


| Basic Information | |
|---|---|
| Family ID | F081718 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 114 |
| Average Sequence Length | 41 residues |
| Representative Sequence | GIIHLTLQVPASAAPGARTLFIQNTNLDKTAASGVLEVQ |
| Number of Associated Samples | 99 |
| Number of Associated Scaffolds | 114 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 92.11 % |
| % of genes from short scaffolds (< 2000 bps) | 84.21 % |
| Associated GOLD sequencing projects | 92 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (93.860 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (28.070 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.947 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.368 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 23.88% Coil/Unstructured: 76.12% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 114 Family Scaffolds |
|---|---|---|
| PF00413 | Peptidase_M10 | 16.67 |
| PF01546 | Peptidase_M20 | 0.88 |
| PF02803 | Thiolase_C | 0.88 |
| PF03703 | bPH_2 | 0.88 |
| PF08281 | Sigma70_r4_2 | 0.88 |
| PF04343 | DUF488 | 0.88 |
| PF08541 | ACP_syn_III_C | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 114 Family Scaffolds |
|---|---|---|---|
| COG5549 | Predicted Zn-dependent protease | Posttranslational modification, protein turnover, chaperones [O] | 16.67 |
| COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 0.88 |
| COG3189 | Uncharacterized conserved protein YeaO, DUF488 family | Function unknown [S] | 0.88 |
| COG3402 | Uncharacterized membrane protein YdbS, contains bPH2 (bacterial pleckstrin homology) domain | Function unknown [S] | 0.88 |
| COG3428 | Uncharacterized membrane protein YdbT, contains bPH2 (bacterial pleckstrin homology) domain | Function unknown [S] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 93.86 % |
| Unclassified | root | N/A | 6.14 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001593|JGI12635J15846_10338186 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100653303 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
| 3300004092|Ga0062389_100464714 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1404 | Open in IMG/M |
| 3300005174|Ga0066680_10001960 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8793 | Open in IMG/M |
| 3300005435|Ga0070714_101182352 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300005467|Ga0070706_101489881 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300005526|Ga0073909_10144582 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
| 3300005557|Ga0066704_10178847 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1430 | Open in IMG/M |
| 3300005591|Ga0070761_10016737 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4074 | Open in IMG/M |
| 3300005712|Ga0070764_10891927 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300006162|Ga0075030_101375591 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300006172|Ga0075018_10236097 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
| 3300006173|Ga0070716_101249935 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300006174|Ga0075014_100002555 | All Organisms → cellular organisms → Bacteria | 5307 | Open in IMG/M |
| 3300006755|Ga0079222_10090824 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1573 | Open in IMG/M |
| 3300006794|Ga0066658_10227714 | All Organisms → cellular organisms → Bacteria | 993 | Open in IMG/M |
| 3300006796|Ga0066665_10073625 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2432 | Open in IMG/M |
| 3300007265|Ga0099794_10072096 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1693 | Open in IMG/M |
| 3300007265|Ga0099794_10185819 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1062 | Open in IMG/M |
| 3300009038|Ga0099829_10339234 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1236 | Open in IMG/M |
| 3300009038|Ga0099829_11760524 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300009839|Ga0116223_10735627 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300010360|Ga0126372_11601831 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300010361|Ga0126378_12285163 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300010376|Ga0126381_100053776 | All Organisms → cellular organisms → Bacteria | 4944 | Open in IMG/M |
| 3300011269|Ga0137392_10850132 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300012096|Ga0137389_10542594 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 998 | Open in IMG/M |
| 3300012096|Ga0137389_11218250 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300012189|Ga0137388_10110793 | All Organisms → cellular organisms → Bacteria | 2374 | Open in IMG/M |
| 3300012189|Ga0137388_10206835 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1771 | Open in IMG/M |
| 3300012189|Ga0137388_10265659 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1566 | Open in IMG/M |
| 3300012189|Ga0137388_11585231 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300012201|Ga0137365_10109800 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2075 | Open in IMG/M |
| 3300012203|Ga0137399_10570759 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
| 3300012203|Ga0137399_11466758 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300012205|Ga0137362_11251197 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300012206|Ga0137380_10198236 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1821 | Open in IMG/M |
| 3300012207|Ga0137381_10475559 | All Organisms → cellular organisms → Bacteria | 1090 | Open in IMG/M |
| 3300012207|Ga0137381_10741958 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
| 3300012210|Ga0137378_11141560 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300012357|Ga0137384_10191185 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1714 | Open in IMG/M |
| 3300012582|Ga0137358_10921927 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300012922|Ga0137394_10563269 | All Organisms → cellular organisms → Bacteria | 965 | Open in IMG/M |
| 3300012927|Ga0137416_10311374 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1308 | Open in IMG/M |
| 3300012927|Ga0137416_11685360 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300012931|Ga0153915_12191969 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300012944|Ga0137410_10074758 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2465 | Open in IMG/M |
| 3300012944|Ga0137410_10499820 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 994 | Open in IMG/M |
| 3300012971|Ga0126369_10548352 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1221 | Open in IMG/M |
| 3300013503|Ga0120127_10108422 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300014154|Ga0134075_10032432 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2125 | Open in IMG/M |
| 3300014166|Ga0134079_10442316 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300015053|Ga0137405_1385397 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1109 | Open in IMG/M |
| 3300015264|Ga0137403_10457303 | All Organisms → cellular organisms → Bacteria | 1151 | Open in IMG/M |
| 3300017959|Ga0187779_10754454 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300018006|Ga0187804_10399498 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300018037|Ga0187883_10381851 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300018058|Ga0187766_10620869 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300018085|Ga0187772_10383246 | All Organisms → cellular organisms → Bacteria | 976 | Open in IMG/M |
| 3300020021|Ga0193726_1145415 | All Organisms → cellular organisms → Bacteria | 1037 | Open in IMG/M |
| 3300020580|Ga0210403_10525433 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
| 3300020582|Ga0210395_10460334 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
| 3300021046|Ga0215015_11023859 | All Organisms → cellular organisms → Bacteria | 1363 | Open in IMG/M |
| 3300021168|Ga0210406_11070043 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300021168|Ga0210406_11368092 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300021170|Ga0210400_10344628 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1226 | Open in IMG/M |
| 3300021171|Ga0210405_10814904 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300021401|Ga0210393_10883456 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300021406|Ga0210386_10751481 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300021420|Ga0210394_11435347 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300021478|Ga0210402_11897065 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300024286|Ga0247687_1026473 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300025439|Ga0208323_1010026 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2380 | Open in IMG/M |
| 3300025472|Ga0208692_1113591 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
| 3300026301|Ga0209238_1055975 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1408 | Open in IMG/M |
| 3300026313|Ga0209761_1213847 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 822 | Open in IMG/M |
| 3300026320|Ga0209131_1207095 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
| 3300026325|Ga0209152_10118788 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
| 3300026334|Ga0209377_1314163 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300027643|Ga0209076_1215776 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300027655|Ga0209388_1079382 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
| 3300027727|Ga0209328_10147956 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300027787|Ga0209074_10029556 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1555 | Open in IMG/M |
| 3300027821|Ga0209811_10051686 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1406 | Open in IMG/M |
| 3300027829|Ga0209773_10236541 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300027853|Ga0209274_10076713 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1622 | Open in IMG/M |
| 3300027875|Ga0209283_10147214 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1561 | Open in IMG/M |
| 3300027903|Ga0209488_10149194 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1764 | Open in IMG/M |
| 3300028047|Ga0209526_10462902 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300029636|Ga0222749_10205788 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
| 3300030991|Ga0073994_12051858 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300031057|Ga0170834_111752129 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300031128|Ga0170823_17663066 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300031753|Ga0307477_10623007 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300031753|Ga0307477_10693013 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300031754|Ga0307475_10066404 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2748 | Open in IMG/M |
| 3300031754|Ga0307475_11335332 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300031823|Ga0307478_10602103 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
| 3300031962|Ga0307479_10522239 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1170 | Open in IMG/M |
| 3300032174|Ga0307470_11247252 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300032180|Ga0307471_101580392 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300032180|Ga0307471_102982751 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300032261|Ga0306920_102016783 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300032770|Ga0335085_10305389 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1883 | Open in IMG/M |
| 3300032892|Ga0335081_10711306 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1216 | Open in IMG/M |
| 3300033158|Ga0335077_11047013 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
| 3300033547|Ga0316212_1017941 | All Organisms → cellular organisms → Bacteria | 995 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 28.07% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.28% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 7.89% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 5.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.26% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.39% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.51% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.51% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.63% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.63% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.63% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.63% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.75% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.75% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.75% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.75% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.75% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.75% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.88% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.88% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.88% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.88% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.88% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.88% |
| Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots | 0.88% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003224 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013503 | Permafrost microbial communities from Nunavut, Canada - A23_5cm_12M | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300024286 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK28 | Environmental | Open in IMG/M |
| 3300025439 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025472 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12635J15846_103381863 | 3300001593 | Forest Soil | IIHLTLQVSAAAIPGARSLFIQNTNLDKTAATGALEVQ* |
| JGIcombinedJ26739_1006533031 | 3300002245 | Forest Soil | ISKQPAGLGIIHLTVQIPSTALPGARTLFVQNANLDKTAASGVLEIQ* |
| JGI26344J46810_10249371 | 3300003224 | Bog Forest Soil | GILHITLVIPAAAAPGPRTLFIQTTNLDKTSASGAVILQ* |
| Ga0062389_1003698191 | 3300004092 | Bog Forest Soil | AGLGVLHVTLLVPASAAAGPRTLFIQTTNLDKTAASGAVILQ* |
| Ga0062389_1004647141 | 3300004092 | Bog Forest Soil | AKQPAGLGIIHLTLQIPAAAAPGARTLFIQNENLDRTAASGVLDIQ* |
| Ga0066680_100019601 | 3300005174 | Soil | GIIHLTLQVPASAAPGARTLFIQNTNLDKTAASGALEVR* |
| Ga0070714_1011823521 | 3300005435 | Agricultural Soil | QPAGLGIIHLTLQIPAAAVPGARTLFIQNTNLDKTAATGALEVQ* |
| Ga0070706_1014898812 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | KQPVGLGIVRVTLQIPAGAVPGARTLFIQNTNLDKTAASGALEVD* |
| Ga0073909_101445823 | 3300005526 | Surface Soil | LTLQIPGTALPGARTLFLQNTNLDKTAASGALVVQ* |
| Ga0066704_101788471 | 3300005557 | Soil | QPAGLGIIHLTLQIPASAAPGARTLFIQNTNLDKTAASGVLEVN* |
| Ga0070761_100167375 | 3300005591 | Soil | ELTIQVPASALPGARTLFIQNTNLDETAASGALVIQ* |
| Ga0070764_108919271 | 3300005712 | Soil | ATQPAGLGIIELTLQVPATALPGARTLFIQNTNLDETAASGALVIQ* |
| Ga0075030_1013755912 | 3300006162 | Watersheds | LTIQIPSTAQPGARTLFIQNANLDKTAASGVLEIQ* |
| Ga0075018_102360971 | 3300006172 | Watersheds | AGLGIIHLTLQVPANAAPGARTVFIQNTNLDKTAASGVLEVN* |
| Ga0070716_1012499352 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | LTLQIAATAIPGARTLFIQNTNMDKTAASGALEVQ* |
| Ga0075014_1000025551 | 3300006174 | Watersheds | AGLGIIHLTLQVPATAAPGARTIFIQNTNLDKTAASGVLEVN* |
| Ga0079222_100908243 | 3300006755 | Agricultural Soil | HLTLQVAAGAQPGARTLSIQNANLDKTAATGALEVQ* |
| Ga0066658_102277141 | 3300006794 | Soil | KQPAGLGIIHLTLQISASAIPGARTLLIQNTNLDETAATGALEVQ* |
| Ga0066665_100736251 | 3300006796 | Soil | AKQPAGLGIIHLTLQIASSALPGARSLFIQNANLDKTAASGALEVE* |
| Ga0099794_100720961 | 3300007265 | Vadose Zone Soil | ILHLTIQIPSTALPGARTLFVQNANLDKTAASGVLEIQ* |
| Ga0099794_101858191 | 3300007265 | Vadose Zone Soil | DGGGIAKLPAGLGIIHLTLQVPATAATGARTLFIQNTNLDKTAASGVLEVH* |
| Ga0099829_103392341 | 3300009038 | Vadose Zone Soil | LTLQISAAAIPGARTLFIQNTNLDKTAATGALEVQ* |
| Ga0099829_117605241 | 3300009038 | Vadose Zone Soil | RLTLQIPAGAVPGARTLFIQNTNLDKTAASGALEVD* |
| Ga0116223_107356271 | 3300009839 | Peatlands Soil | IHLTLQIPSSAAPGARTLFIQNANLDRTAASGALEIR* |
| Ga0126376_105584611 | 3300010359 | Tropical Forest Soil | IHLTLQIPATAATGARTLFIQTTNLDKTAASGALEVF* |
| Ga0126372_116018312 | 3300010360 | Tropical Forest Soil | ISKQPAGLGIIHLTLQVPATASPGARTLFIQNTNLDKTAASGVLEVQ* |
| Ga0126378_122851631 | 3300010361 | Tropical Forest Soil | KQPAGLGIIHLTLQVPASAAPGARTLFIQSTNLDRTAASGVLEVR* |
| Ga0126381_1000537762 | 3300010376 | Tropical Forest Soil | MIHLTLQLPATAAPGARTLFIKNTNLDETAASGVLQVE* |
| Ga0137392_108501321 | 3300011269 | Vadose Zone Soil | AKQPAGLGIIHLTLQIPASATPGARTLFIQNTNLDKTAASGALKVE* |
| Ga0137389_105425941 | 3300012096 | Vadose Zone Soil | GIIHLTLQIPASAAPGARTLFIQNTNLDKTAASGVLEVN* |
| Ga0137389_112182502 | 3300012096 | Vadose Zone Soil | QPAGLGIIHLTIQIPSTALPGARALFVQNANLDKTAASGVLEIQ* |
| Ga0137388_101107931 | 3300012189 | Vadose Zone Soil | IIHLTLQLSAAAIPGARTLFIQNTNLEKTAATGALEVQ* |
| Ga0137388_102068351 | 3300012189 | Vadose Zone Soil | TLQIPANAAAGARTLFIRNTNLDKTAASGVLEVN* |
| Ga0137388_102656591 | 3300012189 | Vadose Zone Soil | VISKQPAGLGIIHLTLQIPVSAAPGARTLFVQNTNLDKTAASGVLEVY* |
| Ga0137388_115852312 | 3300012189 | Vadose Zone Soil | GIIHLTLQISATALPGARALFIQNTNLDKTAASGALEVQ* |
| Ga0137365_101098001 | 3300012201 | Vadose Zone Soil | KQPAGLGIIHLTLQIPASAAPGARTLFIQNTNLDKTAASGVLEVN* |
| Ga0137399_105707593 | 3300012203 | Vadose Zone Soil | AGLGIIHLTLQVTAGAQTGARTLFVQNTNLDKTAASGALEVQ* |
| Ga0137399_114667581 | 3300012203 | Vadose Zone Soil | LTIQIPSTALPGARTLFVQNANLDKTAASGVLEIQ* |
| Ga0137362_112511971 | 3300012205 | Vadose Zone Soil | QPAGLGIIHLTLQIPATAAPGARTLFIQNLNLDKTAASGVLEVN* |
| Ga0137380_101982361 | 3300012206 | Vadose Zone Soil | QPAGLGIIHLTLQIPATAAIGARTLFIQNTNLDKTAASGVLEVR* |
| Ga0137381_104755591 | 3300012207 | Vadose Zone Soil | QPAGLGIIHLTVQVHASALPGARTLFIQNTNLDKTAASGVLEVQ* |
| Ga0137381_107419583 | 3300012207 | Vadose Zone Soil | HVTLQIASSALPGARSLFIQNANLDKTAGSGALEVE* |
| Ga0137378_111415601 | 3300012210 | Vadose Zone Soil | QPAGLGIIHLTLQIPATAVPGARTLFIQNTNLDKTAASGVLEVN* |
| Ga0137384_101911853 | 3300012357 | Vadose Zone Soil | QPAGLGIIHLTLQIPATAVPGARTLFIQNSNLDKTAASGVLEVN* |
| Ga0137358_109219271 | 3300012582 | Vadose Zone Soil | GLGIIHLTLQVSAAAIPGARTLFIQNTNLDKTAATGALEVQ* |
| Ga0137394_105632691 | 3300012922 | Vadose Zone Soil | AGLGIIHLTLQVPATASPGARTVFIQNTNLDKTAASGVLEVN* |
| Ga0137416_103113743 | 3300012927 | Vadose Zone Soil | ISKQPAGLGIIHLTLQVPATASPGARTVFIQNTNLDKTAASGVLEVN* |
| Ga0137416_116853602 | 3300012927 | Vadose Zone Soil | VISKQPAGLGIIHLTLQVPASATPGARTLFIQNTNLDKTAASGVLEVQ* |
| Ga0153915_121919691 | 3300012931 | Freshwater Wetlands | IIHLTLQVASTTLPGARTLFIQNTNLDETAASGALEVK* |
| Ga0137410_100747581 | 3300012944 | Vadose Zone Soil | AGLGIIHLTLQVPASAAPSARTLFIQNTNLDKTAASGVLEVQ* |
| Ga0137410_104998203 | 3300012944 | Vadose Zone Soil | GIIHLTLQVPASAAPGARTLFIQNTNLDKTAASGVLEVQ* |
| Ga0126369_105483521 | 3300012971 | Tropical Forest Soil | GLGIIHLALQVPATASPGERTLFIQNTNLDKTAATGVLEVR* |
| Ga0120127_101084221 | 3300013503 | Permafrost | TLQLPATAAASARTLFIQNTNLDKTAASGTLWVN* |
| Ga0134075_100324321 | 3300014154 | Grasslands Soil | QPAGLGIIHLTLQVPANAAPGARTLFVQNTNLDKTAASGVLEVN* |
| Ga0134079_104423161 | 3300014166 | Grasslands Soil | AGLGIIHLTLQIPSTAAPGARTLFIQTTNLDKTAASGALEVR* |
| Ga0137405_13853971 | 3300015053 | Vadose Zone Soil | QPAGLGAILHLTLQILSTAQAGVRTLFIQNTNLDETAASGVLEVQ* |
| Ga0137403_104573033 | 3300015264 | Vadose Zone Soil | KQPVGLGIVHITLQISSTAIPGLRTLFVQNTNLDKAAASGALEVN* |
| Ga0187779_107544542 | 3300017959 | Tropical Peatland | LGIIRLTLQVAANAAAGARTIFIQTTNLDKTAASGALEVR |
| Ga0187804_103994981 | 3300018006 | Freshwater Sediment | IHLTLQVPATATPGARTLFIQNTNLDQTSASGVLQVQ |
| Ga0187883_103818512 | 3300018037 | Peatland | IIHLTLQIPATAEPGARSLFIQNANLDLTAATGALEVQ |
| Ga0187766_106208691 | 3300018058 | Tropical Peatland | IIHLTLQIPSTAAPGARTLFVQNANLDRTAASGVLEIE |
| Ga0187772_103832461 | 3300018085 | Tropical Peatland | ISQQPAGLGIIHLTLQVPATATAGARTLFIQNSNLDETSASGVLQVQ |
| Ga0066669_109274142 | 3300018482 | Grasslands Soil | GIIHLTMQISANAAPGARTLFIANTNLDMTAASGALEVN |
| Ga0193726_11454152 | 3300020021 | Soil | QPLGLGIIRLTLQLPATAAASTRTLFIQNTNLDKTAASGTLWVN |
| Ga0210403_105254333 | 3300020580 | Soil | LTIQIPSSALPGARTLFVQNANLDKTAASGVLEIQ |
| Ga0210395_104603343 | 3300020582 | Soil | KQPAGLGIIQLTLQVPSSALPGARTLFIQNTNLDETAASGALVIQ |
| Ga0215015_110238591 | 3300021046 | Soil | QRQMCIRDRPAGLWIIHLTLQIPAIGALGARTVFIQNTNLDKAAASGVLEVN |
| Ga0210406_110700432 | 3300021168 | Soil | HLTLQISAAAIPGARTLFIQNTNLDKTAATGALEVQ |
| Ga0210406_113680922 | 3300021168 | Soil | VISKQPAGLGIIHLALQIPAGAEPGARTLFIQNTNLDKTAASGTLEVE |
| Ga0210400_103446281 | 3300021170 | Soil | GIIHLTIQIPSTAPPGARTLFVQNPNLDKTAASGVLEIQ |
| Ga0210405_108149041 | 3300021171 | Soil | AQQRAGLGIIHLTLQISAAAIPGARSLFIQNTNLDKAAATGALEVQ |
| Ga0210393_108834561 | 3300021401 | Soil | KQPAGLGIIQLTLQVPSIALPGGRTLFIQNTNLDETAASGALDIQ |
| Ga0210386_107514811 | 3300021406 | Soil | PAGLGIIHLTLQISAAAIPGARTLFIQNTNLDKTAATGALEVQ |
| Ga0210394_114353471 | 3300021420 | Soil | LTIQIPSTALPGARTLFIQNANLDKTAASGVLEIQ |
| Ga0210402_118970652 | 3300021478 | Soil | QQPAGLGIIHLTLQISAAAIPGARTLFIQNTNLDKTAATGALEVQ |
| Ga0210410_109440472 | 3300021479 | Soil | VTLQISANAVPGARTVFIQNPNLDRAAASGALEVN |
| Ga0247687_10264731 | 3300024286 | Soil | IHLTLQIPATALPGARTLFLQNTNLDKTAASGALVVQ |
| Ga0208323_10100261 | 3300025439 | Peatland | LGIIHLTLQVPASATAGARTLFIQNANLDRTAATGALEIQ |
| Ga0208692_11135911 | 3300025472 | Peatland | IIHLTLQVPASATAGARTLFIQNANLDRTAATGALEIQ |
| Ga0209238_10559753 | 3300026301 | Grasslands Soil | GVIHLTLQILSTAQAGVRTLFIQNTNLDETAASGVLEVQ |
| Ga0209761_12138472 | 3300026313 | Grasslands Soil | IHLTLQISSTAAPGPRTLFIGNSNLDKTAATAALLVK |
| Ga0209131_12070951 | 3300026320 | Grasslands Soil | GLGIIHLTLQIPVSAAQGARTLFVQSTNLDKTAASGVLEVY |
| Ga0209152_101187881 | 3300026325 | Soil | HLTLQISASAIPGARTLLIQNTNLDETAATGALEVQ |
| Ga0209377_13141632 | 3300026334 | Soil | LTLQVPANAAPGARTLFVQNTNLDKTAASGVLEVN |
| Ga0209076_12157762 | 3300027643 | Vadose Zone Soil | VIAKQPAGLGIIHLTLQIPANAAPGARTLFIQNTNLDKTAASGVLEVN |
| Ga0209388_10793821 | 3300027655 | Vadose Zone Soil | IIHLTLQISAAAIPGARTLFIQNTNLDKTAATGALEVQ |
| Ga0209447_100158913 | 3300027701 | Bog Forest Soil | GILHITLVIPAAAAPGPRTLFIQTTNLDKTSASGAVILQ |
| Ga0209328_101479561 | 3300027727 | Forest Soil | PLGLGIIHLTLQISATALPGARTLFIQNTNLDKTAASGALEVQ |
| Ga0209074_100295563 | 3300027787 | Agricultural Soil | HLTLQVAAGAQPGARTLSIQNANLDKTAATGALEVQ |
| Ga0209656_101228681 | 3300027812 | Bog Forest Soil | LHVTLLLPAGSFTGPRTLFIQTTNLDKTSASGAVVIQ |
| Ga0209811_100516861 | 3300027821 | Surface Soil | QPVGLGIIHLTLQIPGTALPGARTLFLQNTNLDKTAASGALVVQ |
| Ga0209773_102365411 | 3300027829 | Bog Forest Soil | SQPAGLGIIELTLQVPASALPGARTLFIQNTNLDETAASGALVIQ |
| Ga0209274_100767131 | 3300027853 | Soil | ELTIQVPASALPGARTLFIQNTNLDETAASGALVIQ |
| Ga0209283_101472141 | 3300027875 | Vadose Zone Soil | PAGLGIIHLTLQVPANAAPGARTLFIQSTNLDKTAASGVLEVN |
| Ga0209488_101491943 | 3300027903 | Vadose Zone Soil | LTLQISAAAIPGARTLFIQDTNLDKTAATGALEVQ |
| Ga0209526_104629023 | 3300028047 | Forest Soil | QPAGLGIIHLTLQISAAAIPGVRTLFIQNTNLDKTAATGALEVQ |
| Ga0222749_102057881 | 3300029636 | Soil | IIHLTLQIPATTAPGARTLFIQNTNLDKTAASGALEVE |
| Ga0073994_120518582 | 3300030991 | Soil | PAGLGIIHLTLQISAAAIPGARTLFIQNTNLDKTAATGTLWVK |
| Ga0170834_1117521291 | 3300031057 | Forest Soil | QPLGLGIIRLTLQLPAAAAPSTRTLFIQNTNLDKTAATGTLWVK |
| Ga0170823_176630661 | 3300031128 | Forest Soil | KQPIGLGIVRITLQVPASALPGHRTLFVQNTNLDKAAASGALEVN |
| Ga0307477_106230071 | 3300031753 | Hardwood Forest Soil | PAGLGIIHLTLQVPATAATGARTLFIQNTNLDKTAASGVLEVY |
| Ga0307477_106930132 | 3300031753 | Hardwood Forest Soil | AKQPLGLGIVRITLQIPASALPGRRTLFVQNTNLDKTAASGAIEVN |
| Ga0307475_100664044 | 3300031754 | Hardwood Forest Soil | GLGIIHLTVQIPSSATPGARTLFIQNTNLDKTAASGVLEVE |
| Ga0307475_113353321 | 3300031754 | Hardwood Forest Soil | TKQPAGLGIIHITLQIPATAASGARTLFIQNTNLDKTAASGVLEVH |
| Ga0307478_106021031 | 3300031823 | Hardwood Forest Soil | HLTLQISAAAIPGARTLFIQNTSLDKTAATGALEVQ |
| Ga0307479_105222393 | 3300031962 | Hardwood Forest Soil | GLGIIHLTLQISAAAIPGARTLFIQNTSLDKTAATGALEVQ |
| Ga0307470_112472521 | 3300032174 | Hardwood Forest Soil | IIHLTLQVSASAIPGARALFIQNANLDKTAATGALEVQ |
| Ga0307471_1015803922 | 3300032180 | Hardwood Forest Soil | PAGLGIIHLTLQISAAAIPGARTLFIQNTNLDKTAATGDLEVQ |
| Ga0307471_1029827511 | 3300032180 | Hardwood Forest Soil | LTLQISAAAIPGARTLFIQNTNLDKTAASGALEVQ |
| Ga0306920_1020167833 | 3300032261 | Soil | PAGLGIIHLTLQVPASATPGARTLFIQNTNLDKTAASGALEVR |
| Ga0335085_103053891 | 3300032770 | Soil | IAEQPAGLGIIHLTLQIPSSALPGARTLFIQNTNLDKTAASGALVIQ |
| Ga0335081_107113061 | 3300032892 | Soil | GVIHLTLQIPASASPGERTLFIQNANLDRTAASGALRIQ |
| Ga0335077_110470131 | 3300033158 | Soil | AGLGIIHLTLQLPSTAAPGARTLFIQNANLDRTAASGVLEIQ |
| Ga0316212_10179411 | 3300033547 | Roots | LGIIQLTLQVPSSALPGARTLFIQNTNLDETAASGALVIQ |
| ⦗Top⦘ |