


| Basic Information | |
|---|---|
| Family ID | F081678 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 114 |
| Average Sequence Length | 39 residues |
| Representative Sequence | TAYQERDWLLVGLKTNFLLDPLRSDPRFAELVRKVGLPQ |
| Number of Associated Samples | 102 |
| Number of Associated Scaffolds | 114 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.88 % |
| % of genes near scaffold ends (potentially truncated) | 96.49 % |
| % of genes from short scaffolds (< 2000 bps) | 92.98 % |
| Associated GOLD sequencing projects | 100 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (92.982 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland (13.158 % of family members) |
| Environment Ontology (ENVO) | Unclassified (21.053 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (57.895 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 31.34% β-sheet: 0.00% Coil/Unstructured: 68.66% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 114 Family Scaffolds |
|---|---|---|
| PF00069 | Pkinase | 12.28 |
| PF00072 | Response_reg | 1.75 |
| PF00196 | GerE | 1.75 |
| PF01594 | AI-2E_transport | 1.75 |
| PF13181 | TPR_8 | 1.75 |
| PF07690 | MFS_1 | 1.75 |
| PF00857 | Isochorismatase | 1.75 |
| PF00486 | Trans_reg_C | 0.88 |
| PF03544 | TonB_C | 0.88 |
| PF00557 | Peptidase_M24 | 0.88 |
| PF02371 | Transposase_20 | 0.88 |
| PF13360 | PQQ_2 | 0.88 |
| PF01431 | Peptidase_M13 | 0.88 |
| PF05163 | DinB | 0.88 |
| PF00589 | Phage_integrase | 0.88 |
| PF02620 | YceD | 0.88 |
| PF13414 | TPR_11 | 0.88 |
| PF07676 | PD40 | 0.88 |
| PF14534 | DUF4440 | 0.88 |
| PF07702 | UTRA | 0.88 |
| PF09286 | Pro-kuma_activ | 0.88 |
| PF12681 | Glyoxalase_2 | 0.88 |
| PF13683 | rve_3 | 0.88 |
| PF13649 | Methyltransf_25 | 0.88 |
| PF00753 | Lactamase_B | 0.88 |
| PF01548 | DEDD_Tnp_IS110 | 0.88 |
| PF00881 | Nitroreductase | 0.88 |
| PF07730 | HisKA_3 | 0.88 |
| PF07883 | Cupin_2 | 0.88 |
| PF07366 | SnoaL | 0.88 |
| PF12833 | HTH_18 | 0.88 |
| PF04237 | YjbR | 0.88 |
| PF00717 | Peptidase_S24 | 0.88 |
| PF10543 | ORF6N | 0.88 |
| PF08238 | Sel1 | 0.88 |
| PF00478 | IMPDH | 0.88 |
| PF13519 | VWA_2 | 0.88 |
| PF00149 | Metallophos | 0.88 |
| PF00293 | NUDIX | 0.88 |
| PF00775 | Dioxygenase_C | 0.88 |
| PF13474 | SnoaL_3 | 0.88 |
| PF01734 | Patatin | 0.88 |
| PF00155 | Aminotran_1_2 | 0.88 |
| PF07681 | DoxX | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 114 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 49.12 |
| COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 1.75 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 1.75 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.75 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.75 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.88 |
| COG1399 | 23S rRNA accumulation protein YceD (essential in plants, uncharacterized in bacteria) | Translation, ribosomal structure and biogenesis [J] | 0.88 |
| COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 0.88 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.88 |
| COG2315 | Predicted DNA-binding protein with ‘double-wing’ structural motif, MmcQ/YjbR family | Transcription [K] | 0.88 |
| COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.88 |
| COG3485 | Protocatechuate 3,4-dioxygenase beta subunit | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.88 |
| COG3590 | Predicted metalloendopeptidase | Posttranslational modification, protein turnover, chaperones [O] | 0.88 |
| COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 0.88 |
| COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.88 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.88 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.88 |
| COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.88 |
| COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.88 |
| COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 0.88 |
| COG4934 | Serine protease, subtilase family | Posttranslational modification, protein turnover, chaperones [O] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.98 % |
| Unclassified | root | N/A | 7.02 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001867|JGI12627J18819_10220782 | Not Available | 764 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100024310 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5272 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100271187 | All Organisms → cellular organisms → Bacteria | 1583 | Open in IMG/M |
| 3300004080|Ga0062385_10290510 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 932 | Open in IMG/M |
| 3300004139|Ga0058897_11009142 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300004633|Ga0066395_10131568 | All Organisms → cellular organisms → Bacteria | 1247 | Open in IMG/M |
| 3300005178|Ga0066688_10611561 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 700 | Open in IMG/M |
| 3300005332|Ga0066388_101862056 | All Organisms → cellular organisms → Bacteria | 1072 | Open in IMG/M |
| 3300005436|Ga0070713_101305591 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300005468|Ga0070707_100517060 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1156 | Open in IMG/M |
| 3300005586|Ga0066691_10354972 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 868 | Open in IMG/M |
| 3300005598|Ga0066706_11038981 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 629 | Open in IMG/M |
| 3300005614|Ga0068856_101238995 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 762 | Open in IMG/M |
| 3300005841|Ga0068863_101788462 | Not Available | 624 | Open in IMG/M |
| 3300005993|Ga0080027_10477006 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300006028|Ga0070717_10014943 | All Organisms → cellular organisms → Bacteria | 5979 | Open in IMG/M |
| 3300006031|Ga0066651_10706499 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 542 | Open in IMG/M |
| 3300006052|Ga0075029_100903318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 606 | Open in IMG/M |
| 3300006059|Ga0075017_100012932 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5322 | Open in IMG/M |
| 3300006173|Ga0070716_100651379 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300006174|Ga0075014_100059929 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1664 | Open in IMG/M |
| 3300006175|Ga0070712_100044740 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 3054 | Open in IMG/M |
| 3300006176|Ga0070765_100139602 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2149 | Open in IMG/M |
| 3300006791|Ga0066653_10364961 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 734 | Open in IMG/M |
| 3300006800|Ga0066660_11008915 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 668 | Open in IMG/M |
| 3300006854|Ga0075425_100491798 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1413 | Open in IMG/M |
| 3300007076|Ga0075435_100001019 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 17756 | Open in IMG/M |
| 3300009500|Ga0116229_11641921 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300009545|Ga0105237_11645914 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 649 | Open in IMG/M |
| 3300009661|Ga0105858_1283074 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 515 | Open in IMG/M |
| 3300010043|Ga0126380_10150071 | All Organisms → cellular organisms → Bacteria | 1491 | Open in IMG/M |
| 3300010048|Ga0126373_11892641 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 660 | Open in IMG/M |
| 3300010339|Ga0074046_10534497 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 698 | Open in IMG/M |
| 3300010366|Ga0126379_13781707 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
| 3300010379|Ga0136449_100707371 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1688 | Open in IMG/M |
| 3300010868|Ga0124844_1095649 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1125 | Open in IMG/M |
| 3300010868|Ga0124844_1295340 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 550 | Open in IMG/M |
| 3300011269|Ga0137392_11370725 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 566 | Open in IMG/M |
| 3300012198|Ga0137364_10794206 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 715 | Open in IMG/M |
| 3300012205|Ga0137362_11631336 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 532 | Open in IMG/M |
| 3300012210|Ga0137378_10133431 | All Organisms → cellular organisms → Bacteria | 2296 | Open in IMG/M |
| 3300012357|Ga0137384_10501651 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
| 3300012971|Ga0126369_10912207 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 964 | Open in IMG/M |
| 3300013102|Ga0157371_10698103 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 759 | Open in IMG/M |
| 3300014158|Ga0181521_10279667 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 866 | Open in IMG/M |
| 3300014168|Ga0181534_10107057 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1404 | Open in IMG/M |
| 3300014499|Ga0182012_10590642 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 715 | Open in IMG/M |
| 3300015374|Ga0132255_105284212 | Not Available | 547 | Open in IMG/M |
| 3300016371|Ga0182034_10268326 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1354 | Open in IMG/M |
| 3300016387|Ga0182040_11855636 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
| 3300017935|Ga0187848_10314952 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 651 | Open in IMG/M |
| 3300017959|Ga0187779_10078323 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1962 | Open in IMG/M |
| 3300017959|Ga0187779_10606658 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300017959|Ga0187779_11116707 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300017961|Ga0187778_11139103 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
| 3300017970|Ga0187783_10300141 | All Organisms → cellular organisms → Bacteria | 1172 | Open in IMG/M |
| 3300017972|Ga0187781_10392569 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 990 | Open in IMG/M |
| 3300017972|Ga0187781_10999270 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 611 | Open in IMG/M |
| 3300017974|Ga0187777_10287021 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1123 | Open in IMG/M |
| 3300017974|Ga0187777_10821783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas lutea | 665 | Open in IMG/M |
| 3300017975|Ga0187782_10630974 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 824 | Open in IMG/M |
| 3300017975|Ga0187782_10917703 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 679 | Open in IMG/M |
| 3300018009|Ga0187884_10063842 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1680 | Open in IMG/M |
| 3300018019|Ga0187874_10458516 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 513 | Open in IMG/M |
| 3300018062|Ga0187784_10603032 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
| 3300018062|Ga0187784_11190187 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 605 | Open in IMG/M |
| 3300018090|Ga0187770_11211825 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 610 | Open in IMG/M |
| 3300018090|Ga0187770_11333020 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 582 | Open in IMG/M |
| 3300020170|Ga0179594_10359678 | Not Available | 552 | Open in IMG/M |
| 3300020579|Ga0210407_10312157 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1228 | Open in IMG/M |
| 3300020580|Ga0210403_10173871 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1765 | Open in IMG/M |
| 3300021170|Ga0210400_10647751 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 870 | Open in IMG/M |
| 3300021401|Ga0210393_10139154 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1948 | Open in IMG/M |
| 3300021404|Ga0210389_10157629 | All Organisms → cellular organisms → Bacteria | 1762 | Open in IMG/M |
| 3300021406|Ga0210386_11414173 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
| 3300021432|Ga0210384_11288786 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 635 | Open in IMG/M |
| 3300021477|Ga0210398_10285771 | Not Available | 1345 | Open in IMG/M |
| 3300026041|Ga0207639_10740070 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
| 3300026078|Ga0207702_11173621 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 762 | Open in IMG/M |
| 3300026215|Ga0209849_1017135 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1207 | Open in IMG/M |
| 3300026297|Ga0209237_1278667 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 513 | Open in IMG/M |
| 3300026317|Ga0209154_1223041 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 703 | Open in IMG/M |
| 3300026467|Ga0257154_1033340 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300026490|Ga0257153_1003333 | All Organisms → cellular organisms → Bacteria | 3106 | Open in IMG/M |
| 3300026529|Ga0209806_1122554 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1050 | Open in IMG/M |
| 3300026547|Ga0209156_10211157 | Not Available | 921 | Open in IMG/M |
| 3300026698|Ga0208843_100618 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 631 | Open in IMG/M |
| 3300027095|Ga0208606_107443 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
| 3300027535|Ga0209734_1013123 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1502 | Open in IMG/M |
| 3300027842|Ga0209580_10514896 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 595 | Open in IMG/M |
| 3300027862|Ga0209701_10698108 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300027879|Ga0209169_10062803 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1922 | Open in IMG/M |
| 3300027879|Ga0209169_10064833 | All Organisms → cellular organisms → Bacteria | 1889 | Open in IMG/M |
| 3300029903|Ga0247271_132364 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 510 | Open in IMG/M |
| 3300029913|Ga0311362_10551300 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1047 | Open in IMG/M |
| 3300029943|Ga0311340_11292096 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300030044|Ga0302281_10411170 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
| 3300030057|Ga0302176_10357782 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
| 3300031232|Ga0302323_101800636 | Not Available | 693 | Open in IMG/M |
| 3300031754|Ga0307475_10510341 | All Organisms → cellular organisms → Bacteria | 965 | Open in IMG/M |
| 3300031754|Ga0307475_10894363 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 701 | Open in IMG/M |
| 3300031833|Ga0310917_10833230 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300031941|Ga0310912_10325755 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1191 | Open in IMG/M |
| 3300031941|Ga0310912_10716541 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 775 | Open in IMG/M |
| 3300031954|Ga0306926_11692587 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 722 | Open in IMG/M |
| 3300031962|Ga0307479_11400050 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300032205|Ga0307472_100352460 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1209 | Open in IMG/M |
| 3300032261|Ga0306920_102346839 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 738 | Open in IMG/M |
| 3300032770|Ga0335085_11007161 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 900 | Open in IMG/M |
| 3300032782|Ga0335082_10405118 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1228 | Open in IMG/M |
| 3300032783|Ga0335079_11473915 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 673 | Open in IMG/M |
| 3300032895|Ga0335074_10384889 | Not Available | 1534 | Open in IMG/M |
| 3300032898|Ga0335072_10505290 | All Organisms → cellular organisms → Bacteria | 1251 | Open in IMG/M |
| 3300033004|Ga0335084_10302797 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1652 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 13.16% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.40% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.89% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.14% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.26% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.26% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.39% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.51% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.51% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.51% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.51% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.63% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.63% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.63% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.75% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.75% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.75% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.75% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.88% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.88% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.88% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.88% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.88% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.88% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.88% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.88% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.88% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.88% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.88% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.88% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.88% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.88% |
| Host-Associated | Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated | 0.88% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004139 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF230 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009500 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009661 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-062 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
| 3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
| 3300014499 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaG | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
| 3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026215 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 (SPAdes) | Environmental | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026467 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-A | Environmental | Open in IMG/M |
| 3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026698 | Forest soil microbial communities from Willamette National Forest, Oregon, USA, amended with Nitrogen - NN411 (SPAdes) | Environmental | Open in IMG/M |
| 3300027095 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF020 (SPAdes) | Environmental | Open in IMG/M |
| 3300027535 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300029903 | Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Fen703 | Environmental | Open in IMG/M |
| 3300029913 | III_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030044 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_2 | Environmental | Open in IMG/M |
| 3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12627J18819_102207821 | 3300001867 | Forest Soil | RDFNLISLKTDFLLNPLRSDPRFAELVSKVGLPQ* |
| JGIcombinedJ26739_1000243101 | 3300002245 | Forest Soil | YEERDYQVESLRTDFRLDLMRSDPRFAELVRKVGLPQ* |
| JGIcombinedJ26739_1002711871 | 3300002245 | Forest Soil | REHDWLLMALNTEFQLDPVRSDPRFAELVCKVGLPQ* |
| Ga0062385_102905101 | 3300004080 | Bog Forest Soil | WLNTAFQEHDIGLMGLKTDFMLDSLRYDPRLAELVRKVGLPQ* |
| Ga0058897_110091422 | 3300004139 | Forest Soil | DTAYQERDAGLLGLKTDYLLDSLRSDTRFPELVHNVGLPQ* |
| Ga0066395_101315682 | 3300004633 | Tropical Forest Soil | LDAAFEDRDIGLMRLKTDFLLDRLRSDPRFPELVRKVGLSQ* |
| Ga0066688_106115611 | 3300005178 | Soil | KAYQARDYRMTQLNVRNDLDSLRSDPRFTELVRKVGLPQ* |
| Ga0066388_1018620561 | 3300005332 | Tropical Forest Soil | WLNTAYQERDSLSLLGLKTDFLLDPLRSDPRFAELVRKVGLPQ* |
| Ga0070713_1013055912 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | DTAYQERDLYLLGLKVDFQFDPLRSDPPFAELVRKVGLPQ* |
| Ga0070707_1005170603 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | NTAYNERDKWLEGLKTDFVLDPIRSDPRFLELVRNVGLPQ* |
| Ga0066691_103549722 | 3300005586 | Soil | QERYAQLPNLETDFLLDPIRSDPRLAELVRKVGLPQ* |
| Ga0066706_110389811 | 3300005598 | Soil | LNTAYDERDGRLVGLKTDFRLNRLHSDPRFAELVRKVGLPQ* |
| Ga0068856_1012389951 | 3300005614 | Corn Rhizosphere | TAYQERDWLLVSLKTNFLLDPLRSDPRFAELVRKVGLPQ* |
| Ga0068863_1017884621 | 3300005841 | Switchgrass Rhizosphere | YQEHDIGLIRLKTDFLLDPLRHDPRFAVMIRKVGLPE* |
| Ga0080027_104770061 | 3300005993 | Prmafrost Soil | LLIERELGLRGLRTDFLLVRSDPRFAELVGKMGLPH* |
| Ga0070717_100149435 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MWFQTAYQERDRLLLDLKTDCGLDLVRSDPRFAELVRKVGLPQ* |
| Ga0066651_107064991 | 3300006031 | Soil | ERDIGLLRLKTDFRLDSLRSDPRLAGLVRKVGLPH* |
| Ga0075029_1009033182 | 3300006052 | Watersheds | IETAYRERDGIGLIDLKTDFLLDPIRSDSRFAEWMKKIGFPQ* |
| Ga0075017_1000129321 | 3300006059 | Watersheds | NTAYKERDGWLVGLKTDFSLDPIRSDPRFAELVRKVGLPQ* |
| Ga0070716_1006513791 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | WLDTARQERDYLLLGLKTDFSLDTIRSDPRFAELVRKVGLPQ* |
| Ga0075014_1000599294 | 3300006174 | Watersheds | AYKERDGWLVGLKTDFSLDPIRSDPRFAELVRKVGLPQ* |
| Ga0070712_1000447401 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | TAYQERDWLLVGLKTNFLLDPLRSDPRFAELVRKVGLPQ* |
| Ga0070765_1001396021 | 3300006176 | Soil | EERDYQMESLRTDFRLDPVRSDPRFAELVRKVGLPQ* |
| Ga0066653_103649612 | 3300006791 | Soil | YQERDIGLLRLKTDFRLDSLRSDPRLAGLVRKVGLPH* |
| Ga0066660_110089151 | 3300006800 | Soil | NTAYQERDWLLVGLKTNFLLDPIRSDPRFAELVRKVGLPQ* |
| Ga0075425_1004917981 | 3300006854 | Populus Rhizosphere | RDLGLLSLKTDFLLDPLRPDPRLAEVVRKVGLPSW* |
| Ga0075435_1000010191 | 3300007076 | Populus Rhizosphere | SRGLTRHTQEHDQGLIALRTDYTLDSLRSDPRYTELVRKVGLPQ* |
| Ga0116229_116419212 | 3300009500 | Host-Associated | LDTAHQERDWLLTALKTDFLLDPLHSDPRFEQLARKIGLPGGK* |
| Ga0105237_116459141 | 3300009545 | Corn Rhizosphere | NTAYQERDWLLIGLKTDFLLDPIRSDPRFAELVRKVGLPQ* |
| Ga0105858_12830741 | 3300009661 | Permafrost Soil | RDLSLEGLKTDFLLDPLRSDPRFAELVRKVGLPQ* |
| Ga0126380_101500712 | 3300010043 | Tropical Forest Soil | AYQERGICLVGLKTNFLLDPIRSDPRFAELARKVGLPQ* |
| Ga0126373_118926411 | 3300010048 | Tropical Forest Soil | RDNHLEALKTDFLLDPLRSDIRFAELVRKVGLPQ* |
| Ga0074046_105344971 | 3300010339 | Bog Forest Soil | HDEELMGLKTDYSLDPVRSDPRFAELVRKVGLPQ* |
| Ga0126379_137817071 | 3300010366 | Tropical Forest Soil | AYQERDQGLLSLKTDLLLDPLRSDPRFAELVRKIRLPQ* |
| Ga0136449_1007073715 | 3300010379 | Peatlands Soil | WLNTAYQERDNRLEGLKTDFLLDPLRSDIRFAELVRKVGLPQ* |
| Ga0124844_10956491 | 3300010868 | Tropical Forest Soil | ERDQQMSDLETDFFFDFDTIRSDPRFAELVRKVGLPQ* |
| Ga0124844_12953402 | 3300010868 | Tropical Forest Soil | RDQQMSDLETDFFFDTIRSDPRFAELVRKVGLPQ* |
| Ga0137392_113707251 | 3300011269 | Vadose Zone Soil | QERDFNLIGLKNDFLLDPLRSDPRFAELVRKVGLPQ* |
| Ga0137364_107942061 | 3300012198 | Vadose Zone Soil | YQERDAQLPNLETDFLLDPIRSDPRLAELVRKVGLPQ* |
| Ga0137362_116313361 | 3300012205 | Vadose Zone Soil | YQEHDWLLGDLKTNLLLDPIRSDPRFAELVRKVGLQQ* |
| Ga0137378_101334311 | 3300012210 | Vadose Zone Soil | KWLDTAYQERDVGLEFLKTDFLLDPLRADSRFAELVSKVGLPQ* |
| Ga0137384_105016511 | 3300012357 | Vadose Zone Soil | KEHDWLLEGLKTDFLFDPIRSDPRFAELVRKVGLPQ* |
| Ga0126369_109122071 | 3300012971 | Tropical Forest Soil | QERDSLSLLGLKTDFLLDPLRSDPRFAELVRKVGLPQ* |
| Ga0157371_106981032 | 3300013102 | Corn Rhizosphere | WLNTAYQERDWLLIGLKTDFLLDPIRSDPRFAELVRKVALPQ* |
| Ga0181521_102796671 | 3300014158 | Bog | WLDTAYREHDFLLKELNTAFEVDSLRSDPRFAELVNTVGLPKLR* |
| Ga0181534_101070572 | 3300014168 | Bog | DGPHQIESLRTDFRLDPVRSDPRFAELVRKVGLPQ* |
| Ga0182012_105906422 | 3300014499 | Bog | DIAYREHDWTLIGLNSYFQFDPLRSDPRFAELVKKIGLPQISR* |
| Ga0132255_1052842121 | 3300015374 | Arabidopsis Rhizosphere | AYRERDALLEGLNTDFLLDPLRSDLRFIDLVHKVGLP* |
| Ga0182034_102683262 | 3300016371 | Soil | YQEHDWQLEGLNSDFYIDPLRSDPRFAELVRKVGLPQ |
| Ga0182040_118556361 | 3300016387 | Soil | IAYQDRDSALVGLKTDFALDPIRSDPRFAELVRKVGLPQ |
| Ga0187848_103149522 | 3300017935 | Peatland | YQEHDWLLIGLKTFVPFDPLRSDPRYAAMVRKVGLP |
| Ga0187779_100783233 | 3300017959 | Tropical Peatland | LNTAYQEHDGQLEGSKTDFLVDPLRSDPRFAELVRKVGLPQ |
| Ga0187779_106066581 | 3300017959 | Tropical Peatland | FQEREIGMMGLRTDFLLDSLATDPRFAELVRKVGLPQ |
| Ga0187779_111167071 | 3300017959 | Tropical Peatland | LNTAYQEHDWLLLSLKNNSELEAVRSDPRFAELVRQVGLPE |
| Ga0187778_111391033 | 3300017961 | Tropical Peatland | ERDWLLVDLKTDFLVDPLRSDPRFAELVRKVGLPQ |
| Ga0187783_103001413 | 3300017970 | Tropical Peatland | WLNTAFQEHDWWLFGLKTDFALDPIRADPRFAELVRKVGLPQ |
| Ga0187781_103925692 | 3300017972 | Tropical Peatland | LNTALQEHDWWLIRLKTDFALDPIRSDLRFAELVRKVGLPQ |
| Ga0187781_109992702 | 3300017972 | Tropical Peatland | YQEHDMGLISLKIDYSLDSLRSDPRFAELVRKVGLP |
| Ga0187777_102870211 | 3300017974 | Tropical Peatland | EHDEYLMGLKTDFLLDPLRSDPRFAELVRKMGLPQ |
| Ga0187777_108217832 | 3300017974 | Tropical Peatland | RDPGLIGLRTDFLLDPLRSDPRYVDLVRKMNFPSPAK |
| Ga0187782_106309742 | 3300017975 | Tropical Peatland | DWLLEGLNTLSQFDSLRADPRFGELVNKVGLPKLPR |
| Ga0187782_109177031 | 3300017975 | Tropical Peatland | YQERDFFLLGLRTDFALDPLRSDPRFPELIRKVGLPQ |
| Ga0187884_100638423 | 3300018009 | Peatland | FRWLNIAYQEHDWLLIGLKTFIPLAPLRSDPRFAELVHKVGLPQ |
| Ga0187874_104585161 | 3300018019 | Peatland | TAYREHDWLLPGLNTYFQLDPLRSDPRFAELVHKVGLPQ |
| Ga0187784_106030321 | 3300018062 | Tropical Peatland | FMWLNTAFQEHDWWLLGLKTDFALDPIRADPRFAELVRKVGLLP |
| Ga0187784_111901872 | 3300018062 | Tropical Peatland | QEHDISLMDLKTDYTLDSLRSDPRFAELVRKVGLPQ |
| Ga0187770_112118252 | 3300018090 | Tropical Peatland | AYREHDWLLKELNTAYQVDSLRSDPRFAELVKKVGLPKVR |
| Ga0187770_113330201 | 3300018090 | Tropical Peatland | VEHDRLLIGLNTYFQLDPVRSDPRFAELVRKVGLPP |
| Ga0179594_103596781 | 3300020170 | Vadose Zone Soil | AYQEHDTELIGLRTDFRFDSLRSDWRYIELVRKVGLPRS |
| Ga0210407_103121571 | 3300020579 | Soil | YQEHDWLLMGLNTYFQLDPLRSDPRFTELVRKVGLPQ |
| Ga0210403_101738711 | 3300020580 | Soil | NAAYEERDYQIESLKTDFRLDSVRSDPRFVELVRKVGLPQ |
| Ga0210400_106477511 | 3300021170 | Soil | TAAYEERDYQMESLRTDFRLDPVRSDPRFAELVRKVGLPQS |
| Ga0210393_101391543 | 3300021401 | Soil | DTAYQEHDWLLMGLNTYFQLDPLRSDPRFTELVRKVGLPQ |
| Ga0210389_101576291 | 3300021404 | Soil | MAYQERESGMKMLKTDYLLDPLRSDPRFPELLRKVGLPQ |
| Ga0210386_114141732 | 3300021406 | Soil | DTAYREHDWLLIGLNTYFQLDPIRSDPRFAELVRKVGLPH |
| Ga0210384_112887862 | 3300021432 | Soil | YRERDLLLLGVKTDDSLDPIRSDPRFAELVRKVGLPL |
| Ga0210398_102857711 | 3300021477 | Soil | NLAYQEHDWLLITLNTHYALDPLRSDPRFAELVRKVGLPQ |
| Ga0207639_107400701 | 3300026041 | Corn Rhizosphere | RGWEIRDSGLLNLKTDVLLDPLRSDGRFAALLAKVGFPA |
| Ga0207702_111736211 | 3300026078 | Corn Rhizosphere | TAYQERDWLLVSLKTNFLLDPLRSDPRFAELVRKVGLPQ |
| Ga0209849_10171351 | 3300026215 | Soil | ERDFFLFGLKADFLLDQLHSDPRFAELVRKVGLPQ |
| Ga0209237_12786671 | 3300026297 | Grasslands Soil | NTAYQERGAFMLGLKTDFLLDPLHSDPRFDELVRKVGLPI |
| Ga0209154_12230412 | 3300026317 | Soil | KAYQGRDYQMTELNVRPELDSLRSDPRLAELARRVGLPQ |
| Ga0257154_10333402 | 3300026467 | Soil | YREHDWLLEGLNTYAQLDSLRSDPRFAALVSKVGLPK |
| Ga0257153_10033332 | 3300026490 | Soil | MRFETAYQERDRLLTDLKTDYGLDLVRSDPRFAELARKVGLPQ |
| Ga0209806_11225544 | 3300026529 | Soil | QERDFNLIGLKTDFLLDPLRSDPRFAELVRKVGLPQ |
| Ga0209156_102111571 | 3300026547 | Soil | ERDIGLLRLKTDFRLDSLRSDPRLAGLVRNVGLPH |
| Ga0208843_1006182 | 3300026698 | Soil | RWLNTACQERDSSLEGLKTDFLLDPLRSDRRFAELVRKVGLPQ |
| Ga0208606_1074431 | 3300027095 | Forest Soil | AYQEHDLGLLSLKTDFLLDPLRSDPRLAELVKKVGLP |
| Ga0209734_10131231 | 3300027535 | Forest Soil | NTAYYERDRLMLGLKADFPLDSLRSDPRFAELVRKVGLPQ |
| Ga0209580_105148962 | 3300027842 | Surface Soil | RWLDVAYHERDREMIGLITDVQLESLRSDPRFAELVRKVGLPQ |
| Ga0209701_106981082 | 3300027862 | Vadose Zone Soil | YQERDANCTLIKNDFAMDRLRSDPRFAELVRKVGLPQKRKQFGLET |
| Ga0209169_100628032 | 3300027879 | Soil | DTAYREHDWLLMALNTEFQLDPVRSDPRFAELVRKVGLPQ |
| Ga0209169_100648331 | 3300027879 | Soil | DTAYREHDWLLMALNTEFQLDPVRSDPRFAELVCKVGLPQ |
| Ga0247271_1323642 | 3300029903 | Soil | AYREHDWLLIGLKTFIPLAPLRSDPRFAELVRKVGLPQ |
| Ga0311362_105513002 | 3300029913 | Bog | IAYQQHDWLLIGLNTYFQLDPLRSDPRFAELVRKVGLPQ |
| Ga0311340_112920961 | 3300029943 | Palsa | WLDTAYREHDFLLNGIRTEFQFDVLRSDPRFAELVSKVGLPKVQ |
| Ga0302281_104111702 | 3300030044 | Fen | HDWTLIGLNSYFQFDPLRSDPRFAELVKKIGLPQISR |
| Ga0302176_103577821 | 3300030057 | Palsa | QEHDWLLIGLKTFIPFAPLRSDPRFAELAHKIGLPD |
| Ga0302323_1018006362 | 3300031232 | Fen | AYQEREWQMTSLKTDFLLDPLRSDSRLNQLVRKMGLPE |
| Ga0307475_105103411 | 3300031754 | Hardwood Forest Soil | NIAYQERDWWMENLKTDFLLDPIRSDPRFSELVRKVGLPQ |
| Ga0307475_108943632 | 3300031754 | Hardwood Forest Soil | VQMWFETAYQERDRLLTDLKTDYGLDVVRSDPRYAELVRKVGLPQ |
| Ga0310917_108332302 | 3300031833 | Soil | TAYQERDFWLLGLKTDYSLDPIRSDPRFAELVRKVGLPQ |
| Ga0310912_103257551 | 3300031941 | Soil | ERDYPLTGLNTDFLLDSLRSDPRFAELARKVGLPL |
| Ga0310912_107165411 | 3300031941 | Soil | EHDLGLLSLNTDFLLDSLRADPRMSKLVRKVGLPQ |
| Ga0306926_116925872 | 3300031954 | Soil | AYSDRDIGLIRLKTDFLLDPLRSDPRLLELARKVGLSH |
| Ga0307479_114000502 | 3300031962 | Hardwood Forest Soil | MWFETAYQERDRLLTDLKTDYGLDVVRSDPRYAELVRKVGLPQ |
| Ga0307472_1003524603 | 3300032205 | Hardwood Forest Soil | HAFEWLNVAYQERDDNLINLKTQFTLDSLRPDPRFAEMVRKVGLPQ |
| Ga0306920_1023468392 | 3300032261 | Soil | ALQEHDQGLIGLKTDYTLDSIRSDPRFAELVRKVGLPQ |
| Ga0335085_110071611 | 3300032770 | Soil | RAGFPVARHAYQERDWLLEGLDTDFVLDPLRSDSRFAELVRKVGLPQ |
| Ga0335082_104051181 | 3300032782 | Soil | QWLNTAYQERDWLLMGLKTDFLVDPLRSDARFAELVRKVGLPQ |
| Ga0335079_114739153 | 3300032783 | Soil | QEHDEGLEGLKTDFSLDPLRSDPRFAELVRKVGLPQ |
| Ga0335074_103848892 | 3300032895 | Soil | MGTAYRLHDSLYQLNTDFMLDPLRSDPRFATLAKKVGLPQ |
| Ga0335072_105052904 | 3300032898 | Soil | NTAYQEKDWLLTSLKTDYLLDPLRSDPRFEELVRKIGLP |
| Ga0335084_103027973 | 3300033004 | Soil | ERDGKVAGLRVDFLLDPLHSDPHFAELVRKVGLPQ |
| ⦗Top⦘ |