


| Basic Information | |
|---|---|
| Family ID | F082314 |
| Family Type | Metagenome |
| Number of Sequences | 113 |
| Average Sequence Length | 41 residues |
| Representative Sequence | FPSSLRVIEKAMANALKFVDHPKAKQFDVRQSFDNSFVDEAMK |
| Number of Associated Samples | 100 |
| Number of Associated Scaffolds | 113 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.23 % |
| % of genes from short scaffolds (< 2000 bps) | 92.04 % |
| Associated GOLD sequencing projects | 96 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.23 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (94.690 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (12.389 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.549 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (44.248 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.07% β-sheet: 0.00% Coil/Unstructured: 54.93% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.23 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 113 Family Scaffolds |
|---|---|---|
| PF09084 | NMT1 | 21.24 |
| PF04392 | ABC_sub_bind | 18.58 |
| PF13379 | NMT1_2 | 2.65 |
| PF04480 | DUF559 | 1.77 |
| PF00211 | Guanylate_cyc | 1.77 |
| PF00072 | Response_reg | 0.88 |
| PF07883 | Cupin_2 | 0.88 |
| PF07992 | Pyr_redox_2 | 0.88 |
| PF02604 | PhdYeFM_antitox | 0.88 |
| PF13565 | HTH_32 | 0.88 |
| PF13546 | DDE_5 | 0.88 |
| PF04909 | Amidohydro_2 | 0.88 |
| PF08882 | Acetone_carb_G | 0.88 |
| PF14559 | TPR_19 | 0.88 |
| PF00872 | Transposase_mut | 0.88 |
| PF06277 | EutA | 0.88 |
| PF05977 | MFS_3 | 0.88 |
| PF00561 | Abhydrolase_1 | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
|---|---|---|---|
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 21.24 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 21.24 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 18.58 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 1.77 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.88 |
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 0.88 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.88 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.88 |
| COG4647 | Acetone carboxylase, gamma subunit | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.88 |
| COG4819 | Ethanolamine utilization protein EutA, possible chaperonin | Amino acid transport and metabolism [E] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 94.69 % |
| Unclassified | root | N/A | 5.31 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000890|JGI11643J12802_11506039 | All Organisms → cellular organisms → Bacteria | 1046 | Open in IMG/M |
| 3300004281|Ga0066397_10010423 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1184 | Open in IMG/M |
| 3300005166|Ga0066674_10401363 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300005289|Ga0065704_10154020 | All Organisms → cellular organisms → Bacteria | 1405 | Open in IMG/M |
| 3300005332|Ga0066388_104718543 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 693 | Open in IMG/M |
| 3300005458|Ga0070681_11816592 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 536 | Open in IMG/M |
| 3300005471|Ga0070698_101210080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 705 | Open in IMG/M |
| 3300005535|Ga0070684_102322831 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300005540|Ga0066697_10508390 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300005556|Ga0066707_10022203 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3388 | Open in IMG/M |
| 3300005614|Ga0068856_101582894 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300005713|Ga0066905_101051976 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 720 | Open in IMG/M |
| 3300005718|Ga0068866_10403319 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 882 | Open in IMG/M |
| 3300005764|Ga0066903_106338911 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300005884|Ga0075291_1051842 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300006844|Ga0075428_101183852 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 806 | Open in IMG/M |
| 3300006845|Ga0075421_101241584 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 829 | Open in IMG/M |
| 3300006852|Ga0075433_10406255 | All Organisms → cellular organisms → Bacteria | 1201 | Open in IMG/M |
| 3300006903|Ga0075426_10140492 | All Organisms → cellular organisms → Bacteria | 1740 | Open in IMG/M |
| 3300006904|Ga0075424_100766657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1030 | Open in IMG/M |
| 3300006904|Ga0075424_101162483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 822 | Open in IMG/M |
| 3300006904|Ga0075424_101644408 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300009094|Ga0111539_11177459 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
| 3300009100|Ga0075418_12290426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 589 | Open in IMG/M |
| 3300009143|Ga0099792_11126550 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 530 | Open in IMG/M |
| 3300009156|Ga0111538_12848916 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300009157|Ga0105092_10032963 | All Organisms → cellular organisms → Bacteria | 2751 | Open in IMG/M |
| 3300009162|Ga0075423_10303022 | All Organisms → cellular organisms → Bacteria | 1675 | Open in IMG/M |
| 3300009162|Ga0075423_11942195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 636 | Open in IMG/M |
| 3300009810|Ga0105088_1103450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 529 | Open in IMG/M |
| 3300009837|Ga0105058_1077827 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 762 | Open in IMG/M |
| 3300010043|Ga0126380_10333017 | All Organisms → cellular organisms → Bacteria | 1096 | Open in IMG/M |
| 3300010043|Ga0126380_11674659 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 570 | Open in IMG/M |
| 3300010046|Ga0126384_11740353 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300010046|Ga0126384_11843374 | Not Available | 575 | Open in IMG/M |
| 3300010322|Ga0134084_10227140 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 664 | Open in IMG/M |
| 3300010366|Ga0126379_10565351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1218 | Open in IMG/M |
| 3300010399|Ga0134127_10910129 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 935 | Open in IMG/M |
| 3300011269|Ga0137392_11598032 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 510 | Open in IMG/M |
| 3300011444|Ga0137463_1168871 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
| 3300012152|Ga0137347_1028305 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300012349|Ga0137387_10350776 | Not Available | 1068 | Open in IMG/M |
| 3300012359|Ga0137385_11038894 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 675 | Open in IMG/M |
| 3300012360|Ga0137375_10895731 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300012902|Ga0157291_10249494 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300012929|Ga0137404_10113026 | All Organisms → cellular organisms → Bacteria | 2209 | Open in IMG/M |
| 3300012930|Ga0137407_10975465 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300012960|Ga0164301_10471636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 898 | Open in IMG/M |
| 3300013297|Ga0157378_10524511 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1186 | Open in IMG/M |
| 3300013306|Ga0163162_12618792 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300014876|Ga0180064_1048992 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 845 | Open in IMG/M |
| 3300014878|Ga0180065_1075447 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300014884|Ga0180104_1181382 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300014885|Ga0180063_1207872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 629 | Open in IMG/M |
| 3300015077|Ga0173483_10537098 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300015254|Ga0180089_1091028 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300015372|Ga0132256_100267547 | All Organisms → cellular organisms → Bacteria | 1784 | Open in IMG/M |
| 3300015372|Ga0132256_101501907 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 784 | Open in IMG/M |
| 3300015372|Ga0132256_101544478 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300015372|Ga0132256_102705513 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300015373|Ga0132257_103791157 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300015374|Ga0132255_106356667 | Not Available | 500 | Open in IMG/M |
| 3300016294|Ga0182041_10529607 | All Organisms → cellular organisms → Bacteria | 1026 | Open in IMG/M |
| 3300018028|Ga0184608_10235615 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 805 | Open in IMG/M |
| 3300018056|Ga0184623_10220625 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
| 3300018056|Ga0184623_10419093 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300018063|Ga0184637_10126456 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1576 | Open in IMG/M |
| 3300018075|Ga0184632_10378705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 599 | Open in IMG/M |
| 3300018081|Ga0184625_10318236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 811 | Open in IMG/M |
| 3300018089|Ga0187774_11428233 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 508 | Open in IMG/M |
| 3300018422|Ga0190265_12805108 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300019882|Ga0193713_1176988 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RIFCSPLOWO2_12_FULL_60_19 | 557 | Open in IMG/M |
| 3300021081|Ga0210379_10105543 | All Organisms → cellular organisms → Bacteria | 1175 | Open in IMG/M |
| 3300021081|Ga0210379_10319341 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 680 | Open in IMG/M |
| 3300022563|Ga0212128_10097829 | All Organisms → cellular organisms → Bacteria | 1895 | Open in IMG/M |
| 3300022756|Ga0222622_11058984 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 596 | Open in IMG/M |
| 3300025537|Ga0210061_1088636 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 543 | Open in IMG/M |
| 3300025903|Ga0207680_10752308 | Not Available | 699 | Open in IMG/M |
| 3300025917|Ga0207660_10095704 | All Organisms → cellular organisms → Bacteria | 2209 | Open in IMG/M |
| 3300025919|Ga0207657_10030472 | All Organisms → cellular organisms → Bacteria | 4896 | Open in IMG/M |
| 3300025922|Ga0207646_10430269 | All Organisms → cellular organisms → Bacteria | 1191 | Open in IMG/M |
| 3300025925|Ga0207650_10080564 | All Organisms → cellular organisms → Bacteria | 2469 | Open in IMG/M |
| 3300025925|Ga0207650_10772457 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 814 | Open in IMG/M |
| 3300025936|Ga0207670_11379952 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300025936|Ga0207670_11561567 | Not Available | 561 | Open in IMG/M |
| 3300025972|Ga0207668_11634765 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 582 | Open in IMG/M |
| 3300026014|Ga0208776_1026138 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300026088|Ga0207641_12080677 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300026307|Ga0209469_1002288 | All Organisms → cellular organisms → Bacteria | 9311 | Open in IMG/M |
| 3300026328|Ga0209802_1329772 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 504 | Open in IMG/M |
| 3300026523|Ga0209808_1048826 | All Organisms → cellular organisms → Bacteria | 1945 | Open in IMG/M |
| 3300027252|Ga0209973_1075673 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300027277|Ga0209846_1064329 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 551 | Open in IMG/M |
| 3300027364|Ga0209967_1015688 | All Organisms → cellular organisms → Bacteria | 1085 | Open in IMG/M |
| 3300027533|Ga0208185_1089716 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 724 | Open in IMG/M |
| 3300027875|Ga0209283_10531818 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300027903|Ga0209488_10942022 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 603 | Open in IMG/M |
| 3300027909|Ga0209382_10309579 | All Organisms → cellular organisms → Bacteria | 1779 | Open in IMG/M |
| 3300027909|Ga0209382_11051610 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300028828|Ga0307312_10123700 | All Organisms → cellular organisms → Bacteria | 1623 | Open in IMG/M |
| 3300031547|Ga0310887_11067092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 517 | Open in IMG/M |
| 3300031716|Ga0310813_10121449 | All Organisms → cellular organisms → Bacteria | 2063 | Open in IMG/M |
| 3300031720|Ga0307469_11486803 | Not Available | 648 | Open in IMG/M |
| 3300031740|Ga0307468_100525756 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
| 3300031890|Ga0306925_10977181 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300031949|Ga0214473_10935300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 921 | Open in IMG/M |
| 3300032001|Ga0306922_12067913 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300032013|Ga0310906_10484604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 834 | Open in IMG/M |
| 3300032180|Ga0307471_100077830 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → unclassified Marinobacter → Marinobacter sp. | 2899 | Open in IMG/M |
| 3300032205|Ga0307472_100236712 | All Organisms → cellular organisms → Bacteria | 1420 | Open in IMG/M |
| 3300032261|Ga0306920_101178171 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1108 | Open in IMG/M |
| 3300033417|Ga0214471_10596317 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300033433|Ga0326726_12465009 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 12.39% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.96% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 7.08% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.19% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.19% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 5.31% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.54% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.54% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.54% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.54% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 3.54% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.65% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 2.65% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 1.77% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.77% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.77% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.77% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.77% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.77% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.89% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.89% |
| Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 0.89% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.89% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.89% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.89% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.89% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300004281 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005884 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_302 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009810 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 | Environmental | Open in IMG/M |
| 3300009837 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
| 3300012152 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT590_2 | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012902 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1 | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014876 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200_16_10D | Environmental | Open in IMG/M |
| 3300014878 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200A_16_10D | Environmental | Open in IMG/M |
| 3300014884 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_1Da | Environmental | Open in IMG/M |
| 3300014885 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_10D | Environmental | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015254 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT860_16_10D | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300022563 | OV2_combined assembly | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025537 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026014 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_205 (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027277 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027533 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033417 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI11643J12802_115060392 | 3300000890 | Soil | KTLRTPEKAMANALKFIDHPKAKQYDVTQSFDNSLVNEGIK* |
| Ga0066397_100104231 | 3300004281 | Tropical Forest Soil | PSLKVIERAMANALKFVDHPKARQFDVRQSFDNSFIEEAMR* |
| Ga0066674_104013631 | 3300005166 | Soil | FSSTLKVTEKEMANALKFIEHPKAKQADAKQFYDNSLVDEAMKSF* |
| Ga0065704_101540202 | 3300005289 | Switchgrass Rhizosphere | AFSSTLRVVEKSMANALKFVEHPKAKGADVKQFYDNSLVDEVK* |
| Ga0066388_1047185432 | 3300005332 | Tropical Forest Soil | TLRVVEKSMANALKFVEHPKAKGADVKQFYDNSLVDEAMKQ* |
| Ga0070681_118165922 | 3300005458 | Corn Rhizosphere | PSSIRVIEKAMANALKFVEHPKAKQFDIRQSFDNSLVDEISK* |
| Ga0070698_1012100801 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | FPSSLRVIEKAMANALKFVDHPKAKQFDVRQSFDNSFVDEAMK* |
| Ga0070684_1023228311 | 3300005535 | Corn Rhizosphere | QSIRVNEKAMSNALKFVEHPKAKQFDVRQSFDNTFVDEAIK* |
| Ga0066697_105083901 | 3300005540 | Soil | IRVVEKAMANALKFVDHPKAKQYDVRQSYDNSYVDEAMK* |
| Ga0066707_100222031 | 3300005556 | Soil | STLKVTEKEMANALKFIEHPKAKQADAKQFYDNSLVDEAMKSF* |
| Ga0068856_1015828941 | 3300005614 | Corn Rhizosphere | KAMANALKFVEHPKAKQFDVRQSFDNSFVDEAMK* |
| Ga0066905_1010519762 | 3300005713 | Tropical Forest Soil | VEKSMANALKFVEHPKAKGADVKQFYDNSLVEEAMK* |
| Ga0068866_104033192 | 3300005718 | Miscanthus Rhizosphere | RVVEKSMANALKFVEHPKAKQYDVRQSFDNSLVDEAMR* |
| Ga0066903_1063389113 | 3300005764 | Tropical Forest Soil | YYRGAFPPSLKVIERAMANALKFVDHPKAKQFDVRQSFDNSFIDEAMK* |
| Ga0075291_10518421 | 3300005884 | Rice Paddy Soil | RTREKVMTNALKFIDHPKAKQYDVTQSFDNSLVDEIK* |
| Ga0075428_1011838521 | 3300006844 | Populus Rhizosphere | YYKDAFSPTLRVVEKAMANALKFVDHPKAKQFDVKQSFDNSLLDEAMKQ* |
| Ga0075421_1012415842 | 3300006845 | Populus Rhizosphere | FPASLRVIEKAMANALKFVDHPKAKQTDVKQSFDNSYVDEAMKQ* |
| Ga0075433_104062551 | 3300006852 | Populus Rhizosphere | AEKAMANALKFVDHPKAKGTDVKQFYDNSLVEEAMR* |
| Ga0075426_101404921 | 3300006903 | Populus Rhizosphere | FPRNIRVNEKAMANALKFVEHPKAKQFDVRQSFDNSFVDEAMK* |
| Ga0075424_1007666571 | 3300006904 | Populus Rhizosphere | LRVIEKAMANALKFVDHPKAKQADVKQSFDNSYVDEAMKQ* |
| Ga0075424_1011624831 | 3300006904 | Populus Rhizosphere | EEKSFTNMLRFLEHPKAKQVDPRQFFDNSLVEEISKRN* |
| Ga0075424_1016444082 | 3300006904 | Populus Rhizosphere | IRVNEKAMANALKFVEHPKAKQFDVRQSFDNSFVDEAMK* |
| Ga0111539_111774591 | 3300009094 | Populus Rhizosphere | ERAMANALKFIDHPKARQFDVRQSFDNSFIDEAMR* |
| Ga0075418_122904261 | 3300009100 | Populus Rhizosphere | RVIEKAMANALKFVDHPKAKQADIKQTFDNSFVDEAIK* |
| Ga0099792_111265502 | 3300009143 | Vadose Zone Soil | LRVIEKAMANALKFVDHPKAKQADIKQTFDNSFVDEAIK* |
| Ga0111538_128489161 | 3300009156 | Populus Rhizosphere | IERAMANALKFVDHPKARQFDVRQSFDNSFIDEAMR* |
| Ga0105092_100329634 | 3300009157 | Freshwater Sediment | DAFSPTLRTVEKSMANALKFVEHPKAKGADAKQFYDNSLVEEAMR* |
| Ga0075423_103030221 | 3300009162 | Populus Rhizosphere | RAMVNALKFIDHPKARQFDVRQSFDNSFIDEAMR* |
| Ga0075423_119421952 | 3300009162 | Populus Rhizosphere | AEKAMANALKFVDHPKAKGVDVKQFYDNSLVDEAIK* |
| Ga0105088_11034501 | 3300009810 | Groundwater Sand | SNLKVVEKSMANALKFVEHPKAKGADVKQFYDNSLVEEAMK* |
| Ga0105058_10778272 | 3300009837 | Groundwater Sand | RVVEKAMANALKFVEHPKAKGADVKQFYDNSLVEEAMR* |
| Ga0126380_103330172 | 3300010043 | Tropical Forest Soil | VEKSMANALKFVEHPKAKGADVKQFYDNSIVDEAMKQ* |
| Ga0126380_116746592 | 3300010043 | Tropical Forest Soil | VRPGGGRVIDKAKANALKFVDHPKAKQADVKQSFDNTFVDEAMQQ* |
| Ga0126384_117403531 | 3300010046 | Tropical Forest Soil | RAMANALKFVDHPKAKQFDVRQSFDNSFIGDAMK* |
| Ga0126384_118433742 | 3300010046 | Tropical Forest Soil | YYKDAFPSSLRVIEKAMANALKFVDHPKAKQADVKQSFDNRYVDEAMKQ* |
| Ga0134084_102271401 | 3300010322 | Grasslands Soil | KEMANALKFIEHPKAKQADAKQFYDNSLVDEAMKSF* |
| Ga0126379_105653511 | 3300010366 | Tropical Forest Soil | RAMANALKFVDHPKARQFDVRQSFDNSFIDEAMR* |
| Ga0134127_109101291 | 3300010399 | Terrestrial Soil | FPASLRVLEKAMSNALKFIDHPKAKQFDVRQSFDNSFVDEAIK* |
| Ga0137392_115980322 | 3300011269 | Vadose Zone Soil | YYKDAFPSSLRVIEKAMANALKFIDHPKAKQFDVKQSFDNSLVDEAMRQ* |
| Ga0137463_11688712 | 3300011444 | Soil | RVIERAMANALKFIDHPKARQFDVRQSFDNSFIDEAMR* |
| Ga0137347_10283052 | 3300012152 | Soil | LRTPESAMVNALKFLDHPKAKQADAKQSFDNSLVEEAMR* |
| Ga0137387_103507762 | 3300012349 | Vadose Zone Soil | SNTLKVTEKEMANALKFIEHPKAKQADAKQFYDNSLVLLCQ* |
| Ga0137385_110388941 | 3300012359 | Vadose Zone Soil | RTAEKSMANALKFVDHPKEKGADVKQFYDNSLVEEAMK* |
| Ga0137375_108957311 | 3300012360 | Vadose Zone Soil | KDAFPSSLRVIEKAMANALKFVDHPKAKQFDVRQSFDNSFVDEAIK* |
| Ga0157291_102494942 | 3300012902 | Soil | RVNEKAMANALKFVEHPKAKQFDVRQSFDNSFVDEAMK* |
| Ga0137404_101130263 | 3300012929 | Vadose Zone Soil | FPSSLRVIEKAMANALKFVDHPKAKEFDVRQSFDNSFVDEAMK* |
| Ga0137407_109754651 | 3300012930 | Vadose Zone Soil | PPSLRVIERAMANALKFVDHPKAKQFDVRQSFDNSFIDEAMR* |
| Ga0164301_104716361 | 3300012960 | Soil | YYREAFPQSIRVNEKAMSNALKFVEHPKAKQFDVRQSFDNTFVDEAIK* |
| Ga0157378_105245111 | 3300013297 | Miscanthus Rhizosphere | ATPDKAMTNALKFVEHPKAKGYDVRQSFDNALVNEIK* |
| Ga0163162_126187921 | 3300013306 | Switchgrass Rhizosphere | RDAFPPSLRVIERAMANALKFIDHPKARQFDVRQSFDNSFIDEAMR* |
| Ga0180064_10489924 | 3300014876 | Soil | DAFPKTLRVEEKAMANALKFVDHPKAKGADVRQFFDNSLVEEAMK* |
| Ga0180065_10754471 | 3300014878 | Soil | VEEKAMANAQKFVEHPKAKGADVKQFYDNSLVEEAMK* |
| Ga0180104_11813821 | 3300014884 | Soil | NTLRTPEKAMANALKFVDHPKAKGADVKQSFDNSMVDEAFK* |
| Ga0180063_12078721 | 3300014885 | Soil | IEKAMANALKFVEHPKAKGADVRQSFDNSFVDEAMR* |
| Ga0173483_105370981 | 3300015077 | Soil | NEKAMANALKFVEHPKAKQFDVRQSFDNSFVDEAMK* |
| Ga0180089_10910281 | 3300015254 | Soil | TLRVIEKAMANALKFVDHPKAKGSDVRQSFDNNFVDEAMRQ* |
| Ga0132256_1002675471 | 3300015372 | Arabidopsis Rhizosphere | YRDAFPPSLRVIERAMANALKFIDHPKARQFDVRQSFDNSFIDEAMR* |
| Ga0132256_1015019072 | 3300015372 | Arabidopsis Rhizosphere | EYYREAFPRSIRVNEKAMSNALKFVEHPKAKQFDVRQSFDNTFVDEAIK* |
| Ga0132256_1015444782 | 3300015372 | Arabidopsis Rhizosphere | SLKVIERAMANALKFVDHPKARQFDVRQSFDNSLIDEAMR* |
| Ga0132256_1027055131 | 3300015372 | Arabidopsis Rhizosphere | SERAMANALKFIDHPKARQFDVRQSFDNSFIDEAMR* |
| Ga0132257_1037911572 | 3300015373 | Arabidopsis Rhizosphere | YREAFPNTLRTPEKAMANALKFVDHPKAKQADVKQSFDNSLVDEAIK* |
| Ga0132255_1063566671 | 3300015374 | Arabidopsis Rhizosphere | SAFPPSLKVIERAMANALKFVDHPKARQFDVRQSFDNSFIDEALK* |
| Ga0182041_105296071 | 3300016294 | Soil | FPSSLRVIEKAMANALKFVDHPKAKQFDVRQSFDNSFVDEAMRQ |
| Ga0184608_102356153 | 3300018028 | Groundwater Sediment | FYREAFPSTLRTPEKAMANALKFVDHPKAKQADVKQSFDNSLVDEAIK |
| Ga0184623_102206251 | 3300018056 | Groundwater Sediment | SSLRVIEKAMANALKFIEHPKAKQFDVRQSFDNSYVEEAMK |
| Ga0184623_104190932 | 3300018056 | Groundwater Sediment | TLRTPEKAMANALKFIDHPKAKQYDVRQSFDNSFVDEAMKQ |
| Ga0184637_101264561 | 3300018063 | Groundwater Sediment | EKAIANALRFLDHPKAKGADPKQFYDNSLVDEAIK |
| Ga0184632_103787052 | 3300018075 | Groundwater Sediment | AFPSTLRTAEKSMANALKFVDHPKAKGADVKQFYDNSLVDEAMR |
| Ga0184625_103182361 | 3300018081 | Groundwater Sediment | LRVVEKSMANALKFVEHPKAKGADVKQFYDNSLVDEAMK |
| Ga0187774_114282332 | 3300018089 | Tropical Peatland | SLRVIEKAMANALKFVDHPKAKQADVKQSFDNSYVDEAMKQ |
| Ga0190265_128051082 | 3300018422 | Soil | VEYFCDVFPKTLTTTEKAMANALKFIDHPKAKQYDVTQSFDNSLVAEAIK |
| Ga0193713_11769881 | 3300019882 | Soil | YKDAFPSSLRVIEKAMANALKFVDHSKAKQFDVKQSFDNSFVDEATK |
| Ga0210379_101055433 | 3300021081 | Groundwater Sediment | IERAMANALKFVDHPKARQFDVRQSFDNSFIDEAMR |
| Ga0210379_103193412 | 3300021081 | Groundwater Sediment | FPPSLRVIEKAMANALKFVEHPKAKGADVRQSFDNSFVEEAMR |
| Ga0212128_100978291 | 3300022563 | Thermal Springs | TEPKIIANALKFLDHPKAKQADPTQFYDNSLVEEAIK |
| Ga0222622_110589841 | 3300022756 | Groundwater Sediment | SLRVIEKAMANALKFVDHPKAKQADVKQSFDNTYVDEAMKQ |
| Ga0210061_10886361 | 3300025537 | Natural And Restored Wetlands | RVVDKAMVNALKFVDHPKAKTADVKQSYDNRYVDEALK |
| Ga0207680_107523083 | 3300025903 | Switchgrass Rhizosphere | SAFPPSLKVIERAMANALKFVDHPKARQFDVRQSFDNSFIDEALK |
| Ga0207660_100957041 | 3300025917 | Corn Rhizosphere | FPSSIRVIEKAMANALKFVEHPKAKQFDIRQSFDNSLVDEISK |
| Ga0207657_100304721 | 3300025919 | Corn Rhizosphere | ERAMANALKFVDHPKARQFDVRQSFDNSFIDEAMR |
| Ga0207646_104302691 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | SSLKVVEKAMANALKFIDHPKAKQFDVKQSFDNSLVDEMMK |
| Ga0207650_100805641 | 3300025925 | Switchgrass Rhizosphere | RVNEKAMANALKFVEHPKAKQFDVRQSFDNSFVDEAMK |
| Ga0207650_107724572 | 3300025925 | Switchgrass Rhizosphere | IRVNEKAMANALKFVEHPKAKQFDVRQSFDNTFVDEAIK |
| Ga0207670_113799522 | 3300025936 | Switchgrass Rhizosphere | SIRVNEKAMANALKFVEHPKAKQFDVRQSFDNSFVDEAMK |
| Ga0207670_115615671 | 3300025936 | Switchgrass Rhizosphere | LSLKVNERAMANALKFVDHPKARQFDVRQSFDNSFIDEAMR |
| Ga0207668_116347651 | 3300025972 | Switchgrass Rhizosphere | YYRDAFPSSLRVIEKAMANALKFVDHPKAKQADIKQTFDNSFVDEAIK |
| Ga0208776_10261382 | 3300026014 | Rice Paddy Soil | PSTLRTREKVMTNALKFIDHPKAKQYDVTQSFDNSLVDEIK |
| Ga0207641_120806771 | 3300026088 | Switchgrass Rhizosphere | IERAMVNALKFIDHPKARQFDVRQSFDNSFIDEAMR |
| Ga0209469_10022888 | 3300026307 | Soil | KSAFSSTLKVTEKEMANALKFIEHPKAKQADAKQFYDNSLVDEAMKSF |
| Ga0209802_13297722 | 3300026328 | Soil | EKEMANALKFIEHTKAKQADPKQFYDNSLVDEAMKSF |
| Ga0209808_10488263 | 3300026523 | Soil | TEKEMANALKFIEHPKAKQADAKQFYDNSLVDEAMKSF |
| Ga0209973_10756731 | 3300027252 | Arabidopsis Thaliana Rhizosphere | STLRTREKVMTNALKFIDHPKAKQYDVTQSFDNSLVDEIK |
| Ga0209846_10643291 | 3300027277 | Groundwater Sand | SNLKVVEKSMANALKFVEHPKAKGADVKQFYDNSLVEEAMK |
| Ga0209967_10156882 | 3300027364 | Arabidopsis Thaliana Rhizosphere | REKVMTNALKFIDHPKAKQYDVTQSFDNSLVDEIK |
| Ga0208185_10897164 | 3300027533 | Soil | EKAMANAQKFVDHPKARGADVTQFYDKSLIEEAMK |
| Ga0209283_105318181 | 3300027875 | Vadose Zone Soil | FPSTLRTVEKTMANALKFIDHPKAKQADAKQFYDNSLVNEAMK |
| Ga0209488_109420222 | 3300027903 | Vadose Zone Soil | YRDAFPSSLRVIEKAMANALKFVDHPKAKQADIKQTFDNSFVDEAIK |
| Ga0209382_103095794 | 3300027909 | Populus Rhizosphere | RVIEKAMANALKFVDHPKAKQADIKQTFDNSFVDEAVR |
| Ga0209382_110516102 | 3300027909 | Populus Rhizosphere | AEKAMANALKFVDHPKAKGTDVKQFYDNSLVEEAMR |
| Ga0307312_101237001 | 3300028828 | Soil | YYKDAFPSSLRVIEKAMANALKFVDHSKTKQFDVKQSFDNSFVDEAMK |
| Ga0310887_110670921 | 3300031547 | Soil | YKSAFPNTLRTTEKSMANALKFVDHPKARGADVKQFYDNSLVEEAMK |
| Ga0310813_101214491 | 3300031716 | Soil | PSSIRVIEKAMANALKFVEHPKAKQFDIRQSFDNSLVDEISK |
| Ga0307469_114868032 | 3300031720 | Hardwood Forest Soil | RGAFPPSLKVTERAMANALKFVDHPKARQFDVRQSFDNSFIDEAMR |
| Ga0307468_1005257561 | 3300031740 | Hardwood Forest Soil | IERAMANALKFVDHPKAKQFDVRQSFDNSFIDEAMR |
| Ga0306925_109771812 | 3300031890 | Soil | RSIRVNEKAMANALKFVEHPKAKQFDVRQSFDNSFVDEAVK |
| Ga0214473_109353002 | 3300031949 | Soil | KDAFPPSLRVIEKAMANALKFVEHPKAKGADVRQSFDNSFVEEAMR |
| Ga0306922_120679131 | 3300032001 | Soil | RVIEKAMANALKFVDHPKAKQFDVRQLFDNNFVDEAMR |
| Ga0310906_104846041 | 3300032013 | Soil | NTLRTTEKSMANALKFVDHPKARGADVKQFYDNSLVEEAMK |
| Ga0307471_1000778303 | 3300032180 | Hardwood Forest Soil | AFPSSLRVIEKAMANALKFVDHPKAKQADVKQSFDNSYVDEAMKQ |
| Ga0307472_1002367122 | 3300032205 | Hardwood Forest Soil | FPSSLKVVEKAMANALKFIDHPKAKQFDVKQSFDNSLVDEMMK |
| Ga0306920_1011781712 | 3300032261 | Soil | VFSSSLRTTDKSMANALKFIDHPKAKQADLKQFYDNSLVDEAMR |
| Ga0214471_105963171 | 3300033417 | Soil | FPATLRTPEKAMANALKFIDHPKAKQFDVKQSFDNSLVDEAIK |
| Ga0326726_124650091 | 3300033433 | Peat Soil | YRGAFPPSLRVIERAMANALKFVDHPKAKQFDVRQSFDNSFIDEAMR |
| ⦗Top⦘ |