


| Basic Information | |
|---|---|
| Family ID | F082276 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 113 |
| Average Sequence Length | 45 residues |
| Representative Sequence | LLVVDEARKFRGMISVTDLLQVIASDHKARADMLEAFLFPQR |
| Number of Associated Samples | 102 |
| Number of Associated Scaffolds | 113 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.91 % |
| % of genes near scaffold ends (potentially truncated) | 92.04 % |
| % of genes from short scaffolds (< 2000 bps) | 86.73 % |
| Associated GOLD sequencing projects | 101 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (69.027 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (23.894 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.858 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.637 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 32.86% β-sheet: 10.00% Coil/Unstructured: 57.14% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 113 Family Scaffolds |
|---|---|---|
| PF07238 | PilZ | 29.20 |
| PF00158 | Sigma54_activat | 15.93 |
| PF02954 | HTH_8 | 6.19 |
| PF01161 | PBP | 2.65 |
| PF03793 | PASTA | 2.65 |
| PF00196 | GerE | 1.77 |
| PF03721 | UDPG_MGDP_dh_N | 1.77 |
| PF13727 | CoA_binding_3 | 0.88 |
| PF00571 | CBS | 0.88 |
| PF02965 | Met_synt_B12 | 0.88 |
| PF01938 | TRAM | 0.88 |
| PF13620 | CarboxypepD_reg | 0.88 |
| PF01842 | ACT | 0.88 |
| PF13414 | TPR_11 | 0.88 |
| PF13551 | HTH_29 | 0.88 |
| PF14376 | Haem_bd | 0.88 |
| PF00082 | Peptidase_S8 | 0.88 |
| PF07719 | TPR_2 | 0.88 |
| PF02518 | HATPase_c | 0.88 |
| PF07244 | POTRA | 0.88 |
| PF07690 | MFS_1 | 0.88 |
| PF14532 | Sigma54_activ_2 | 0.88 |
| PF01370 | Epimerase | 0.88 |
| PF05685 | Uma2 | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
|---|---|---|---|
| COG1881 | Uncharacterized conserved protein, phosphatidylethanolamine-binding protein (PEBP) family | General function prediction only [R] | 2.65 |
| COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 1.77 |
| COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 1.77 |
| COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 1.77 |
| COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 1.77 |
| COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 1.77 |
| COG1410 | Methionine synthase I, cobalamin-binding domain | Amino acid transport and metabolism [E] | 0.88 |
| COG4636 | Endonuclease, Uma2 family (restriction endonuclease fold) | General function prediction only [R] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 69.03 % |
| Unclassified | root | N/A | 30.97 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001867|JGI12627J18819_10053659 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1682 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100628708 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
| 3300003352|JGI26345J50200_1029592 | Not Available | 594 | Open in IMG/M |
| 3300004080|Ga0062385_10183368 | All Organisms → cellular organisms → Bacteria | 1114 | Open in IMG/M |
| 3300004082|Ga0062384_100257862 | All Organisms → cellular organisms → Bacteria | 1061 | Open in IMG/M |
| 3300004119|Ga0058887_1467110 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
| 3300004152|Ga0062386_101727028 | Not Available | 522 | Open in IMG/M |
| 3300004631|Ga0058899_12148743 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 694 | Open in IMG/M |
| 3300005167|Ga0066672_10091699 | All Organisms → cellular organisms → Bacteria | 1837 | Open in IMG/M |
| 3300005186|Ga0066676_11140593 | Not Available | 512 | Open in IMG/M |
| 3300005451|Ga0066681_10436801 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 804 | Open in IMG/M |
| 3300005602|Ga0070762_10460483 | Not Available | 828 | Open in IMG/M |
| 3300005602|Ga0070762_10651507 | Not Available | 703 | Open in IMG/M |
| 3300006854|Ga0075425_102140052 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 624 | Open in IMG/M |
| 3300009029|Ga0066793_10476693 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 714 | Open in IMG/M |
| 3300009088|Ga0099830_10398195 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1113 | Open in IMG/M |
| 3300009090|Ga0099827_10002987 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 9542 | Open in IMG/M |
| 3300009093|Ga0105240_11891436 | Not Available | 621 | Open in IMG/M |
| 3300009094|Ga0111539_11728337 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 725 | Open in IMG/M |
| 3300010048|Ga0126373_11981344 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300010343|Ga0074044_10797037 | Not Available | 617 | Open in IMG/M |
| 3300010359|Ga0126376_10699659 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 975 | Open in IMG/M |
| 3300010366|Ga0126379_13746381 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_64_15 | 509 | Open in IMG/M |
| 3300010398|Ga0126383_10977277 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 934 | Open in IMG/M |
| 3300010401|Ga0134121_10115404 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2264 | Open in IMG/M |
| 3300011120|Ga0150983_14987607 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
| 3300011269|Ga0137392_10587400 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 924 | Open in IMG/M |
| 3300011269|Ga0137392_10724793 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
| 3300012208|Ga0137376_10533555 | Not Available | 1017 | Open in IMG/M |
| 3300012357|Ga0137384_10231745 | Not Available | 1542 | Open in IMG/M |
| 3300012363|Ga0137390_10639164 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1030 | Open in IMG/M |
| 3300012902|Ga0157291_10309550 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300014155|Ga0181524_10351586 | Not Available | 656 | Open in IMG/M |
| 3300014495|Ga0182015_10994441 | Not Available | 521 | Open in IMG/M |
| 3300014968|Ga0157379_11762323 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 608 | Open in IMG/M |
| 3300016319|Ga0182033_10358409 | All Organisms → cellular organisms → Bacteria | 1222 | Open in IMG/M |
| 3300017822|Ga0187802_10444119 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
| 3300017934|Ga0187803_10132297 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 980 | Open in IMG/M |
| 3300017940|Ga0187853_10273543 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300017995|Ga0187816_10049065 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1760 | Open in IMG/M |
| 3300018022|Ga0187864_10305457 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 709 | Open in IMG/M |
| 3300018060|Ga0187765_10478401 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300018077|Ga0184633_10058459 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1967 | Open in IMG/M |
| 3300018086|Ga0187769_10049626 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2912 | Open in IMG/M |
| 3300018088|Ga0187771_11807007 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
| 3300020579|Ga0210407_10507424 | Not Available | 942 | Open in IMG/M |
| 3300020579|Ga0210407_10911785 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 673 | Open in IMG/M |
| 3300020579|Ga0210407_11270339 | Not Available | 551 | Open in IMG/M |
| 3300020581|Ga0210399_10089707 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2504 | Open in IMG/M |
| 3300020581|Ga0210399_11169657 | Not Available | 612 | Open in IMG/M |
| 3300021171|Ga0210405_10097493 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2319 | Open in IMG/M |
| 3300021171|Ga0210405_10664445 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
| 3300021178|Ga0210408_10183684 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1661 | Open in IMG/M |
| 3300021181|Ga0210388_10847383 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 790 | Open in IMG/M |
| 3300021407|Ga0210383_10486657 | All Organisms → cellular organisms → Bacteria | 1065 | Open in IMG/M |
| 3300021420|Ga0210394_10513502 | Not Available | 1054 | Open in IMG/M |
| 3300021420|Ga0210394_11442198 | Not Available | 584 | Open in IMG/M |
| 3300021432|Ga0210384_11377003 | Not Available | 610 | Open in IMG/M |
| 3300021433|Ga0210391_10108610 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2185 | Open in IMG/M |
| 3300021475|Ga0210392_10097559 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1926 | Open in IMG/M |
| 3300021476|Ga0187846_10081858 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1401 | Open in IMG/M |
| 3300021478|Ga0210402_10146243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2151 | Open in IMG/M |
| 3300021559|Ga0210409_11359859 | Not Available | 586 | Open in IMG/M |
| 3300022531|Ga0242660_1236085 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
| 3300023030|Ga0224561_1015606 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300027090|Ga0208604_1030530 | Not Available | 506 | Open in IMG/M |
| 3300027266|Ga0209215_1017913 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
| 3300027334|Ga0209529_1021341 | All Organisms → cellular organisms → Bacteria | 1098 | Open in IMG/M |
| 3300027576|Ga0209003_1076641 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 618 | Open in IMG/M |
| 3300027674|Ga0209118_1015641 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2488 | Open in IMG/M |
| 3300027846|Ga0209180_10055101 | All Organisms → cellular organisms → Bacteria | 2202 | Open in IMG/M |
| 3300027855|Ga0209693_10328143 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300027862|Ga0209701_10741535 | Not Available | 501 | Open in IMG/M |
| 3300027889|Ga0209380_10103833 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1644 | Open in IMG/M |
| 3300028047|Ga0209526_10409491 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
| 3300028792|Ga0307504_10412346 | Not Available | 534 | Open in IMG/M |
| 3300028906|Ga0308309_10209906 | All Organisms → cellular organisms → Bacteria | 1609 | Open in IMG/M |
| 3300028906|Ga0308309_11157576 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 668 | Open in IMG/M |
| 3300029951|Ga0311371_12456265 | Not Available | 532 | Open in IMG/M |
| 3300031040|Ga0265754_1011499 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 713 | Open in IMG/M |
| 3300031231|Ga0170824_121285506 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
| 3300031234|Ga0302325_10801462 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1330 | Open in IMG/M |
| 3300031242|Ga0265329_10067087 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1135 | Open in IMG/M |
| 3300031525|Ga0302326_10027850 | All Organisms → cellular organisms → Bacteria | 11388 | Open in IMG/M |
| 3300031708|Ga0310686_105545096 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2160 | Open in IMG/M |
| 3300031708|Ga0310686_116362716 | Not Available | 1530 | Open in IMG/M |
| 3300031718|Ga0307474_11521420 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300031753|Ga0307477_10590806 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 749 | Open in IMG/M |
| 3300031754|Ga0307475_10402367 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1100 | Open in IMG/M |
| 3300031793|Ga0318548_10333154 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 745 | Open in IMG/M |
| 3300031797|Ga0318550_10404924 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 660 | Open in IMG/M |
| 3300031820|Ga0307473_11088502 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
| 3300031959|Ga0318530_10374227 | Not Available | 590 | Open in IMG/M |
| 3300031962|Ga0307479_10147029 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2310 | Open in IMG/M |
| 3300032025|Ga0318507_10031610 | All Organisms → cellular organisms → Bacteria | 1979 | Open in IMG/M |
| 3300032042|Ga0318545_10372270 | Not Available | 515 | Open in IMG/M |
| 3300032055|Ga0318575_10680868 | Not Available | 520 | Open in IMG/M |
| 3300032060|Ga0318505_10158660 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1050 | Open in IMG/M |
| 3300032063|Ga0318504_10541284 | Not Available | 558 | Open in IMG/M |
| 3300032160|Ga0311301_10581613 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1623 | Open in IMG/M |
| 3300032160|Ga0311301_11529202 | Not Available | 819 | Open in IMG/M |
| 3300032401|Ga0315275_10597880 | Not Available | 1232 | Open in IMG/M |
| 3300032805|Ga0335078_10657790 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1308 | Open in IMG/M |
| 3300033158|Ga0335077_11887120 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
| 3300033475|Ga0310811_11143910 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 651 | Open in IMG/M |
| 3300033480|Ga0316620_11679257 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 629 | Open in IMG/M |
| 3300033977|Ga0314861_0204616 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 931 | Open in IMG/M |
| 3300033977|Ga0314861_0519200 | Not Available | 509 | Open in IMG/M |
| 3300034091|Ga0326724_0244080 | Not Available | 1033 | Open in IMG/M |
| 3300034282|Ga0370492_0316471 | Not Available | 633 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 23.89% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 9.73% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.19% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 5.31% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.42% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.54% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.54% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.65% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.65% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.65% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.65% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.77% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.77% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 1.77% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.77% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.89% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.89% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.89% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.89% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.89% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.89% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.89% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.89% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.89% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.89% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.89% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003352 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004119 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF210 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004631 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012902 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1 | Environmental | Open in IMG/M |
| 3300014155 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023030 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU2 | Environmental | Open in IMG/M |
| 3300027090 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF016 (SPAdes) | Environmental | Open in IMG/M |
| 3300027266 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027334 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027576 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300031040 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Host-Associated | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
| 3300033977 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75 | Environmental | Open in IMG/M |
| 3300034091 | Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00N | Environmental | Open in IMG/M |
| 3300034282 | Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12627J18819_100536591 | 3300001867 | Forest Soil | LRLMEQNGIYHLVVLDHEKGYQGMISVTDLLKLFASDQKARADMLEALIFPQR* |
| JGIcombinedJ26739_1006287082 | 3300002245 | Forest Soil | RLMEEHGIYHLVVLDHTKGFRGMISVTDLLQLFASDQKARADMLEALIFPQR* |
| JGI26345J50200_10295921 | 3300003352 | Bog Forest Soil | EQHGIYHLVVLDHAKGFRGMISVTDLLQLFASDQKARADMLEAMIFPQR* |
| Ga0062385_101833681 | 3300004080 | Bog Forest Soil | CLRLMDQHGIFHLLIVDHEKGFRGMISVTDLLELFASDQKARADMLEALIFPQR* |
| Ga0062384_1002578621 | 3300004082 | Bog Forest Soil | EDCLRLMEQHGIYHLVVLDHAQGFRGMISVTDLLQLFASDQKARADMLEAMMFPQR* |
| Ga0062593_1030016552 | 3300004114 | Soil | DEGGGYRGMLSVTDLLTVIASDEKSRADMLEAFLFERTSNS* |
| Ga0058887_14671102 | 3300004119 | Forest Soil | GIFHLLVVDNQGVFRGMLSVTDLLQVIASDEKSRADMLESLLFPQR* |
| Ga0062386_1017270281 | 3300004152 | Bog Forest Soil | IYHLVVLDHEKGYRGMISVTDLLQLFASDQKARADMLEALIFPQR* |
| Ga0058899_121487431 | 3300004631 | Forest Soil | FHLLVVDNQGVFRGMLSVTDLLQVIASDEKSRADMLESLLFPQR* |
| Ga0066672_100916993 | 3300005167 | Soil | IFHLLVVDHQGVFRGMISVTDLLQVIASDEKARADMLESLLFPQR* |
| Ga0066676_111405932 | 3300005186 | Soil | LVVDAAGAYRGMLSVSDLLKVIASDEKARADMLEAFVFERPSV* |
| Ga0066681_104368012 | 3300005451 | Soil | LLVIDHDGGFRGMLSVSDLLKVIASDEKARADMLEAFVFDRPTA* |
| Ga0070741_108061361 | 3300005529 | Surface Soil | DAGDRYRGMLSVTDLLTVIASDEKSRADMLEAFLFERTPAS* |
| Ga0070762_104604832 | 3300005602 | Soil | FHLIVTDDEKKFLGMISVKDLLWVIASDHKERADLMESFVFPQR* |
| Ga0070762_106515071 | 3300005602 | Soil | MEQHGIYHLVVLDHAKGFRGMISVTDLLQLFASDQKARADMLEALIFPQR* |
| Ga0075425_1021400521 | 3300006854 | Populus Rhizosphere | LVVDEGGAFRGMLSVSDLLKVIASDEKARADMLEAFVFERRPI* |
| Ga0066793_104766932 | 3300009029 | Prmafrost Soil | GRFLGMISVADLLQVIASDHKARADMFEAFVFPQR* |
| Ga0099830_103981952 | 3300009088 | Vadose Zone Soil | VVDQAQKYYGMLSVSDLLQVIASDHKARADMLEAFIFPQR* |
| Ga0099827_100029871 | 3300009090 | Vadose Zone Soil | HLLVVDQAQKYYGMLSVTDLLQVIASDHKARADMLEAFIFPQR* |
| Ga0105240_118914362 | 3300009093 | Corn Rhizosphere | GVFHLLVAGDSGRFLGMISVADLLQIIASDHKARADMFEAFAFPQR* |
| Ga0111539_117283372 | 3300009094 | Populus Rhizosphere | VDEGGGYRGMLSVTDLLTVIASDEKSRADMLEAFLFERTTGS* |
| Ga0126373_119813441 | 3300010048 | Tropical Forest Soil | GIYHLVVLDHEKGYQGMISVTDLLKLFASDQKARADMLEALIFPQR* |
| Ga0074044_107970371 | 3300010343 | Bog Forest Soil | LPVVDALETYRGMISAQDLLRVIASDEKARADMLESFLFSGR* |
| Ga0126376_106996591 | 3300010359 | Tropical Forest Soil | LLVVDEARKFRGMISVTDLLQVIASDHKARADMLEAFLFPQR* |
| Ga0126379_137463811 | 3300010366 | Tropical Forest Soil | HLLVVDKSGGYQGMLSVSDLLRVSASSEKARADLLEAFIFERGTT* |
| Ga0126383_109772772 | 3300010398 | Tropical Forest Soil | LVLDQSGGYRGMLSVTDLLSVIASDEKARADMLEAFVFERTPAR* |
| Ga0134121_101154043 | 3300010401 | Terrestrial Soil | LVVDATGAYRGMVSVTDMVTVIASDEKARADMLEAFVFERTSPP* |
| Ga0150983_149876071 | 3300011120 | Forest Soil | IFHLLVVDPQGVFRGMISVTDLLQVIASDQKARADMLESLLFPQR* |
| Ga0137392_105874001 | 3300011269 | Vadose Zone Soil | HLLVVDEKGAYRGMLSVSDLLQLIASDQKARADMLEAFIFPQR* |
| Ga0137392_107247932 | 3300011269 | Vadose Zone Soil | HLLVVDQAQKYYGMLSVSDLLQVIASDHKARADMLEAFIFPQR* |
| Ga0137376_105335553 | 3300012208 | Vadose Zone Soil | FHLLVVEDSGRYLGMISVADLLQVIASDHKARADMFEAFAFPQR* |
| Ga0137384_102317454 | 3300012357 | Vadose Zone Soil | VFHLLVREEQERYLGMISVADLLQVIASDHKARAHMFEAFVFPQR* |
| Ga0137390_106391643 | 3300012363 | Vadose Zone Soil | LMEKHGVFHLLVAEESGRFLGMISVADLLQVIASDHKARADMFEAFVFPQR* |
| Ga0157291_103095501 | 3300012902 | Soil | EQNGIFHLLVVDASGRYRGMLSVTDLVTVIASDEKARADMLEAFVFERTATR* |
| Ga0181524_103515861 | 3300014155 | Bog | LAVVDDREAYCGMISVQDLLRVIASDEKARADMLESFVFSPR* |
| Ga0182015_109944411 | 3300014495 | Palsa | HEIFHLLVVDAAGAFRGMISVADLLRLIASDHKARADMFEAMMFPQR* |
| Ga0157379_117623231 | 3300014968 | Switchgrass Rhizosphere | HLLVVDDAKGTYRGMISVTDLLTVIASDEKARADMLEAFLFERTQAS* |
| Ga0182033_103584092 | 3300016319 | Soil | LVVDEKDGYLGMISVQDLLKVIASDEKARADMLESFLFQQR |
| Ga0187802_104441191 | 3300017822 | Freshwater Sediment | RMEKHGIFHLLVVDSQGVFRGMISVTDLLQVIASDQKARADMLESLLFPQR |
| Ga0187803_101322972 | 3300017934 | Freshwater Sediment | GFYHLPVIDAKAGYRGMVSVKDLLKVIASDEKARADMLESFLFSPR |
| Ga0187853_102735432 | 3300017940 | Peatland | VLDHAKGFRGMISVTDLLRLFASDQKARADMLEALIFPQR |
| Ga0187816_100490654 | 3300017995 | Freshwater Sediment | HGVFHLLVAEESGRFLGMISVADLLQVIASDHKARADMFEAFAFPQR |
| Ga0187864_103054572 | 3300018022 | Peatland | VEEAERFLGMISVVDLLQVIVSDYKARVGMFDASLFPQR |
| Ga0187765_104784011 | 3300018060 | Tropical Peatland | LVVDEKGRFHGMISVADLLTVIASDEKARADLLEDLMFPKR |
| Ga0184633_100584593 | 3300018077 | Groundwater Sediment | LVVDAQYTFRGMISVTDLLRLIASDQKARADMLEAFIFPQH |
| Ga0187769_100496264 | 3300018086 | Tropical Peatland | MDQHGIFHLLLVDAEKGFRGMISVTDLLQLFASDQKARADMLEALIFPPR |
| Ga0187771_118070071 | 3300018088 | Tropical Peatland | LLVVDAAGTFRGMISVADLLQVIASDEKARADMLEALLFPQR |
| Ga0210407_105074241 | 3300020579 | Soil | HLVVVEESGRFLGMISVADLLKIIASDHKARADMFEAFAFPQR |
| Ga0210407_109117851 | 3300020579 | Soil | LRLMDQHGIFHLLIVDHEKGFRGMISVTDLLELFASDQKARADMLEALIFPQR |
| Ga0210407_112703391 | 3300020579 | Soil | IYHLVVLDHEKGYQGMISVTDLLKLFASDQKARADMLEALIFPQR |
| Ga0210399_100897075 | 3300020581 | Soil | ESGRFLGMISVADLLQVIASDHKARADMFEAFAFPQR |
| Ga0210399_111696571 | 3300020581 | Soil | GFHLLVAEEAGRFLGMISVADLLQVIASDHKARADLFEAFAFPQR |
| Ga0210395_110221842 | 3300020582 | Soil | LDHEKGYQGMISVTDLLKLFASDQKARADMLEALIFPQR |
| Ga0210405_100974931 | 3300021171 | Soil | VLDHEKGYQGMISVTDLLKLFASDQKARADMLEALIFPQR |
| Ga0210405_106644453 | 3300021171 | Soil | YHLVVLDHEKGYQGMISVTDLLKLFASDQKARADMLEALIFPQR |
| Ga0210408_101836841 | 3300021178 | Soil | YHLVVLDNEKGYRGMISVTDLLQLFASDQKARADMLEALIFPQR |
| Ga0210388_108473832 | 3300021181 | Soil | LMEEHGIYHLVVLDHAKGFRGMISVTDLLQLFASDQKARADMLEALIFPQR |
| Ga0210383_104866572 | 3300021407 | Soil | QHGIYHLVVLDHAKGFRGMISVTDLLQLFASDQKARADMLEALIFPQR |
| Ga0210394_105135021 | 3300021420 | Soil | GRFLGMISVADLLKVIASDHKARADMFEAFAFPQR |
| Ga0210394_114421981 | 3300021420 | Soil | GRFLGMISVADLLQVIASDHKARADMFEAFAFPQR |
| Ga0210384_113770031 | 3300021432 | Soil | FHLVVAEESGRFLGMISVADLLKIIASDHKARADMFEAFAFPQR |
| Ga0210391_101086104 | 3300021433 | Soil | KESGQFLGMISVADLLQVIASDHKARADMFESFAFPQR |
| Ga0210392_100975593 | 3300021475 | Soil | VVLEHEKGYQGMISVTDLLKLFASDQKARADMLEALIFPQR |
| Ga0187846_100818583 | 3300021476 | Biofilm | HLLVVGDKGSYQGMVSVHDLLKVIASDEKARADMLESFLFQQR |
| Ga0210402_101462431 | 3300021478 | Soil | LQKCLRLMKKRGDFQFLIEEESSRFLGMILVADFLQIIASDHAARAEMIEAFAFPQI |
| Ga0210409_113598592 | 3300021559 | Soil | GIYHLVVLDHEKGFRGMISVTDLLQLFASDQKARADMLEAMIFPQR |
| Ga0242660_12360852 | 3300022531 | Soil | MHGIFHLLVVDAQGVFRGMISVTDLLQVIASDQKARADMLESLLFPQR |
| Ga0224561_10156062 | 3300023030 | Soil | CLRLMNQHGIFHLLVVDREKGFRGMISVTDLLQLFASDQKARADMLEAFIFPQR |
| Ga0208604_10305301 | 3300027090 | Forest Soil | QHGIYHLVVLDHAKGFRGMISVTDLLQLFASDQKARADMLEAMIFPQR |
| Ga0209215_10179131 | 3300027266 | Forest Soil | MEQHGIYHLVVLDHEKGYQGMISVTDLLKLFASDQKARADMLEALIFPQR |
| Ga0209529_10213412 | 3300027334 | Forest Soil | IYHLVVLDNQKGYRGMISVTDLLQLFASDQKARADMLESLIFPQR |
| Ga0209003_10766411 | 3300027576 | Forest Soil | EQNGIYHLVVLDHEKGYQGMISVTDLLKLFASDQKARADMLEALIFPQR |
| Ga0209118_10156415 | 3300027674 | Forest Soil | SGRFLGMISVADLLKIIASDHKARADMFEAFAFPQR |
| Ga0209180_100551011 | 3300027846 | Vadose Zone Soil | YHLLVVDQAQKYYGMLSVSDLLQVIASDHKARADMLEAFIFPQR |
| Ga0209693_103281431 | 3300027855 | Soil | QHGIYHLVVLDHEKGYQGMISVTDLLKLFASDQKARADMLEALIFPQR |
| Ga0209701_107415351 | 3300027862 | Vadose Zone Soil | EEQGRYLGMISVADLLQVIASDHKARADMFEAFVFPQR |
| Ga0209380_101038332 | 3300027889 | Soil | CLRLMEQHSIYHLVVLDHEKGFRGMISVTDLLQLFASDQKARADMLESLIFPQR |
| Ga0209526_104094912 | 3300028047 | Forest Soil | IFHLLIVDHEKGFRGMISVTDLLELFASDQKARADMLEALIFPQR |
| Ga0307504_104123462 | 3300028792 | Soil | VVDDSGRYLGMISVADLLQVIASDHKARADMFEAFVFPQR |
| Ga0308309_102099061 | 3300028906 | Soil | IYHLVVLDHAKGFRGMISVTDLLQLFASDQKARADMLESLIFPQR |
| Ga0308309_111575761 | 3300028906 | Soil | IFHLLVVDNQGVFRGMLSVTDLLQVIASDEKSRADMLESLLFPQR |
| Ga0311371_124562652 | 3300029951 | Palsa | AEESGRFLGMISVADLLQIIASDHKARADMFEAFAFPQR |
| Ga0265754_10114991 | 3300031040 | Soil | LVVLDHAKGFRGMISVTDLLQLFASDQKARADMLEALIFPQR |
| Ga0170824_1212855061 | 3300031231 | Forest Soil | TYFYLLVVDNQGVFRGMLSVTDLLQVIASDEKSRADMLESLLFPQR |
| Ga0302325_108014621 | 3300031234 | Palsa | LMEKHGVFHLLVAEESGRFRGMISVADLLQVIASDHKARADMFEAFAFPQR |
| Ga0265329_100670871 | 3300031242 | Rhizosphere | EESGRYLGMISVADLLQVISSDHKARADMFEAFAFPQR |
| Ga0302326_1002785010 | 3300031525 | Palsa | HLLVVDENSRYYGMLSVSDLLQLIASDEKARADLLEDFMFPKR |
| Ga0310686_1055450963 | 3300031708 | Soil | VLDHAKGFRGMISVTDLLQLFASDQKSRADLLEALIFPQR |
| Ga0310686_1163627162 | 3300031708 | Soil | MEKHGVFHLLVAAESGRFLGMISVADLLQVIASDHKARADMFEAFAFPQR |
| Ga0307474_115214201 | 3300031718 | Hardwood Forest Soil | QNGIYHLVVLDHEKGYQGMISVTDLLKLFASDQKARADMLEALIFPQR |
| Ga0307477_105908061 | 3300031753 | Hardwood Forest Soil | HLLVVDNQGVFRGMLSVTDLLQVIASDEKSRADMLESLLFPQR |
| Ga0307475_104023671 | 3300031754 | Hardwood Forest Soil | KYGIFHLLVVDNQGVFRGMLSVTDLLQVIASDEKSRADMLESLLFPQR |
| Ga0318548_103331541 | 3300031793 | Soil | HGFYHLLVVGDKGAYQGMISVHDLLKVIASNEKARADMLESFLFQQR |
| Ga0318550_104049242 | 3300031797 | Soil | VVDAGGTYRGMLSVSDLLRVIASDEKARADMLEAFLFERTAGR |
| Ga0307473_110885021 | 3300031820 | Hardwood Forest Soil | YPLLVVDATGAYRGMVSVTDMVTVIASDEKARADMLEAFLFERTTHS |
| Ga0318530_103742272 | 3300031959 | Soil | GFYHLLVVGDKGAYQGMISVHDLLKVIASNEKARADMLESFLFQQR |
| Ga0307479_101470291 | 3300031962 | Hardwood Forest Soil | ILVVDEQGEYYGMISVTDLLQVIASDHKTRADMFEAFLIPQR |
| Ga0318507_100316103 | 3300032025 | Soil | LMDKHGFYHLLVVGDKGAYQGMISVHDLLKVIASNEKARADMLESFLFQQR |
| Ga0318545_103722701 | 3300032042 | Soil | YGFYHLLVVGDKGAYQGMISVHDLLKVIASNEKARADMLESFLFQQR |
| Ga0318575_106808682 | 3300032055 | Soil | HLLVVGDKGAYQGMISVHDLLKVIASNEKARADMLESFLFQQR |
| Ga0318505_101586602 | 3300032060 | Soil | YHLLVVDAGGSYRGMLSVSDLLRVIASDEKARADMLEAFLFERTAGR |
| Ga0318504_105412841 | 3300032063 | Soil | YHLLVVGDKGAYQGMISVHDLLKVIASNEKARADMLESFLFQQR |
| Ga0311301_105816131 | 3300032160 | Peatlands Soil | VFHLVVTEESGRFLGMISVADLLKIIASDHKARADMFEAFAFPQR |
| Ga0311301_115292022 | 3300032160 | Peatlands Soil | CLRRMENHAIFHLLVVDAAGVFRGMISVADLLRLIASDHKARADLFEAMMFPQR |
| Ga0315275_105978801 | 3300032401 | Sediment | DKHGIFHLAVVDSVQGYRGLISVQDLLKVIASDQKARADMLEAYMFPSR |
| Ga0335078_106577902 | 3300032805 | Soil | QHGIYHLLVVGGEGFRGMISVTDLLQLFASDQKARADMLEALIFPQR |
| Ga0335077_118871202 | 3300033158 | Soil | HLVVLDVDSKFQGMISVTDLLQVIASDHKERADLLEAFAFPPR |
| Ga0310811_111439101 | 3300033475 | Soil | YHLLVVDGQSRYRGMLSVTDLLTVIASDEKARADMLEAFLFERTAGQ |
| Ga0316620_116792572 | 3300033480 | Soil | LRLMEKHEIFHLLIVGETGNFLGMLSVADLLQVIASDHKARADMFEAFVFPQR |
| Ga0314861_0204616_645_797 | 3300033977 | Peatland | MEQHGIYHLVVVDSEKGFRGMISVTDLLQLFASDQKARADMLEALMFPQR |
| Ga0314861_0519200_28_183 | 3300033977 | Peatland | LLEKHRFFHLPVLDPQGNYRGMVSVKDLLKVIASNEKARADMLEAFMFPQR |
| Ga0326724_0244080_11_139 | 3300034091 | Peat Soil | LPVVDALETYRGMISAQDLLRVIASDEKARADMLESFLFSGR |
| Ga0370492_0316471_491_628 | 3300034282 | Untreated Peat Soil | VFHLLVAEESGRFRGMISVADLLQVISSDHKARADMFEAFAFPQR |
| ⦗Top⦘ |