3300011427|Ga0137448_1131199 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300011441|Ga0137452_1126293 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
| 3300012022|Ga0120191_10012280 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1090 | Open in IMG/M |
| 3300012035|Ga0137445_1018804 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1261 | Open in IMG/M |
| 3300012039|Ga0137421_1133133 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 728 | Open in IMG/M |
| 3300012198|Ga0137364_10457558 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 958 | Open in IMG/M |
| 3300012349|Ga0137387_11195823 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 537 | Open in IMG/M |
| 3300012354|Ga0137366_10799083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 670 | Open in IMG/M |
| 3300012498|Ga0157345_1049592 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 530 | Open in IMG/M |
| 3300012519|Ga0157352_1039119 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 664 | Open in IMG/M |
| 3300012884|Ga0157300_1108732 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 521 | Open in IMG/M |
| 3300012984|Ga0164309_11725503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 537 | Open in IMG/M |
| 3300012988|Ga0164306_11317800 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 611 | Open in IMG/M |
| 3300014326|Ga0157380_10999487 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 870 | Open in IMG/M |
| 3300014865|Ga0180078_1081983 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 560 | Open in IMG/M |
| 3300015053|Ga0137405_1094386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1347 | Open in IMG/M |
| 3300015259|Ga0180085_1031918 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1483 | Open in IMG/M |
| 3300015262|Ga0182007_10341032 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 560 | Open in IMG/M |
| 3300015371|Ga0132258_12094515 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1422 | Open in IMG/M |
| 3300015373|Ga0132257_100280491 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1997 | Open in IMG/M |
| 3300017656|Ga0134112_10309466 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 637 | Open in IMG/M |
| 3300017792|Ga0163161_10259254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1357 | Open in IMG/M |
| 3300017966|Ga0187776_10819942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 669 | Open in IMG/M |
| 3300018000|Ga0184604_10106365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 876 | Open in IMG/M |
| 3300018028|Ga0184608_10134635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1056 | Open in IMG/M |
| 3300018073|Ga0184624_10340995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 671 | Open in IMG/M |
| 3300018076|Ga0184609_10458840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 585 | Open in IMG/M |
| 3300018081|Ga0184625_10080460 | All Organisms → cellular organisms → Bacteria | 1666 | Open in IMG/M |
| 3300018081|Ga0184625_10372097 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 740 | Open in IMG/M |
| 3300019356|Ga0173481_10023545 | All Organisms → cellular organisms → Bacteria | 1900 | Open in IMG/M |
| 3300019789|Ga0137408_1281784 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1035 | Open in IMG/M |
| 3300020003|Ga0193739_1029211 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1432 | Open in IMG/M |
| 3300020004|Ga0193755_1006630 | All Organisms → cellular organisms → Bacteria | 3753 | Open in IMG/M |
| 3300020006|Ga0193735_1001488 | All Organisms → cellular organisms → Bacteria | 7529 | Open in IMG/M |
| 3300020022|Ga0193733_1017996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1996 | Open in IMG/M |
| 3300020195|Ga0163150_10141198 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1403 | Open in IMG/M |
| 3300021412|Ga0193736_1044787 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300021560|Ga0126371_10289040 | All Organisms → cellular organisms → Bacteria | 1763 | Open in IMG/M |
| 3300022214|Ga0224505_10103844 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1115 | Open in IMG/M |
| 3300022385|Ga0210376_1062250 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300022694|Ga0222623_10294574 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 623 | Open in IMG/M |
| 3300022756|Ga0222622_10863059 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 663 | Open in IMG/M |
| 3300025926|Ga0207659_10995729 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 721 | Open in IMG/M |
| 3300025934|Ga0207686_10717724 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 796 | Open in IMG/M |
| 3300025951|Ga0210066_1046489 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 729 | Open in IMG/M |
| 3300025966|Ga0210105_1077594 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300025971|Ga0210102_1039464 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1020 | Open in IMG/M |
| 3300026095|Ga0207676_11151832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 768 | Open in IMG/M |
| 3300026118|Ga0207675_102066733 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 586 | Open in IMG/M |
| 3300026320|Ga0209131_1312934 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 584 | Open in IMG/M |
| 3300026324|Ga0209470_1345263 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 535 | Open in IMG/M |
| 3300026332|Ga0209803_1149800 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 904 | Open in IMG/M |
| 3300026540|Ga0209376_1346801 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 562 | Open in IMG/M |
| 3300026548|Ga0209161_10479957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 548 | Open in IMG/M |
| 3300027787|Ga0209074_10231541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 709 | Open in IMG/M |
| 3300027874|Ga0209465_10192705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1017 | Open in IMG/M |
| 3300028293|Ga0247662_1074948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 603 | Open in IMG/M |
| 3300028828|Ga0307312_11050122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 539 | Open in IMG/M |
| 3300028884|Ga0307308_10222399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 905 | Open in IMG/M |
| 3300031820|Ga0307473_10297499 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1014 | Open in IMG/M |
| 3300032163|Ga0315281_10893759 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 909 | Open in IMG/M |
| 3300032205|Ga0307472_100143725 | All Organisms → cellular organisms → Bacteria | 1730 | Open in IMG/M |
| 3300033480|Ga0316620_11332216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 706 | Open in IMG/M |
| 3300033513|Ga0316628_104388098 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 500 | Open in IMG/M |
| 3300034150|Ga0364933_089775 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 774 | Open in IMG/M |
| 3300034819|Ga0373958_0186190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 537 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 12.39% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.85% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 7.96% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 5.31% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 4.42% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.42% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.42% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.54% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.54% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.65% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.65% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.77% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.77% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.77% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.77% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.77% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.77% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.77% |
| Freshwater Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat | 0.89% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.89% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.89% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.89% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.89% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.89% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.89% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.89% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.89% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003987 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 | Environmental | Open in IMG/M |
| 3300004011 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009609 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300011405 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT400_2 | Environmental | Open in IMG/M |
| 3300011417 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT500_2 | Environmental | Open in IMG/M |
| 3300011427 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT418_2 | Environmental | Open in IMG/M |
| 3300011441 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT513_2 | Environmental | Open in IMG/M |
| 3300012022 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6 | Environmental | Open in IMG/M |
| 3300012035 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT338_2 | Environmental | Open in IMG/M |
| 3300012039 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT534_2 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Host-Associated | Open in IMG/M |
| 3300012519 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.7.yng.070610 | Environmental | Open in IMG/M |
| 3300012884 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014865 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT499_16_10D | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015259 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_10D | Environmental | Open in IMG/M |
| 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020003 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
| 3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
| 3300020195 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.P2.IB | Environmental | Open in IMG/M |
| 3300021412 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2m1 | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022214 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_4_1 | Environmental | Open in IMG/M |
| 3300022385 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S771 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025951 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025966 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025971 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300028293 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK03 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300034150 | Sediment microbial communities from East River floodplain, Colorado, United States - 25_j17 | Environmental | Open in IMG/M |
| 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F14TC_1017623121 | 3300000559 | Soil | MIPQLSIEERDRRYKIVRGEMAKRGIDCLLLPANTGRWEQLQGDSRYLTTIGGFATE |
| JGI11615J12901_100012591 | 3300000953 | Soil | MIPQLSIQERDRRYQLVRAEMAKRGIDVLLLPANTGRWEQLQGDSRY |
| JGI10216J12902_1008502922 | 3300000956 | Soil | MIPQLSVEERDRRYQLVRAEMAKRGVDVLLLPANTGRWEQLQGDSRYLTNIGGFATEMFTVFPA |
| JGI10216J12902_1040450102 | 3300000956 | Soil | MIPQLSIQERDRRYQIVRAEMAKRGIDVLLLPANTGRWEQLQGDSRYLTNI |
| Ga0055471_102473351 | 3300003987 | Natural And Restored Wetlands | MIPQLSIEERDRRYQVVRAEMSKRNIDVLLLPANTGRWEQLQGDSRYLTTIG |
| Ga0055460_100591752 | 3300004011 | Natural And Restored Wetlands | MIPQLSIQERDRRYQLVRAEMVKRGIDVLLLPANTGRWEQLQGDSRYLTNIGG |
| Ga0062590_1017426952 | 3300004157 | Soil | MIPQLSIQERDRRYQLVRAEMAERGIDVLLLPANTGRWEQLQGDSRYLTNIGGFATEMFT |
| Ga0062592_1016385732 | 3300004480 | Soil | MIPQLSIQERDRRYQLVRAEMAKRGIDVLLLPANTGRWEQLQGDSRYLTNIG |
| Ga0065705_110281461 | 3300005294 | Switchgrass Rhizosphere | MIPQLSIEERDRRYKIVRAEMAKRGIDVLLLPANTGRWEQ |
| Ga0065707_101761921 | 3300005295 | Switchgrass Rhizosphere | MIPQLSIQERDRRYKIVRAEMAKHGIDCLLLPANTGRWEQLQGDSRYLTTIG |
| Ga0070692_103789571 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MIPQLSIEERDRRYKIVRAEMVQRNIDVLLLPANTGRWEQLQGDSRYLT |
| Ga0070675_1012145211 | 3300005354 | Miscanthus Rhizosphere | MIPQLSIQERDRRYKLVRAEMAKRGIDVLLLPANTGRWEQLQGDSRYLTNIGGFATEMF |
| Ga0070708_1007731882 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MIPQLSLQERDRRYDKVRAEMARQGIDCLLLPANTGRWEQLQGDSRYLTTIGGFATEVF |
| Ga0070698_1010898431 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MIPQLSIEERDRRYKIVRGEMAKRGIDCLLLPANTGRWEQLQGDSRYLTTIGGFATEVF |
| Ga0070699_1016176412 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MSETELIPQLSLEERDRRYRNVRREMARRGIECLLLPANSGRW |
| Ga0066698_105956541 | 3300005558 | Soil | MASDILIPQLTLEERDRRYRKAREAMAAAGIDCFLLPANSGRWEQ |
| Ga0066699_111380482 | 3300005561 | Soil | MNIMIPQLSIQERDRRYQIVRAEMGKRGIDCLLLPANTGRWEQLQGDSRY |
| Ga0066706_105376092 | 3300005598 | Soil | MQIPQLSLEERDRRYKKVRTEMARSNIDCLLLPANTGRWEQLQADS |
| Ga0066905_1007707941 | 3300005713 | Tropical Forest Soil | MIPQLSIQERDRRYKIVRAEMAKRGIDVLLLPANTGRWEQLQGDSRYL |
| Ga0066905_1009530781 | 3300005713 | Tropical Forest Soil | MIPQLSIEERDRRYKNVRREMAKRGIDCLLLPANTGRWEQLQG |
| Ga0068860_1008685412 | 3300005843 | Switchgrass Rhizosphere | MNIPQLSIQERDRRYKIVRAEMVKRGIDCLLLPANTGRWEQLQGDSRYL |
| Ga0068860_1025726361 | 3300005843 | Switchgrass Rhizosphere | MIPQLSIQERDRRYQKVRAEMTRRGVDVLLLPANTGRW |
| Ga0075428_1005037741 | 3300006844 | Populus Rhizosphere | MIPQLSIEERDRRYKIVRAEMATRGIDCLLLPANTGRWEQLQGDSR |
| Ga0075421_1020517011 | 3300006845 | Populus Rhizosphere | MIPQLTLQERDRRYKIVRDEMVKRSIDVLILPANTGRWEQLQGDSRYLTSIG |
| Ga0075421_1020683402 | 3300006845 | Populus Rhizosphere | MIPQLSIQERDRRYKTVRAEMAKLGIDVLLLPANTGRWEQL |
| Ga0075431_1017373531 | 3300006847 | Populus Rhizosphere | MIPQLSIQERDRRYKIVKAEMAKRGIDCLLLPANTGRWEQLQ |
| Ga0075433_110672362 | 3300006852 | Populus Rhizosphere | MIPQLSIQERDRRYQNVRAEMAKLGIDCLLLPANTGRWEQLQGDSRYLTTIGGFATE |
| Ga0075420_1010715042 | 3300006853 | Populus Rhizosphere | MIPQLSIEERDRRYRIVRTEMAQRNIDVLLLPANTGRWEQLQGDSRYLTSIGGFSTEVF |
| Ga0075425_1025904262 | 3300006854 | Populus Rhizosphere | MIPQLSIKERDRRYKIVRAEMATRGIDCLLLPANTGRWE |
| Ga0075434_1021176321 | 3300006871 | Populus Rhizosphere | MIPQLSIQERDRRYKTVRAEMAKLGIDVLLLPANTGRWEQLQG |
| Ga0075429_1015579112 | 3300006880 | Populus Rhizosphere | MIPQLSIQERDRRYKIVRAEMAKHGIDCLLLPANTG |
| Ga0075426_113015482 | 3300006903 | Populus Rhizosphere | MIPQLSIEERDRRYKIVRAEMATRGIDCLLLPANTGRWEQLQGDSRYLTTI |
| Ga0075424_1023139291 | 3300006904 | Populus Rhizosphere | MIPQLSIKERDRRYKIVRAEMATRGIDCLLLPANT |
| Ga0075436_1010138941 | 3300006914 | Populus Rhizosphere | MIPQLSLQERDRRYDKVRAEMARQGIDCLLLPANTGRWE |
| Ga0079216_119561531 | 3300006918 | Agricultural Soil | MIPQLSIQERDRRYKLVRAEMAKRGIDVLLLPANTGRWEQLQGDSRYLT |
| Ga0079219_124817892 | 3300006954 | Agricultural Soil | MSIPQLSIEERDRRYKKVRAEMAQSNIDVLLLPANTG |
| Ga0075418_112662381 | 3300009100 | Populus Rhizosphere | MIPQLSIEERDRRYKIVRAEMVQRNIDVLLLPANTGRWEQLQGDSRYLTSIGG |
| Ga0105247_114877871 | 3300009101 | Switchgrass Rhizosphere | MGIPQLSIEERDRRYKVVRAEMAQRNIDVLLLPANTGRWEQLQGDSRYL |
| Ga0075423_115667592 | 3300009162 | Populus Rhizosphere | MIPQLSIQERDRRYKLVRAEMAKRGIDVLLLPANTGRWEQLQGDSRYLTNIGGFATEMFTIFP |
| Ga0105347_12538301 | 3300009609 | Soil | MIPQLSIQERDRRYKIVRAEMAKRGIDVLLAPANTGRWEQLQGDS |
| Ga0126380_112116762 | 3300010043 | Tropical Forest Soil | METDLIPQLSLEERDRRYKKVREEMLQRGIDVLLLPANSGRWEQL |
| Ga0126380_117923272 | 3300010043 | Tropical Forest Soil | MIPQLSIQERDRRYKIVRAEMAKRGIDVLLLPANTGRWEQLQGDSRYLTTIGGFA |
| Ga0126382_121869032 | 3300010047 | Tropical Forest Soil | MIPELSIEERDRRYKIVRAEMAQRGIDCLLLPANTGRWEQLQGDSRYLTTIGGFATEVFTVF |
| Ga0134088_106276451 | 3300010304 | Grasslands Soil | MASDILIPQLNLEERDRRYRKAREAMAAAGIDYFLLPANSGRWEQLQA |
| Ga0126376_125620841 | 3300010359 | Tropical Forest Soil | MIPQLSIQERDRRYKIVRAEMAKRNIDVLLLPANTG |
| Ga0137340_11150952 | 3300011405 | Soil | MIPQLSIQERDRRYQLVRAEMAKRGIDVLLLPANT |
| Ga0137326_10849152 | 3300011417 | Soil | MIPQLSIQERDRRYKVVRAEMAQHGIDCLLLPANTGRWE |
| Ga0137448_11311991 | 3300011427 | Soil | MLIPQLSIEERDRRYKIVRAEMAKRGIDCLVLPANTGRWEQMQGDSRYLTSIGGFATEVFTVFP |
| Ga0137452_11262931 | 3300011441 | Soil | MIPQLSIQERDRRYKIVRAEMAKRGIDVLLLPANTGRWEQLQGDSRYLT |
| Ga0120191_100122802 | 3300012022 | Terrestrial | MIPQLSIQERDRRYKIVRTEMAQCGIDCLLLPANTGRWEQLQGDSRYLTTIGGFATQVFPVF |
| Ga0137445_10188041 | 3300012035 | Soil | MMIPQLSIQERDRRYKIVRAEMAKRGIDVLLLPANTGRWEQLQGDSRYLTSIG |
| Ga0137421_11331331 | 3300012039 | Soil | MIPQLSIQERDRRYQLVRAEMAKRGIDVLLLPANTGRWEQLQGDSRYLTSIGGFATE |
| Ga0137364_104575582 | 3300012198 | Vadose Zone Soil | MNIMIPQLSIQERDRRYQIVRAEMATRGIDCMLLPANTG |
| Ga0137387_111958232 | 3300012349 | Vadose Zone Soil | MIPQLSIEERDRRYKIVRAEMAERGIDCLLLPANTGRWEQLQGDSRYLTTIGGFATEVFTVFPRE |
| Ga0137366_107990831 | 3300012354 | Vadose Zone Soil | MIPQLSIQERDRRYRKVREEMARRSIDCLLLPANTGRWEQLQADSRYLTSIGGFATEV |
| Ga0157345_10495921 | 3300012498 | Arabidopsis Rhizosphere | MNIPQLSIQERDRRYKIVRAEMVKRSIDCLLLPANT |
| Ga0157352_10391191 | 3300012519 | Unplanted Soil | MNIPQLSIQERDRRYKIVRAEMVKRGIDCLLLPANTGRWEQLQGDSRY |
| Ga0157300_11087321 | 3300012884 | Soil | MGIPQLSIEERDRRYKVVRAEMAQRKIDVLLLPANTG |
| Ga0164309_117255032 | 3300012984 | Soil | MNIPQLSIQERDRRYKIVRAEMVKRGIDCLLLPANTGRWEQLQ |
| Ga0164306_113178001 | 3300012988 | Soil | MIPQLSIEERDRRYKIVRAEMVQRNIDVLLLPANTGRWEQLQGDSRYLTSIGGFATEVFTVF |
| Ga0157380_109994872 | 3300014326 | Switchgrass Rhizosphere | MIPQLSIQERDRRYKLVRAEMAKRGIDVLLLPANTGRWEQLQGDSRYLTNIGGFATE |
| Ga0180078_10819831 | 3300014865 | Soil | MMPQLSIQERDRRYKIVRAEMAGRGIDCLLLPANTGRWEQMQADS |
| Ga0137405_10943863 | 3300015053 | Vadose Zone Soil | MIPQLSIQERDRRYKIVRAEMARRGIDCLLLPANTGRWEQLQGDSRYL |
| Ga0180085_10319181 | 3300015259 | Soil | MIPLLSIQERDRRYKIVRAEMAKRGIDCLVLPANTGRWEQMQGDSRY |
| Ga0182007_103410321 | 3300015262 | Rhizosphere | MGIPQLSIEERDRRYKVVRAEMAQRNIDVLLLPANTGRWEQLQGDSR |
| Ga0132258_120945153 | 3300015371 | Arabidopsis Rhizosphere | MIPQLSIEERDRRYKIVRAEMAQRNIDVLLLPANTGRWEQLQGDSRYLTSIGGFATE |
| Ga0132257_1002804914 | 3300015373 | Arabidopsis Rhizosphere | MIPQLSIQERDRRYQKVRAEMTRRGVDVLLLPANTGRWEQLQGDSRYLTNIGGFATEMFT |
| Ga0134112_103094662 | 3300017656 | Grasslands Soil | MIPQLSIQERDRRYKIVRAEMARRGIDCLLLPANTG |
| Ga0163161_102592543 | 3300017792 | Switchgrass Rhizosphere | MGIPQLSIEERDRRYKVVRAEMAQRNIDVLLLPANTGRWEQL |
| Ga0187776_108199422 | 3300017966 | Tropical Peatland | MIPQLSIEERDRRYKIVRAEMAKRNIDVLLLPANTGRWEQ |
| Ga0184604_101063652 | 3300018000 | Groundwater Sediment | MIPQLSLQERDRRYQIVRAEMAKRGIDVLILPANTGRWEQLQG |
| Ga0184608_101346351 | 3300018028 | Groundwater Sediment | MIPQLSIQERDRRYRIVRAEMAKRGIDVLILPANTGRWEQLQGDSRYVTSIGG |
| Ga0184624_103409951 | 3300018073 | Groundwater Sediment | MIPQLSIEERDRRYKIVRAQMAQRGIDCLLLPANTGRWEQMQADSRYIS |
| Ga0184609_104588402 | 3300018076 | Groundwater Sediment | MSIPQLSIEERDRRYQNVRAEMARRGIDCLLLPANTGRWEQLQGDSRYITTIGGFATEVF |
| Ga0184625_100804601 | 3300018081 | Groundwater Sediment | MIPQLSIEERDRRYKIVRAQMAQRGIDCLLLPANTGRWEQMQADSR |
| Ga0184625_103720971 | 3300018081 | Groundwater Sediment | MSPQLAIEERDRRYKIVRAQMAQRGIDCLLLPANTGRWEQMQADSR |
| Ga0173481_100235451 | 3300019356 | Soil | MGIPQLSIEERDRRYKVVRAEMAQRKIDVLLLPANTGRWEQLQGD |
| Ga0137408_12817842 | 3300019789 | Vadose Zone Soil | MIPQLSIQERDRRYKIVKAEMAKRGIDCLLLPANTGRWEQLQGDSRYLTTIGGFATEV |
| Ga0193739_10292113 | 3300020003 | Soil | MIPQLSIEERDRRYKIVRTEMAKRGIDCLLLPANTGRWEQLQGDSRYLTTI |
| Ga0193755_10066304 | 3300020004 | Soil | MIPQLSIQERDRRYQMVRAEMAKRGIDVLILPANTGRWEQLQGVKAT |
| Ga0193735_10014881 | 3300020006 | Soil | MIPQLSIQERDRRYQMVRAEMAKRGIDVLILPANTGRWEQLQGDSRYL |
| Ga0193733_10179961 | 3300020022 | Soil | MIPQLSIQERDRRYQMVRAEMAKRGIDVLILPANTGRWEQLQGDSRYLTSIGGFATEVFTVFLR |
| Ga0163150_101411981 | 3300020195 | Freshwater Microbial Mat | MIPQLSIQERDRRYQLVRAEMAKRGIDVLLLPANTGRWEQLQGDSRYLTNIGGFAT |
| Ga0193736_10447871 | 3300021412 | Soil | MIPQLSIEERDRRYQLVRAEMAKRGIDVLLLPANTGRWEQLQGDSRYLTNIGGFA |
| Ga0126371_102890401 | 3300021560 | Tropical Forest Soil | MSIPQLSLQERDRRYQKVRAEMKRQGIDCLLLPANTG |
| Ga0224505_101038441 | 3300022214 | Sediment | MIPQLSIQERDRRYQLVRAEMAKRGIDVLLLPANTGRWEQLQGDSRYLTNIGGFATEMFTVF |
| Ga0210376_10622502 | 3300022385 | Estuarine | MIPQLSIQERDRRYQLVRGQMAKRGIDVLLLPANTGRWEQLQGDSRYLTNIGGFA |
| Ga0222623_102945742 | 3300022694 | Groundwater Sediment | MIPQLSIQERDRRYRIVRAEMAKRGIDVLILPANTGRWEQLQGDSRYVTSIGGFATEVFTVF |
| Ga0222622_108630592 | 3300022756 | Groundwater Sediment | MIPQLSIQERDRRYKIVRAEMAKRGIDVLLAPANTGRWEQLQG |
| Ga0207659_109957291 | 3300025926 | Miscanthus Rhizosphere | MIPQLSIQERDRRYKLVRAEMAKRGIDVLLLPANTGRWEQLQGDSRYLTNIGGFATEMFTVFP |
| Ga0207686_107177241 | 3300025934 | Miscanthus Rhizosphere | MIPQLSIQERDRRYQKVRAEMTRRGVDVLLLPANTGRWEQLQGDSRYLTNIGG |
| Ga0210066_10464892 | 3300025951 | Natural And Restored Wetlands | MVPQLSIQERDRRYQIVRAEMAKRGIDVLLLPANTGRWEQLQGDSR |
| Ga0210105_10775942 | 3300025966 | Natural And Restored Wetlands | MVPQLSIQERDRRYQLVRGEMAKRGIDVLLLPANTGRWEQLQ |
| Ga0210102_10394642 | 3300025971 | Natural And Restored Wetlands | MVPQLSIQERDRRYQIVRAEMAKRGIDVLLLPANTGRWEQLQGDSRYLTNIGGFATEMFT |
| Ga0207676_111518321 | 3300026095 | Switchgrass Rhizosphere | MGIPQLSIEERDRRYKVVRAEMAQRKIDVLLLPANTGRWEQLQGDSRYLTSIGGFATE |
| Ga0207675_1020667332 | 3300026118 | Switchgrass Rhizosphere | MGIPQLSIEERDRRYKVVRAEMAQSKIDVLLLPANTGR |
| Ga0209131_13129341 | 3300026320 | Grasslands Soil | MIPQLSIQERDRRYKNVRAEMAKRGIDVLLLPANTGRWEQLQGDSRYLTNIGGFATE |
| Ga0209470_13452632 | 3300026324 | Soil | MIPQLSIQERDRRYRKVREEMARRGIDCLLLPANTGRW |
| Ga0209803_11498001 | 3300026332 | Soil | MQIPQLSLEERDRRYKKVRTEMARSNIDCLLLPANTGRWEQLQADSRYLTSIGG |
| Ga0209376_13468011 | 3300026540 | Soil | MIPQLSIQERDRRYRKVREEMARSNIDCLLLPANTG |
| Ga0209161_104799571 | 3300026548 | Soil | MQIPQLSLEERDRRYKKVRTEMARSNIDCLLLPANTGR |
| Ga0209074_102315412 | 3300027787 | Agricultural Soil | MIPQLSIEERDRRYKIVRAEMAQRNIDVLLLPANTGRWEQLQGDSRYLTSIGGFATEV |
| Ga0209465_101927051 | 3300027874 | Tropical Forest Soil | MIPQLSLQERDRRYRVVRAEMAQRGIDCLLLPANTGRWEQLQG |
| Ga0247662_10749481 | 3300028293 | Soil | MIPQLSIQERDRRYKIVRAEMVKRGIDVLLLPANTGRWEQLQGD |
| Ga0307312_110501222 | 3300028828 | Soil | MIPQLSIQERDRRYQMVRAEMAKRGIDVLILPANTGRWEQLQGDSRYLTSIGGFAT |
| Ga0307308_102223992 | 3300028884 | Soil | MIPQLSIQERDRRYQMVRAEMAKRGIDVLILPANTGRWEQLQGD |
| Ga0307473_102974992 | 3300031820 | Hardwood Forest Soil | MIPQLSLQERDRRYDKVRAEMARQGIDCLLLPANTGRWEQLQGDSRYLTTIGGFAT |
| Ga0315281_108937591 | 3300032163 | Sediment | MIPQLSIEERDRRYKIVRAEMAKRGIDVLLLPANTGRWEQLQGDSRYLTSIGGFATE |
| Ga0307472_1001437251 | 3300032205 | Hardwood Forest Soil | MIPQLSIQERDRRYKIVKAEMAKRGIDCLLLPANTG |
| Ga0316620_113322162 | 3300033480 | Soil | MIPQISIQERDRRYQIVRAEMAKRGMDCLLLPANTGRWEQLQGDSRYLTTIGGFATEVF |
| Ga0316628_1043880981 | 3300033513 | Soil | MIPQLSIEERDRRYKSVRAEMAKRGMDCLLLPANTGRWEQLQGD |
| Ga0364933_089775_612_773 | 3300034150 | Sediment | MIPQLSIEERDRRYKIVRAQMAQRGIDCLLLPANTGRWEQMQADSRYISSIGGF |
| Ga0373958_0186190_365_535 | 3300034819 | Rhizosphere Soil | MIPQLSIEERDRRYKIVRAEMVQRNIDVLLLPANTGRWEQLQGDSRYLTSIGGFATE |
| ⦗Top⦘ |