


| Basic Information | |
|---|---|
| Family ID | F081913 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 114 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MKEVKLIKMQHDLKLTQQALVVALNRLEKLEKKVFPKEEDVK |
| Number of Associated Samples | 91 |
| Number of Associated Scaffolds | 114 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 5.26 % |
| % of genes near scaffold ends (potentially truncated) | 18.42 % |
| % of genes from short scaffolds (< 2000 bps) | 61.40 % |
| Associated GOLD sequencing projects | 80 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.56 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (37.719 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh (21.053 % of family members) |
| Environment Ontology (ENVO) | Unclassified (43.860 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (81.579 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.43% β-sheet: 0.00% Coil/Unstructured: 48.57% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 114 Family Scaffolds |
|---|---|---|
| PF12684 | DUF3799 | 29.82 |
| PF00145 | DNA_methylase | 3.51 |
| PF03819 | MazG | 2.63 |
| PF02195 | ParBc | 2.63 |
| PF04466 | Terminase_3 | 2.63 |
| PF08299 | Bac_DnaA_C | 2.63 |
| PF00303 | Thymidylat_synt | 1.75 |
| PF09568 | RE_MjaI | 1.75 |
| PF08291 | Peptidase_M15_3 | 0.88 |
| PF08241 | Methyltransf_11 | 0.88 |
| PF11325 | DUF3127 | 0.88 |
| PF03796 | DnaB_C | 0.88 |
| PF00291 | PALP | 0.88 |
| PF04404 | ERF | 0.88 |
| PF12851 | Tet_JBP | 0.88 |
| PF13649 | Methyltransf_25 | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 114 Family Scaffolds |
|---|---|---|---|
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 3.51 |
| COG0593 | Chromosomal replication initiation ATPase DnaA | Replication, recombination and repair [L] | 2.63 |
| COG1783 | Phage terminase large subunit | Mobilome: prophages, transposons [X] | 2.63 |
| COG0207 | Thymidylate synthase | Nucleotide transport and metabolism [F] | 1.75 |
| COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 0.88 |
| COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 62.28 % |
| Unclassified | root | N/A | 37.72 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000116|DelMOSpr2010_c10000855 | Not Available | 19139 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10025606 | All Organisms → Viruses → Predicted Viral | 2811 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10153728 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 784 | Open in IMG/M |
| 3300000947|BBAY92_10008595 | All Organisms → Viruses → Predicted Viral | 2708 | Open in IMG/M |
| 3300001419|JGI11705J14877_10146469 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 644 | Open in IMG/M |
| 3300001934|GOS2267_100098 | All Organisms → Viruses → Predicted Viral | 1857 | Open in IMG/M |
| 3300001938|GOS2221_1000087 | All Organisms → Viruses → Predicted Viral | 1561 | Open in IMG/M |
| 3300003427|JGI26084J50262_1023977 | All Organisms → Viruses → Predicted Viral | 1845 | Open in IMG/M |
| 3300005512|Ga0074648_1020531 | All Organisms → Viruses → Predicted Viral | 3721 | Open in IMG/M |
| 3300005747|Ga0076924_1032039 | Not Available | 10633 | Open in IMG/M |
| 3300005747|Ga0076924_1077077 | All Organisms → Viruses → Predicted Viral | 3795 | Open in IMG/M |
| 3300005748|Ga0076925_1031986 | Not Available | 634 | Open in IMG/M |
| 3300006752|Ga0098048_1161804 | Not Available | 666 | Open in IMG/M |
| 3300006802|Ga0070749_10428410 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 727 | Open in IMG/M |
| 3300006810|Ga0070754_10005605 | Not Available | 8439 | Open in IMG/M |
| 3300006810|Ga0070754_10010693 | Not Available | 5779 | Open in IMG/M |
| 3300006874|Ga0075475_10307068 | Not Available | 653 | Open in IMG/M |
| 3300006916|Ga0070750_10002739 | Not Available | 9796 | Open in IMG/M |
| 3300006916|Ga0070750_10005275 | Not Available | 7020 | Open in IMG/M |
| 3300006919|Ga0070746_10011058 | Not Available | 5107 | Open in IMG/M |
| 3300006919|Ga0070746_10409991 | Not Available | 606 | Open in IMG/M |
| 3300006990|Ga0098046_1006074 | All Organisms → Viruses → Predicted Viral | 3544 | Open in IMG/M |
| 3300007234|Ga0075460_10074144 | All Organisms → Viruses → Predicted Viral | 1248 | Open in IMG/M |
| 3300007538|Ga0099851_1000206 | Not Available | 24053 | Open in IMG/M |
| 3300007538|Ga0099851_1077363 | All Organisms → Viruses → Predicted Viral | 1283 | Open in IMG/M |
| 3300007538|Ga0099851_1133431 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 932 | Open in IMG/M |
| 3300007540|Ga0099847_1145929 | Not Available | 705 | Open in IMG/M |
| 3300007541|Ga0099848_1008010 | All Organisms → Viruses → Predicted Viral | 4736 | Open in IMG/M |
| 3300007541|Ga0099848_1078974 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1285 | Open in IMG/M |
| 3300009000|Ga0102960_1002208 | Not Available | 7466 | Open in IMG/M |
| 3300009000|Ga0102960_1032441 | All Organisms → Viruses → Predicted Viral | 1942 | Open in IMG/M |
| 3300009001|Ga0102963_1011615 | All Organisms → Viruses → Predicted Viral | 3754 | Open in IMG/M |
| 3300009001|Ga0102963_1021031 | Not Available | 2751 | Open in IMG/M |
| 3300010149|Ga0098049_1124031 | Not Available | 803 | Open in IMG/M |
| 3300010296|Ga0129348_1082671 | All Organisms → Viruses → Predicted Viral | 1140 | Open in IMG/M |
| 3300010316|Ga0136655_1123065 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 778 | Open in IMG/M |
| 3300010368|Ga0129324_10073881 | All Organisms → Viruses → Predicted Viral | 1510 | Open in IMG/M |
| 3300010368|Ga0129324_10075667 | All Organisms → Viruses → Predicted Viral | 1488 | Open in IMG/M |
| 3300010389|Ga0136549_10166782 | Not Available | 978 | Open in IMG/M |
| 3300016745|Ga0182093_1652215 | All Organisms → Viruses → Predicted Viral | 1061 | Open in IMG/M |
| 3300016797|Ga0182090_1158299 | All Organisms → Viruses → Predicted Viral | 1156 | Open in IMG/M |
| 3300017708|Ga0181369_1050037 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
| 3300017719|Ga0181390_1029277 | All Organisms → Viruses → Predicted Viral | 1735 | Open in IMG/M |
| 3300017742|Ga0181399_1001305 | Not Available | 8895 | Open in IMG/M |
| 3300017776|Ga0181394_1049492 | All Organisms → Viruses | 1416 | Open in IMG/M |
| 3300017779|Ga0181395_1181606 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → unclassified Balneolaceae → Balneolaceae bacterium | 658 | Open in IMG/M |
| 3300017818|Ga0181565_10031356 | All Organisms → Viruses → Predicted Viral | 3910 | Open in IMG/M |
| 3300017818|Ga0181565_10048066 | All Organisms → Viruses → Predicted Viral | 3089 | Open in IMG/M |
| 3300017824|Ga0181552_10139028 | All Organisms → Viruses → Predicted Viral | 1305 | Open in IMG/M |
| 3300017824|Ga0181552_10200893 | Not Available | 1029 | Open in IMG/M |
| 3300017950|Ga0181607_10051412 | All Organisms → Viruses → Predicted Viral | 2798 | Open in IMG/M |
| 3300017951|Ga0181577_10095386 | All Organisms → Viruses → Predicted Viral | 2065 | Open in IMG/M |
| 3300017951|Ga0181577_10692675 | Not Available | 621 | Open in IMG/M |
| 3300018036|Ga0181600_10017203 | Not Available | 5138 | Open in IMG/M |
| 3300018041|Ga0181601_10497131 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 636 | Open in IMG/M |
| 3300018048|Ga0181606_10348055 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 805 | Open in IMG/M |
| 3300018049|Ga0181572_10147511 | All Organisms → Viruses → Predicted Viral | 1543 | Open in IMG/M |
| 3300018049|Ga0181572_10905359 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 522 | Open in IMG/M |
| 3300018416|Ga0181553_10103682 | All Organisms → Viruses → Predicted Viral | 1752 | Open in IMG/M |
| 3300018416|Ga0181553_10286927 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 920 | Open in IMG/M |
| 3300018416|Ga0181553_10514988 | Not Available | 638 | Open in IMG/M |
| 3300018416|Ga0181553_10752255 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 506 | Open in IMG/M |
| 3300018876|Ga0181564_10549857 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 615 | Open in IMG/M |
| 3300019732|Ga0194014_1005347 | All Organisms → Viruses → Predicted Viral | 1407 | Open in IMG/M |
| 3300019765|Ga0194024_1109499 | Not Available | 634 | Open in IMG/M |
| 3300019937|Ga0194022_1027760 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 745 | Open in IMG/M |
| 3300020051|Ga0181555_1252463 | Not Available | 642 | Open in IMG/M |
| 3300020188|Ga0181605_10359673 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 590 | Open in IMG/M |
| 3300021085|Ga0206677_10000935 | Not Available | 27660 | Open in IMG/M |
| 3300021347|Ga0213862_10002160 | Not Available | 8108 | Open in IMG/M |
| 3300021347|Ga0213862_10107230 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 982 | Open in IMG/M |
| 3300021364|Ga0213859_10188811 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 959 | Open in IMG/M |
| 3300021371|Ga0213863_10033691 | All Organisms → Viruses → Predicted Viral | 2800 | Open in IMG/M |
| 3300021373|Ga0213865_10034004 | All Organisms → Viruses → Predicted Viral | 2855 | Open in IMG/M |
| 3300021373|Ga0213865_10402857 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 607 | Open in IMG/M |
| 3300021375|Ga0213869_10204366 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
| 3300021378|Ga0213861_10111342 | All Organisms → Viruses → Predicted Viral | 1613 | Open in IMG/M |
| 3300021378|Ga0213861_10246053 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 946 | Open in IMG/M |
| 3300021959|Ga0222716_10590590 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 608 | Open in IMG/M |
| 3300021960|Ga0222715_10173820 | All Organisms → Viruses → Predicted Viral | 1313 | Open in IMG/M |
| 3300021964|Ga0222719_10064483 | All Organisms → Viruses → Predicted Viral | 2756 | Open in IMG/M |
| 3300022176|Ga0212031_1002384 | All Organisms → Viruses → Predicted Viral | 2041 | Open in IMG/M |
| 3300022187|Ga0196899_1016199 | Not Available | 2827 | Open in IMG/M |
| 3300023110|Ga0255743_10460535 | Not Available | 612 | Open in IMG/M |
| 3300023119|Ga0255762_10504219 | Not Available | 567 | Open in IMG/M |
| 3300024180|Ga0228668_1000173 | Not Available | 30787 | Open in IMG/M |
| 3300024188|Ga0228602_1091931 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 530 | Open in IMG/M |
| 3300024191|Ga0228636_1004477 | All Organisms → Viruses → Predicted Viral | 3447 | Open in IMG/M |
| 3300024231|Ga0233399_1014323 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 2517 | Open in IMG/M |
| (restricted) 3300024264|Ga0233444_10116074 | Not Available | 1363 | Open in IMG/M |
| 3300024301|Ga0233451_10340019 | Not Available | 562 | Open in IMG/M |
| 3300025070|Ga0208667_1001196 | Not Available | 9817 | Open in IMG/M |
| 3300025098|Ga0208434_1074786 | Not Available | 698 | Open in IMG/M |
| 3300025543|Ga0208303_1062568 | Not Available | 869 | Open in IMG/M |
| 3300025608|Ga0209654_1022488 | All Organisms → Viruses → Predicted Viral | 2301 | Open in IMG/M |
| 3300025646|Ga0208161_1011239 | All Organisms → Viruses → Predicted Viral | 3717 | Open in IMG/M |
| 3300025695|Ga0209653_1038530 | All Organisms → Viruses | 1942 | Open in IMG/M |
| 3300025759|Ga0208899_1035160 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 2298 | Open in IMG/M |
| 3300026183|Ga0209932_1108470 | Not Available | 607 | Open in IMG/M |
| 3300026187|Ga0209929_1001539 | Not Available | 8271 | Open in IMG/M |
| 3300026453|Ga0228644_1000357 | Not Available | 15212 | Open in IMG/M |
| 3300026503|Ga0247605_1122086 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 631 | Open in IMG/M |
| 3300026504|Ga0247587_1039189 | Not Available | 1148 | Open in IMG/M |
| 3300026505|Ga0228647_1000304 | Not Available | 17785 | Open in IMG/M |
| (restricted) 3300027861|Ga0233415_10243522 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 838 | Open in IMG/M |
| 3300027917|Ga0209536_100035398 | Not Available | 6728 | Open in IMG/M |
| 3300027917|Ga0209536_100814770 | All Organisms → Viruses → Predicted Viral | 1156 | Open in IMG/M |
| 3300028008|Ga0228674_1129685 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 856 | Open in IMG/M |
| 3300028133|Ga0228609_1077590 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 875 | Open in IMG/M |
| 3300028287|Ga0257126_1000560 | Not Available | 29862 | Open in IMG/M |
| 3300031519|Ga0307488_10038454 | All Organisms → Viruses → Predicted Viral | 3775 | Open in IMG/M |
| 3300032277|Ga0316202_10505694 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 568 | Open in IMG/M |
| 3300034374|Ga0348335_131799 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 719 | Open in IMG/M |
| 3300034375|Ga0348336_001113 | Not Available | 25587 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 21.05% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 19.30% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 16.67% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 5.26% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 5.26% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 4.39% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 3.51% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 3.51% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 2.63% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.63% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 2.63% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.75% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 1.75% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.75% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.88% |
| Marine | Environmental → Aquatic → Marine → Inlet → Unclassified → Marine | 0.88% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 0.88% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.88% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.88% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment | 0.88% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment | 0.88% |
| Marine Methane Seep Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Methane Seep Sediment | 0.88% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.88% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000947 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY92 | Host-Associated | Open in IMG/M |
| 3300001419 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline water (15 m) | Environmental | Open in IMG/M |
| 3300001934 | Estuary microbial communities from Chesapeake Bay, Maryland, USA - MOVE858 | Environmental | Open in IMG/M |
| 3300001938 | Marine microbial communities from Bedford Basin, Nova Scotia, Canada - GS005 | Environmental | Open in IMG/M |
| 3300003427 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_116LU_22_DNA | Environmental | Open in IMG/M |
| 3300005512 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_water | Environmental | Open in IMG/M |
| 3300005747 | Seawater microbial communities from Vineyard Sound, MA, USA - control T14 | Environmental | Open in IMG/M |
| 3300005748 | Seawater microbial communities from Vineyard Sound, MA, USA - control T7 | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006874 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006990 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG | Environmental | Open in IMG/M |
| 3300007234 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300009000 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
| 3300010316 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010389 | Marine sediment microbial communities from methane seeps within Baltimore Canyon, US Atlantic Margin - Baltimore Canyon MUC-11 12-14 cmbsf | Environmental | Open in IMG/M |
| 3300016745 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041411BS metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016797 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041408BS metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017708 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG | Environmental | Open in IMG/M |
| 3300017719 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 | Environmental | Open in IMG/M |
| 3300017742 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21 | Environmental | Open in IMG/M |
| 3300017776 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23 | Environmental | Open in IMG/M |
| 3300017779 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16 | Environmental | Open in IMG/M |
| 3300017818 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017950 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017951 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018036 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041406US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018041 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041407BS metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018048 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018049 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018876 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019732 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRC_0-1_MG | Environmental | Open in IMG/M |
| 3300019765 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW13Sep16_MG | Environmental | Open in IMG/M |
| 3300019937 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW29Aug16_MG | Environmental | Open in IMG/M |
| 3300020051 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011504AT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020188 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041411US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300021085 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 | Environmental | Open in IMG/M |
| 3300021347 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266 | Environmental | Open in IMG/M |
| 3300021364 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304 | Environmental | Open in IMG/M |
| 3300021371 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497 | Environmental | Open in IMG/M |
| 3300021373 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282 | Environmental | Open in IMG/M |
| 3300021375 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132 | Environmental | Open in IMG/M |
| 3300021378 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131 | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022176 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
| 3300023110 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaG | Environmental | Open in IMG/M |
| 3300023119 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG | Environmental | Open in IMG/M |
| 3300024180 | Seawater microbial communities from Monterey Bay, California, United States - 82D | Environmental | Open in IMG/M |
| 3300024188 | Seawater microbial communities from Monterey Bay, California, United States - 2D | Environmental | Open in IMG/M |
| 3300024191 | Seawater microbial communities from Monterey Bay, California, United States - 45D | Environmental | Open in IMG/M |
| 3300024231 | Seawater microbial communities from Monterey Bay, California, United States - 43D | Environmental | Open in IMG/M |
| 3300024264 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_10_MG | Environmental | Open in IMG/M |
| 3300024301 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011504CT (spades assembly) | Environmental | Open in IMG/M |
| 3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025098 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025608 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_161SG_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025695 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_116LU_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300026183 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026187 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026453 | Seawater microbial communities from Monterey Bay, California, United States - 56D | Environmental | Open in IMG/M |
| 3300026503 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 91R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026504 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 46R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026505 | Seawater microbial communities from Monterey Bay, California, United States - 59D | Environmental | Open in IMG/M |
| 3300027861 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MG | Environmental | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300028008 | Seawater microbial communities from Monterey Bay, California, United States - 1D_r | Environmental | Open in IMG/M |
| 3300028133 | Seawater microbial communities from Monterey Bay, California, United States - 10D | Environmental | Open in IMG/M |
| 3300028287 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI060_120m | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300032277 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotite | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| 3300034375 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSpr2010_1000085514 | 3300000116 | Marine | MKETTLHKMKHDIKLLQQAVMVALHRIEKLEEKEEKK* |
| DelMOSpr2010_100256067 | 3300000116 | Marine | MKEATLVKMQHDLKLTQQALVVALNRLEKLEEKVFSKEKDVK* |
| DelMOSpr2010_101537283 | 3300000116 | Marine | MKESTLVKMQHDLKLTQQALVVALNRLEQLEKKVFPKEEDVK* |
| BBAY92_100085953 | 3300000947 | Macroalgal Surface | MKESTLVKMQHDLKLTQQALVVALNRLEKLEEKVFPKEEDVK* |
| JGI11705J14877_101464692 | 3300001419 | Saline Water And Sediment | LQYAHKSTGMKEAKLIKMQHDIKLTQQALVVALNKIEKLEEKVFPKDEDVK* |
| GOS2267_1000986 | 3300001934 | Marine | MKEAELIKMKHDLRLAQEALVVALHKIDNLEKKVFPKVDDV* |
| GOS2221_10000874 | 3300001938 | Marine | MKESKLIKMQYDLKLTQQALVVALNRIEQLEKKVFPK |
| JGI26084J50262_10239773 | 3300003427 | Marine | MKESTLIKMKQELKLTXQAVVVALHRIEKLEAKFPPELDEEKKDSL* |
| Ga0074648_10205318 | 3300005512 | Saline Water And Sediment | MKEAKLIKMQHDIKLTQQALVVALNKIEKLEEKVFPKDEDVK* |
| Ga0076924_103203918 | 3300005747 | Marine | MKESTLIKMQQELKLTQQAVVVALHRIEKLEAKFPPELDEEEKDSE* |
| Ga0076924_10770771 | 3300005747 | Marine | SKLIKMQYDLKLTQQALAVALHKIEQLEKKVFEKKE* |
| Ga0076925_10319862 | 3300005748 | Marine | MKEATLVKMQHDLKLTQQALVVALNRLEKLEEKVFPKDEDVK* |
| Ga0098048_11618042 | 3300006752 | Marine | MKESTLVKMQHDLKLTQQALVVALNRLKQLEKKVFPKEEDVK* |
| Ga0070749_104284103 | 3300006802 | Aqueous | MKEAEIIKMLYDLKLTQQALVVALEKIKALEEKVFEKN* |
| Ga0070754_1000560515 | 3300006810 | Aqueous | MKEATLVKMQHDLKLTQQALVVALNRLEKLEEKVFEKKD* |
| Ga0070754_100106935 | 3300006810 | Aqueous | MKETTLHKMKHDIKLLQQAVMVALHRIEKLEEKKE* |
| Ga0075475_103070683 | 3300006874 | Aqueous | MKEVKLIKMQHDIKLTQQALVVALNRLEKLEEKVFEKKD* |
| Ga0070750_100027398 | 3300006916 | Aqueous | MKEIKLIKMRNDLKLTQEALAVALYRIEQLEKKVFPKEKEKK* |
| Ga0070750_100052759 | 3300006916 | Aqueous | MKEVKLIKMQHDLKLTQQALVVALDKIEKLEKKVFENNDSVK* |
| Ga0070746_100110585 | 3300006919 | Aqueous | MKEATLVKMQHDLKLTQQALVIALNRLEKLEEKVFEKKD* |
| Ga0070746_104099912 | 3300006919 | Aqueous | MKEAKLIKMQHDIKLTQQALVVALNKIEKLEKKVFKKEEDV* |
| Ga0098046_10060741 | 3300006990 | Marine | TEMKESTLVKMQHDLKLTQQALVVALNRLEQLEKKVFPKEEDVK* |
| Ga0075460_100741445 | 3300007234 | Aqueous | MKEAELIKMKHDIKLTQQALVVALDKIEKLEQKVFEKKD* |
| Ga0099851_100020629 | 3300007538 | Aqueous | MKEAELVKMRYDLKLTQQALVVALEKIKALEEKVFKNN* |
| Ga0099851_10773633 | 3300007538 | Aqueous | MKEAELIKMKYDLRLAQEALVVALHKIDNLEKKVFPKVDDV* |
| Ga0099851_11334314 | 3300007538 | Aqueous | MKEAELIRMKHDLRLAQQALVVALNKIEKLEEKVFPKVDDV* |
| Ga0099847_11459292 | 3300007540 | Aqueous | MKEVKLIKMQHDLKLTQQALVVALRRLEKLEEKVFPKDEDVK* |
| Ga0099848_10080101 | 3300007541 | Aqueous | MKEAELVKMRYDLKLTQQALVVALEKIKALEEKVF |
| Ga0099848_10789742 | 3300007541 | Aqueous | MKEAELIKMKHDLRLAQQALVVALNKIEKLEEKVFPKVDDV* |
| Ga0102960_10022089 | 3300009000 | Pond Water | VKESTLVKMQHDLKLTQQALVVALNRIEKLEEKIFPKEQDVK* |
| Ga0102960_10324415 | 3300009000 | Pond Water | MKEVKLIKMQNDLKLTQQALVVALRRLEKLEEKVFPKDEDVK* |
| Ga0102963_10116152 | 3300009001 | Pond Water | MKEATLVKMQHDLKLTQQALVVALNRLEQLEKKVFPKEEDVK* |
| Ga0102963_10210316 | 3300009001 | Pond Water | MKEIKLIKMRNDLKLTQEALAVALYRIEQLEKKVFPKEKEKNNNS* |
| Ga0098049_11240311 | 3300010149 | Marine | MKESTLVKMQHDLKLTQQALVVALNRLKQLEKKVFPKE |
| Ga0129348_10826711 | 3300010296 | Freshwater To Marine Saline Gradient | IKLIKMRNDLKLTQEALAVALYRIEQLEKKVFPKEKEKK* |
| Ga0136655_11230653 | 3300010316 | Freshwater To Marine Saline Gradient | MKEVKLIKMQHDLKLTQQALVVALRRLEKLEEKVFPKDEDV |
| Ga0129324_100738815 | 3300010368 | Freshwater To Marine Saline Gradient | MKEATLVKMQHDLKLTQQALVVALNRLEKLEEKVFPKEEDV |
| Ga0129324_100756674 | 3300010368 | Freshwater To Marine Saline Gradient | MKEVKLIKMQHDIKLTQQALVVALNKIEKLEEKVFPKEEDVK* |
| Ga0136549_101667823 | 3300010389 | Marine Methane Seep Sediment | MKESTLVKMQHDLKLTQQALVVALNRIEKLEEKISPKEQDVK* |
| Ga0182093_16522151 | 3300016745 | Salt Marsh | KEAKLIKMQHDIKLTQQALVVALNKIEKLEKKVFPKDEDVK |
| Ga0182090_11582992 | 3300016797 | Salt Marsh | LQCAHKSIGMKEAKLIKMQHDIKLTQQALVVALNKIEKLEKKVFPKDEDVK |
| Ga0181369_10500374 | 3300017708 | Marine | MKESILIKMQHDLKLTQQALVVTLNRLEQLEKKVFPKEEDVK |
| Ga0181390_10292772 | 3300017719 | Seawater | MKETTLHKMKHDIKLLQQAVMVALHRIEKLEEKEEE |
| Ga0181399_100130512 | 3300017742 | Seawater | MKETTLHQMKHDIKLLQQAVMVALHRIEKLEEKEEE |
| Ga0181394_10494922 | 3300017776 | Seawater | MKESTLVKMQHDIKLAQQALVVALNKLEKLEEKVFPKEEDVK |
| Ga0181395_11816062 | 3300017779 | Seawater | MKESTLVKMQHDIKLAQQALVVALNKLEKLEEKVIPKEEDVK |
| Ga0181565_100313565 | 3300017818 | Salt Marsh | MKEVKLIKMQHDIKLTQQALVVALNKIEKLEEKVFPKDEDVK |
| Ga0181565_100480666 | 3300017818 | Salt Marsh | MKEVELFKMKHDLRLAQQALVVALNRIEKLEEKVFEKKE |
| Ga0181552_101390281 | 3300017824 | Salt Marsh | LQYAHKSTGMKEVKLIKMQHDIKLTQQALVVALNKIEKLEEKVFPKDEDVK |
| Ga0181552_102008934 | 3300017824 | Salt Marsh | MKEAELYKMKHDIKLTQQALVVALNRLEKLEEKVFEKKE |
| Ga0181607_100514128 | 3300017950 | Salt Marsh | MKEAKLIKMQHDIKLTQQALVVALNKIEKLEKKVFPKDEDVK |
| Ga0181577_100953866 | 3300017951 | Salt Marsh | MKEVKLIKMQHDIKLTQQALVVALNRLEKLEEKVFPKDEDVK |
| Ga0181577_106926752 | 3300017951 | Salt Marsh | MKEAKLIKMQHDIKLTQQALVVALNKIEKLEKKVFPNDEDVK |
| Ga0181600_100172033 | 3300018036 | Salt Marsh | LQYAHKFTGMKEANLIKMQHDIKLTQQALVVALNKIEKLEKKVFPKDEDVK |
| Ga0181601_104971314 | 3300018041 | Salt Marsh | MKEANLIKMQHDIKLTQQALVVALNKIEKLEKKVFPKDEDVK |
| Ga0181606_103480554 | 3300018048 | Salt Marsh | MKEVKLIKMQHDIKLTQQALVVALNKIEKLEKKVF |
| Ga0181572_101475113 | 3300018049 | Salt Marsh | LQYAHKSTRMKEAKLIKMQHDIKLTQQALVVALNKIEKLEKKVFPKEEDVK |
| Ga0181572_109053593 | 3300018049 | Salt Marsh | MKEANLIKMQHDIKLTQQALVVALNKIEKLEQKVFEKKD |
| Ga0181553_101036825 | 3300018416 | Salt Marsh | MKEVKLIKMQHDIKLTQQALVVALNRLEKLEEKVFEKKD |
| Ga0181553_102869274 | 3300018416 | Salt Marsh | MKEAKLIKMQHDIKLTQQALVVALNKIEKLEKKVFPKEEDVK |
| Ga0181553_105149882 | 3300018416 | Salt Marsh | MKEVKLIKMQHDIKLTQQALVVALSKLEKLEEKVFPKDEDVK |
| Ga0181553_107522553 | 3300018416 | Salt Marsh | MKEANLIKMQHDIKLTQQALVVALNKREKLEQKVFEKKD |
| Ga0181564_105498573 | 3300018876 | Salt Marsh | MKEAELIKMRYDLKLTQQALVVALEKIKALEEKVFEKK |
| Ga0194014_10053472 | 3300019732 | Sediment | MKEAKLIKMQQDLKLTQQALVVALNKIEKLEKKVFPKEEDVE |
| Ga0194024_11094991 | 3300019765 | Freshwater | GLQYAIKYTGMKEASLIMMQKDIKILQQALAVALYKIEKLEKKVFPKEEDVE |
| Ga0194022_10277602 | 3300019937 | Freshwater | LQSVTKYTKMKEAKLIKMQQDLKLTQQALVVALNKIEKLEKKVFPKEEDVE |
| Ga0181555_12524633 | 3300020051 | Salt Marsh | MKEAKLIKMQHDIKLTQQALVVALNKIEKLEEKVFPKDEDVK |
| Ga0181605_103596734 | 3300020188 | Salt Marsh | MKESTLIKMQQDLKLTQQAVVVALHRIEKLESKFPPELDEEE |
| Ga0206677_1000093530 | 3300021085 | Seawater | MKESTLVKMQHDLKLCQQVLMVALGKIEKLEKKVFDGSSDVK |
| Ga0213862_1000216013 | 3300021347 | Seawater | LLYVHKYTRMKEVKLIKMQHDLKLTQQALVVALRRLEKLEEKVFPKDEDVK |
| Ga0213862_101072303 | 3300021347 | Seawater | MKEATLVKMQHDLKLTQQALVVALNRLEKIEEKVFPKEEDVK |
| Ga0213859_101888111 | 3300021364 | Seawater | MKEATLVKMQHDLRLAQQALVVALNRIEKLEKKVFEKEEDVK |
| Ga0213863_100336914 | 3300021371 | Seawater | LLYVRKYTRMKEVKLIKMQHDLKLTQQALVVALRRLEKLEEKVFPKDEDVK |
| Ga0213865_100340045 | 3300021373 | Seawater | MKEATLVKMQHDLKLTQQALVVALNRLEKLEEKVFPKDEDVK |
| Ga0213865_104028571 | 3300021373 | Seawater | MKESTLIKMQQDLKLTQQAVVVALHRIEKLESKFPPELDEEEKDSE |
| Ga0213869_102043661 | 3300021375 | Seawater | MKEQTLMKMKYDLELTQKAVVVALNKIEKLEEKVFPKEEDVK |
| Ga0213861_101113424 | 3300021378 | Seawater | MKESTLIKMQQDLKLTQQAVVVALYRIEKLESKFPPELDEEEK |
| Ga0213861_102460533 | 3300021378 | Seawater | MKEVKLIKMQHDIKLTQQALVVALNKIEKLEEKVFPKEEDVK |
| Ga0222716_105905902 | 3300021959 | Estuarine Water | LQYVHKSTGMKEVKLIKMQHDIKLTQQALVVALNKIEKLEEKVFPKDEDVK |
| Ga0222715_101738204 | 3300021960 | Estuarine Water | MKEAELIKMKHDLRLTQQALVVALNKIEKLEQKVFEKEDDV |
| Ga0222719_100644833 | 3300021964 | Estuarine Water | MKEVKLIKMQNDLKLTQQALVVALRRLEKLEEKVFPKDEDVK |
| Ga0212031_10023845 | 3300022176 | Aqueous | MKEAELIRMKHDLRLAQQALVVALNKIEKLEEKVFPKVDDV |
| Ga0196899_10161996 | 3300022187 | Aqueous | MKETTLHKMKHDIKLLQQAVMVALHRIEKLEEKKE |
| Ga0255743_104605354 | 3300023110 | Salt Marsh | ELFKMKHDLRLAQQALVVALNRIEKLEEKVFEKKE |
| Ga0255762_105042191 | 3300023119 | Salt Marsh | LIKMQHDIKLTQQALVVALNKIEKLEEKVFPKDEDVK |
| Ga0228668_100017334 | 3300024180 | Seawater | MKEIKLIKMRNDLKLTQEALAVALYRIEQLEKKVFPKEKEKNNNS |
| Ga0228602_10919311 | 3300024188 | Seawater | MKESTIIKMQHDLKLTQQALVVALNRLEKLEKKVFPK |
| Ga0228636_10044776 | 3300024191 | Seawater | MKESTIIKLQHDLKLTQQALVVALNRLEQLEKKVFPKDEDVK |
| Ga0233399_10143235 | 3300024231 | Seawater | MKEIKLIKMQHDLKLTQQALVVALNRLEKLEKKVFPKEEDVK |
| (restricted) Ga0233444_101160742 | 3300024264 | Seawater | MKESTLVKMQHDIKLLQQAVMVALHRIEKLEKTNKDEDKGSD |
| Ga0233451_103400191 | 3300024301 | Salt Marsh | MMKEAELYKMKHDIKLTQQALVVALNRLEKLEEKVFEKKE |
| Ga0208667_100119617 | 3300025070 | Marine | MKESTLVKMQHDLKLTQQALVVALNRLEQLEKKVFPKEEDVK |
| Ga0208434_10747861 | 3300025098 | Marine | MKEVKLIKMQNDLKLTQKALAVALYRIEKIEEQLKPK |
| Ga0208303_10625682 | 3300025543 | Aqueous | MKEIKLIKMRNDLKLTQEALAVALYRIEQLEKKVFPKEKEKK |
| Ga0209654_10224885 | 3300025608 | Marine | MKESTLVKMKYDLSLVSQALAVALMRLDKLEEKVKEKE |
| Ga0208161_10112393 | 3300025646 | Aqueous | MKEAELIKMKYDLRLAQEALVVALHKIDNLEKKVFPKVDDV |
| Ga0209653_10385306 | 3300025695 | Marine | MKETTLHKMKHDIKLLQQAVMVALHRIEKLEKKEEE |
| Ga0208899_10351603 | 3300025759 | Aqueous | MKEVKLIKMQHDLKLTQQALVVALDKIEKLEKKVFENNDSVK |
| Ga0209932_11084701 | 3300026183 | Pond Water | EVKLIKMQHDLKLTQQALVVALRRLEKLEEKVFPKDEDVK |
| Ga0209929_100153913 | 3300026187 | Pond Water | VKESTLVKMQHDLKLTQQALVVALNRIEKLEEKIFPKEQDVK |
| Ga0228644_100035721 | 3300026453 | Seawater | MKESTIIKMQHDLKLTQQALVVALNRLEKLEKKVFPKEEDVK |
| Ga0247605_11220862 | 3300026503 | Seawater | MKEVKLIKMQHDLKLTQQALVVALNRLEKLEKKVFPKEEDVK |
| Ga0247587_10391895 | 3300026504 | Seawater | MKESTIIKMQHDLKLTQQALVVALNRLEKLEKKVFLKEEDVK |
| Ga0228647_100030429 | 3300026505 | Seawater | MKESTIIKMQYDLKLTQQALVVALNRLEKLEKKVFLKEEDVK |
| (restricted) Ga0233415_102435222 | 3300027861 | Seawater | MKESTLVKMQHDLKLAQKVLVVALNRLEQLEKKVFQKEEDVK |
| Ga0209536_10003539816 | 3300027917 | Marine Sediment | MKEANLIKMQHDIKLTQQALVVALNKIEKLEEKVFSKDEDVK |
| Ga0209536_1008147703 | 3300027917 | Marine Sediment | MKEVKLIKMQHDIKLTQQALVVALNRLEKLEEKVFEKKIDDV |
| Ga0228674_11296854 | 3300028008 | Seawater | MKEVKLIKMQHDLKLTQQALVVALNRLEQLEKKVFPKEEDVK |
| Ga0228609_10775903 | 3300028133 | Seawater | MKESTLVKMKHDLKLTQQALVVALNRLEQLEKKVFPKDEDVK |
| Ga0257126_100056019 | 3300028287 | Marine | MKESTLVKMQHDLKLCQQVLMVALGKVEKLEKKVFDGSSDVK |
| Ga0307488_100384549 | 3300031519 | Sackhole Brine | MKEQTLVKMQHDLKLTQQALVVALNKIEAIEKKLEEKLEEKNNS |
| Ga0316202_105056941 | 3300032277 | Microbial Mat | MKEIKLIKMRNDLKLTQEALAVALYRIEQLEKKVF |
| Ga0348335_131799_1_114 | 3300034374 | Aqueous | MKEATLVKMQHDLKLTQQALVVALNRLEKLEEKVFEKK |
| Ga0348336_001113_16800_16919 | 3300034375 | Aqueous | MKEATLVKMQHDLKLTQQALVVALNRLEKLEEKVFEKKD |
| ⦗Top⦘ |