


| Basic Information | |
|---|---|
| Family ID | F081633 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 114 |
| Average Sequence Length | 44 residues |
| Representative Sequence | PGGTLTFLGKKPATEDVRHQELLGKMERLAQEIALLRGSQPPARA |
| Number of Associated Samples | 99 |
| Number of Associated Scaffolds | 114 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 83.33 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.491 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (33.333 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.702 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.877 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.99% β-sheet: 0.00% Coil/Unstructured: 63.01% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 114 Family Scaffolds |
|---|---|---|
| PF14235 | DUF4337 | 71.93 |
| PF00202 | Aminotran_3 | 14.91 |
| PF00490 | ALAD | 6.14 |
| PF03900 | Porphobil_deamC | 1.75 |
| PF04674 | Phi_1 | 0.88 |
| PF13519 | VWA_2 | 0.88 |
| PF07519 | Tannase | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 114 Family Scaffolds |
|---|---|---|---|
| COG0113 | Delta-aminolevulinic acid dehydratase, porphobilinogen synthase | Coenzyme transport and metabolism [H] | 6.14 |
| COG0181 | Porphobilinogen deaminase | Coenzyme transport and metabolism [H] | 1.75 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.49 % |
| Unclassified | root | N/A | 3.51 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300003351|JGI26346J50198_1002168 | All Organisms → cellular organisms → Bacteria | 1727 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10368766 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300004620|Ga0068957_1200629 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
| 3300005166|Ga0066674_10270999 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 801 | Open in IMG/M |
| 3300005175|Ga0066673_10555343 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 672 | Open in IMG/M |
| 3300005176|Ga0066679_10244190 | All Organisms → cellular organisms → Bacteria | 1155 | Open in IMG/M |
| 3300005177|Ga0066690_10045796 | All Organisms → cellular organisms → Bacteria | 2642 | Open in IMG/M |
| 3300005332|Ga0066388_103011840 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
| 3300005447|Ga0066689_10205853 | All Organisms → cellular organisms → Bacteria | 1196 | Open in IMG/M |
| 3300005534|Ga0070735_10056772 | All Organisms → cellular organisms → Bacteria | 2567 | Open in IMG/M |
| 3300005542|Ga0070732_10355079 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
| 3300005921|Ga0070766_11256735 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 513 | Open in IMG/M |
| 3300006032|Ga0066696_10381217 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
| 3300006047|Ga0075024_100882168 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
| 3300006162|Ga0075030_100757136 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300006174|Ga0075014_100666112 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 602 | Open in IMG/M |
| 3300006794|Ga0066658_10726913 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 551 | Open in IMG/M |
| 3300006797|Ga0066659_10047885 | All Organisms → cellular organisms → Bacteria | 2680 | Open in IMG/M |
| 3300007255|Ga0099791_10590176 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 543 | Open in IMG/M |
| 3300007258|Ga0099793_10379312 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 693 | Open in IMG/M |
| 3300007265|Ga0099794_10039628 | All Organisms → cellular organisms → Bacteria | 2237 | Open in IMG/M |
| 3300007265|Ga0099794_10344470 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 775 | Open in IMG/M |
| 3300009012|Ga0066710_101564044 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
| 3300009012|Ga0066710_104189414 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
| 3300009038|Ga0099829_10941336 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 717 | Open in IMG/M |
| 3300009088|Ga0099830_10114613 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2032 | Open in IMG/M |
| 3300010048|Ga0126373_11522799 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 734 | Open in IMG/M |
| 3300010336|Ga0134071_10069953 | All Organisms → cellular organisms → Bacteria | 1626 | Open in IMG/M |
| 3300010366|Ga0126379_13012517 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 564 | Open in IMG/M |
| 3300011120|Ga0150983_16335072 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 635 | Open in IMG/M |
| 3300011269|Ga0137392_10368770 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1190 | Open in IMG/M |
| 3300011270|Ga0137391_10189737 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1790 | Open in IMG/M |
| 3300011271|Ga0137393_10345643 | All Organisms → cellular organisms → Bacteria | 1270 | Open in IMG/M |
| 3300011271|Ga0137393_11054087 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 691 | Open in IMG/M |
| 3300012096|Ga0137389_10281279 | All Organisms → cellular organisms → Bacteria | 1405 | Open in IMG/M |
| 3300012202|Ga0137363_10868360 | Not Available | 766 | Open in IMG/M |
| 3300012205|Ga0137362_10272911 | All Organisms → cellular organisms → Bacteria | 1462 | Open in IMG/M |
| 3300012207|Ga0137381_11369239 | Not Available | 600 | Open in IMG/M |
| 3300012209|Ga0137379_10989517 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 746 | Open in IMG/M |
| 3300012349|Ga0137387_10170819 | All Organisms → cellular organisms → Bacteria | 1554 | Open in IMG/M |
| 3300012362|Ga0137361_11628889 | Not Available | 566 | Open in IMG/M |
| 3300012917|Ga0137395_10631462 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 774 | Open in IMG/M |
| 3300012918|Ga0137396_10252790 | All Organisms → cellular organisms → Bacteria | 1300 | Open in IMG/M |
| 3300012918|Ga0137396_10762729 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 712 | Open in IMG/M |
| 3300012922|Ga0137394_10007871 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 8256 | Open in IMG/M |
| 3300012925|Ga0137419_10463548 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
| 3300012925|Ga0137419_10704111 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 820 | Open in IMG/M |
| 3300012925|Ga0137419_11022523 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 685 | Open in IMG/M |
| 3300012927|Ga0137416_10460782 | All Organisms → cellular organisms → Bacteria | 1089 | Open in IMG/M |
| 3300012931|Ga0153915_10371759 | All Organisms → cellular organisms → Bacteria | 1612 | Open in IMG/M |
| 3300012944|Ga0137410_10024922 | All Organisms → cellular organisms → Bacteria | 4146 | Open in IMG/M |
| 3300014150|Ga0134081_10028523 | Not Available | 1606 | Open in IMG/M |
| 3300014157|Ga0134078_10037420 | All Organisms → cellular organisms → Bacteria | 1624 | Open in IMG/M |
| 3300015054|Ga0137420_1080690 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 739 | Open in IMG/M |
| 3300015054|Ga0137420_1238011 | All Organisms → cellular organisms → Bacteria | 1556 | Open in IMG/M |
| 3300015054|Ga0137420_1365689 | All Organisms → cellular organisms → Bacteria | 1076 | Open in IMG/M |
| 3300015054|Ga0137420_1381579 | All Organisms → cellular organisms → Bacteria | 2267 | Open in IMG/M |
| 3300016357|Ga0182032_10000967 | All Organisms → cellular organisms → Bacteria | 12532 | Open in IMG/M |
| 3300017656|Ga0134112_10103325 | All Organisms → cellular organisms → Bacteria | 1072 | Open in IMG/M |
| 3300017961|Ga0187778_10001539 | All Organisms → cellular organisms → Bacteria | 15899 | Open in IMG/M |
| 3300017966|Ga0187776_10843564 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 661 | Open in IMG/M |
| 3300017974|Ga0187777_10461383 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
| 3300018006|Ga0187804_10026895 | All Organisms → cellular organisms → Bacteria | 2142 | Open in IMG/M |
| 3300018431|Ga0066655_10053782 | All Organisms → cellular organisms → Bacteria | 2088 | Open in IMG/M |
| 3300018482|Ga0066669_12027793 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
| 3300020170|Ga0179594_10427305 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300020579|Ga0210407_11272703 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 550 | Open in IMG/M |
| 3300021088|Ga0210404_10365756 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 802 | Open in IMG/M |
| 3300021088|Ga0210404_10667684 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300021178|Ga0210408_10622984 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
| 3300021406|Ga0210386_10243763 | All Organisms → cellular organisms → Bacteria | 1532 | Open in IMG/M |
| 3300021433|Ga0210391_10363180 | All Organisms → cellular organisms → Bacteria | 1136 | Open in IMG/M |
| 3300021477|Ga0210398_10166455 | All Organisms → cellular organisms → Bacteria | 1795 | Open in IMG/M |
| 3300021559|Ga0210409_10132670 | All Organisms → cellular organisms → Bacteria | 2286 | Open in IMG/M |
| 3300021560|Ga0126371_11210903 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
| 3300024279|Ga0247692_1076688 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300024330|Ga0137417_1294351 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 787 | Open in IMG/M |
| 3300026316|Ga0209155_1257526 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
| 3300026317|Ga0209154_1216185 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 722 | Open in IMG/M |
| 3300026323|Ga0209472_1026303 | All Organisms → cellular organisms → Bacteria | 2709 | Open in IMG/M |
| 3300026360|Ga0257173_1059461 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
| 3300026482|Ga0257172_1065083 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 668 | Open in IMG/M |
| 3300026508|Ga0257161_1058425 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 784 | Open in IMG/M |
| 3300026515|Ga0257158_1029658 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
| 3300026548|Ga0209161_10084381 | All Organisms → cellular organisms → Bacteria | 1958 | Open in IMG/M |
| 3300026548|Ga0209161_10319428 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 723 | Open in IMG/M |
| 3300026552|Ga0209577_10090975 | All Organisms → cellular organisms → Bacteria | 2491 | Open in IMG/M |
| 3300026555|Ga0179593_1172992 | All Organisms → cellular organisms → Bacteria | 2377 | Open in IMG/M |
| 3300026999|Ga0207949_1029197 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
| 3300027674|Ga0209118_1086756 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300027775|Ga0209177_10263772 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 642 | Open in IMG/M |
| 3300027829|Ga0209773_10111277 | All Organisms → cellular organisms → Bacteria | 1134 | Open in IMG/M |
| 3300027846|Ga0209180_10453915 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300027846|Ga0209180_10702868 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
| 3300027855|Ga0209693_10265007 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 841 | Open in IMG/M |
| 3300027875|Ga0209283_10745566 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 608 | Open in IMG/M |
| 3300027882|Ga0209590_11005908 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
| 3300027889|Ga0209380_10398149 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300027889|Ga0209380_10533346 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 683 | Open in IMG/M |
| 3300027903|Ga0209488_10991823 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
| 3300028065|Ga0247685_1017829 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300031679|Ga0318561_10036007 | All Organisms → cellular organisms → Bacteria | 2417 | Open in IMG/M |
| 3300031715|Ga0307476_10302387 | All Organisms → cellular organisms → Bacteria | 1173 | Open in IMG/M |
| 3300031718|Ga0307474_10239774 | All Organisms → cellular organisms → Bacteria | 1387 | Open in IMG/M |
| 3300031720|Ga0307469_10879509 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
| 3300031754|Ga0307475_10603733 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300031754|Ga0307475_10607898 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300031754|Ga0307475_11148359 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 606 | Open in IMG/M |
| 3300031796|Ga0318576_10046127 | All Organisms → cellular organisms → Bacteria | 1873 | Open in IMG/M |
| 3300031820|Ga0307473_10044663 | All Organisms → cellular organisms → Bacteria | 2051 | Open in IMG/M |
| 3300031962|Ga0307479_10002665 | All Organisms → cellular organisms → Bacteria | 16209 | Open in IMG/M |
| 3300032042|Ga0318545_10244060 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 645 | Open in IMG/M |
| 3300032065|Ga0318513_10261846 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300032955|Ga0335076_11713090 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 33.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 10.53% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 7.02% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.51% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.51% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.51% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.51% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.63% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.63% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.63% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.75% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.75% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.75% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.88% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.88% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.88% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.88% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.88% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.88% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300003351 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004620 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 49 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024279 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK33 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026360 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-B | Environmental | Open in IMG/M |
| 3300026482 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B | Environmental | Open in IMG/M |
| 3300026508 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-A | Environmental | Open in IMG/M |
| 3300026515 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-A | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300026999 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF044 (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028065 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK26 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI26346J50198_10021683 | 3300003351 | Bog Forest Soil | ILEPSGTLSFVGKKPATEEIRHQELLRHMEQLMEEIGRLRGSKPPARA* |
| JGIcombinedJ51221_103687662 | 3300003505 | Forest Soil | EPGGTLCFVGKKPGTEDLRHKELLGKLESLAREIALLRGSQPPARA* |
| Ga0068957_12006291 | 3300004620 | Peatlands Soil | LTFLGKKPRGEDVRHQELLGKLDLLSKEITLLRSSQPPARA* |
| Ga0066674_102709991 | 3300005166 | Soil | CVLEPGGTLTFLAKKPAVEDVRHQELLGKLERLAQEIALLRGSQPPTRA* |
| Ga0066673_105553432 | 3300005175 | Soil | VEQCVLEPGGTMTFIGKKPGVEDVRHQELLGKMESLAHEIALLRGSQPPARA* |
| Ga0066679_102441903 | 3300005176 | Soil | VLEPGGTLTFLGKKPTGEDVRHQELLGKLERLAQEIALLRGSQPPASA* |
| Ga0066690_100457961 | 3300005177 | Soil | GTLTFLGKKPTGEDVRHQELLGKLERLAQEIALLRGSQPPASA* |
| Ga0066388_1030118401 | 3300005332 | Tropical Forest Soil | LEPGGTMTFIGKKPGTEDVRHQELLGKLERLAQEISLVRGAQPPARA* |
| Ga0066689_102058533 | 3300005447 | Soil | VNQCILEPGGTLTFVGKKPGTEDVRHKELLDRLDLLTKEIATLRESQPPARA* |
| Ga0070735_100567721 | 3300005534 | Surface Soil | ILEPSGTLSFVAKKPATEDVRHQELLGRLEKLMEEIVRLRGSQPPARA* |
| Ga0070732_103550791 | 3300005542 | Surface Soil | KKPASEEIRHQELLTHLEKLMEQVVRLRSPQPPARA* |
| Ga0070766_112567351 | 3300005921 | Soil | EPSGTLSFVGRKPATEDLRHRELLARLEKLMEEVVRLRGSQPPARA* |
| Ga0066696_103812171 | 3300006032 | Soil | FLGKKPAVEDVRHQELLGKLERLAQEIALLRGSQPPARA* |
| Ga0075024_1008821682 | 3300006047 | Watersheds | LTFVGKKPASEELRHLELVGKLERLTQEIALLRGSQPPARA* |
| Ga0075030_1007571362 | 3300006162 | Watersheds | KKPPAEELRQQELLQGLEKLTEEIVRLRGSQPPAHA* |
| Ga0075014_1006661122 | 3300006174 | Watersheds | CILEPGGTLSFVGKKPASDEVRHQQLLSRLEKLMEEVVRLRASQPPAQA* |
| Ga0066658_107269131 | 3300006794 | Soil | QCVLEPGGTLTFLGKKPSVEDVRHQELLGKLERLAQEIALLRGSQPPARA* |
| Ga0066659_100478854 | 3300006797 | Soil | VGKKPASEELRHQELLGKLEHLTQEIALLRGSQPPARA* |
| Ga0099791_105901761 | 3300007255 | Vadose Zone Soil | VGKKPGTEDVRHKELLDRLDLLTKEIATLRGSQPPARA* |
| Ga0099793_103793121 | 3300007258 | Vadose Zone Soil | TFVGKKPGTEDVRHKELLDRLDLLTKEITALRGSQPPARA* |
| Ga0099794_100396284 | 3300007265 | Vadose Zone Soil | EVAQCILEPGGTLTFVGKKPGTEDVRHKELLDRLDLLTKEITALRGSQPPARA* |
| Ga0099794_103444701 | 3300007265 | Vadose Zone Soil | TLTFVGKKPGTEDVRHKELLDRLDLLTKEIATLRGSQPPARA* |
| Ga0066710_1015640443 | 3300009012 | Grasslands Soil | GGTLTFVGKKPATEEVRHQELVGKLERLTQEIALLRGSQPPARA |
| Ga0066710_1041894141 | 3300009012 | Grasslands Soil | EVEQCVLEPGGTLTFLGKKPAVEDVRHQELLGKLERLAQEIALLRGSQPPARLT |
| Ga0099829_109413362 | 3300009038 | Vadose Zone Soil | LTFVGKKPGTEDVRHKELLDRLDLLTKEISALRGSQPPARA* |
| Ga0099830_101146131 | 3300009088 | Vadose Zone Soil | KKPASEELRHQELLGKLERLAQEIALLRGSQPPARA* |
| Ga0126373_115227992 | 3300010048 | Tropical Forest Soil | FIGKKPGTEDVRHQELLGKLERLAQEIALLRGSQPPARA* |
| Ga0134071_100699533 | 3300010336 | Grasslands Soil | VLEPGGTLTFLGKKPAVEDVRHQELLGKLERLAQEIALLRGLQPPARA* |
| Ga0126379_130125172 | 3300010366 | Tropical Forest Soil | SEVSQCVLEPGGTLTFLGKKPPAEEVRHQELLGKMESLAQEIALLRGSARA* |
| Ga0150983_163350722 | 3300011120 | Forest Soil | SFLGKKPGTEDVRHQDLVARLERLTKEIALLRGSQPPARA* |
| Ga0137392_103687703 | 3300011269 | Vadose Zone Soil | GTLTFLAKKPTSEDVRHQELLGKLERLTQEIAQLRGSQPPARA* |
| Ga0137391_101897371 | 3300011270 | Vadose Zone Soil | GGTLTFLGKKPTGEDVRHQELVGKLERLTQEIALLRGSQPPARA* |
| Ga0137393_103456431 | 3300011271 | Vadose Zone Soil | CVLEPGGTLTFLGKKPSGEDVRHQELIGKLERLGQEIALLRGSQPQASA* |
| Ga0137393_110540871 | 3300011271 | Vadose Zone Soil | DVEQCVLEPGGTLTFIGKKPGSEDVRHQELIGRLERLAQEIALLRSSQPPARA* |
| Ga0137389_102812791 | 3300012096 | Vadose Zone Soil | CILEPGGTLTFLAKKPSGEDVRHQELLGKLDRLTQEIAQLRGSQPPARA* |
| Ga0137363_108683602 | 3300012202 | Vadose Zone Soil | FIGKKPGSEDVRHQELIGRLERLAQELALLRSSQPPTRA* |
| Ga0137362_102729113 | 3300012205 | Vadose Zone Soil | VLEPGGTLTFTGKKPTSEDVRHQELLGRLELLAKEITLLRGSQPPARA* |
| Ga0137381_113692391 | 3300012207 | Vadose Zone Soil | VEQCVLEPGGTLTFIGKKPGSEDVRHQELIGRLERLAQEIALLRSSQPPARA* |
| Ga0137379_109895171 | 3300012209 | Vadose Zone Soil | KPTGEDVRHQQLLGKLELLAQEIALLRSSQPPARA* |
| Ga0137387_101708191 | 3300012349 | Vadose Zone Soil | LEPGGTLTFLGNKPTGEDLRHQELVGKLERLTQEIALLRGSQPPARA* |
| Ga0137361_116288892 | 3300012362 | Vadose Zone Soil | GTLTFIGKKPGSEDVRHQELIGRLERLAQELALLRSSQPPTRA* |
| Ga0137395_106314621 | 3300012917 | Vadose Zone Soil | PGGSLTFMGKKPAPEEVRHQELLASINQLAAEIAALRTTLPKG* |
| Ga0137396_102527901 | 3300012918 | Vadose Zone Soil | KPTGEDVRHQELLGKLDRLAQEIALLRGSQPPARA* |
| Ga0137396_107627291 | 3300012918 | Vadose Zone Soil | EPGGTLTFVGKKPGTEDGRHKGLLDRLDLLAKEITGLGGSQPPARA* |
| Ga0137394_100078711 | 3300012922 | Vadose Zone Soil | KKPTGEDVRHQELVGKLDRLTQEIALFRGSQPPARA* |
| Ga0137419_104635481 | 3300012925 | Vadose Zone Soil | KKPGTEDVRHKELLDRLDLLTKEITALGGSQPPARA* |
| Ga0137419_107041113 | 3300012925 | Vadose Zone Soil | EPGGTLTFLGKKPTGEDVRHQELVGKLERLTQEIALLRGSQPPARA* |
| Ga0137419_110225231 | 3300012925 | Vadose Zone Soil | VLEPGGTLTFVAKKPATEDVRHQELLAKLERLTQEIAILRGSQPPARA* |
| Ga0137416_104607823 | 3300012927 | Vadose Zone Soil | FLGKKPTGEDVRHQELVGKLERLTQEIALLRGSQPPSRA* |
| Ga0153915_103717591 | 3300012931 | Freshwater Wetlands | CILEPSGTLSFTGKKPPAEEVRHQERLDRMEQLMEEIVRLRGSQPPARA* |
| Ga0137410_100249226 | 3300012944 | Vadose Zone Soil | LTFVGKKPGTEDVRHKELLDRLDLLTKEIVTLRGSQPPARA* |
| Ga0134081_100285233 | 3300014150 | Grasslands Soil | FLVKKPPTEEVRHQELLGRLESLAHEIALLRGSQPPARA* |
| Ga0134078_100374201 | 3300014157 | Grasslands Soil | PASEELRHQELLGKLEHLTQEIALLRGSQPPARA* |
| Ga0137420_10806901 | 3300015054 | Vadose Zone Soil | RRHTLLEPGGTLTFVGKKPAAEDVRHQELLGKLERLTQEIALLRGSQPPARA* |
| Ga0137420_12380113 | 3300015054 | Vadose Zone Soil | LTFVGKKPAAEDVRHQELLGKLERLTQEIALLRGSQPPARA* |
| Ga0137420_13656893 | 3300015054 | Vadose Zone Soil | TLTFLGKKPTGEDLRHQELVGKLERLTQEIALLRGSQPPSRA* |
| Ga0137420_13815794 | 3300015054 | Vadose Zone Soil | TLTFLGKKPTGEDVRHQELVGKLERLTQEIALLRSSQPPARA* |
| Ga0182032_100009671 | 3300016357 | Soil | VSQCILEPGGTLTFLGKKPPAEEVRHRELLGKMESLAHEIALLRGSWPPARA |
| Ga0134112_101033253 | 3300017656 | Grasslands Soil | VLEPGGTLTFIGKKPGSEDVRHQELIGRLERLAQELALLRSSQPPARA |
| Ga0187778_1000153916 | 3300017961 | Tropical Peatland | QCVLEPGGTLTFLGKKPDTEDIRHRELLGKLEVLAREIATLRSSQPPARA |
| Ga0187776_108435642 | 3300017966 | Tropical Peatland | CVLEPGGTLTFLGKKPPTEEIRHQELLGKLERLAQEVALLRSSQPPARA |
| Ga0187777_104613833 | 3300017974 | Tropical Peatland | EQCVLEPGGTLTFLGKKPDAEDIRHRELLGKLEQLAKEIATLRSSQPPARA |
| Ga0187804_100268954 | 3300018006 | Freshwater Sediment | EQCILEPGGTLTFLGKKPSGEDVRHQELLGRLELLAQELAALRGSQPPARA |
| Ga0066655_100537821 | 3300018431 | Grasslands Soil | VNQCVLEPGGTLTFLGKKPATEDVRHQELLGKMERLAQEIALLRGSQPPARA |
| Ga0066669_120277931 | 3300018482 | Grasslands Soil | QCVLEPGGTLTFLGKKPTGEDMRHQELVGKLERLTQEIALLRGSQPPARA |
| Ga0179594_104273052 | 3300020170 | Vadose Zone Soil | EPGGTLTFLGKKPTGEDIRHQELLGKLERLAQEIALLRGSQPPARG |
| Ga0210407_112727031 | 3300020579 | Soil | PGGVLCFVGKKPATDELRHQEVMQRIEKLMEEVVRLRRVEPPARA |
| Ga0210404_103657563 | 3300021088 | Soil | VLEPGGTLTFLGKKPTGEDVRHQELVGKLDRLTQEIALLRGSQPPARA |
| Ga0210404_106676841 | 3300021088 | Soil | LEPGGTLSFVGKKPATEDVRHQELLGRLERLTEEVVRLRSPEPPART |
| Ga0210408_106229841 | 3300021178 | Soil | CVLEPGGTLTFLAKKPSSEDVRHRELLGKLEGLAQEIALMRSSQPPPGA |
| Ga0210386_102437631 | 3300021406 | Soil | SFVAKKPATEDVRHRELVSHLEKLMEEIARLKASQPPARA |
| Ga0210391_103631801 | 3300021433 | Soil | RSPATEDLRHQELLGRMEKLMEEIVRLRGSQPPARA |
| Ga0210398_101664551 | 3300021477 | Soil | KPATEDVRHQELLARLEKLMEEVSRLRGSQPPARA |
| Ga0210409_101326704 | 3300021559 | Soil | KKPATEDVRHQELLGKLDRLTQEITLLKGSQPPARA |
| Ga0126371_112109031 | 3300021560 | Tropical Forest Soil | FIGKKPATEDVRHQELLGKMESLGHEIALLRSSQPPAHS |
| Ga0247692_10766881 | 3300024279 | Soil | TGKKPASEEVRHQELLARMEKLMEEIVRLRGSQPPARA |
| Ga0137417_12943513 | 3300024330 | Vadose Zone Soil | KKPTGEDVRHQELVGKLDRPTQEIALLRGSRPPARA |
| Ga0209155_12575262 | 3300026316 | Soil | GKKPATEDVRHQELLGKMVRLAQEIALLRGSQPPARA |
| Ga0209154_12161852 | 3300026317 | Soil | LTFLGKKPSVEDVRHQELLGKLERLAQEIALLRGSQPPARA |
| Ga0209472_10263034 | 3300026323 | Soil | PGGTLTFLGKKPATEDVRHQELLGKMERLAQEIALLRGSQPPARA |
| Ga0257173_10594612 | 3300026360 | Soil | VNQCILEPGGTLSFVGKKPGTEDVRHKELLDRLDILTKEIATLRGSQPPARA |
| Ga0257172_10650831 | 3300026482 | Soil | VEQCVLEPGGTLTFLGKKPTGEDVRHQELVGKLDRLTKEIALLRGSQPPARA |
| Ga0257161_10584253 | 3300026508 | Soil | TFLGKKPTGEDVRHQELVGKLERLTQEIALLRGSQPPSRA |
| Ga0257158_10296583 | 3300026515 | Soil | EVQQCVLEPGGTLTFLGKKPSGEDVRHQELLGKLERLAQEIARLRGSQPPARA |
| Ga0209161_100843811 | 3300026548 | Soil | PGGTLTFVGKKPAAEEVRHHELLGKVESLAHEIALLRGSWPPARA |
| Ga0209161_103194282 | 3300026548 | Soil | AKKPAVEDVRHQELLGKLERLAQEIALLRGSQPPTRA |
| Ga0209577_100909754 | 3300026552 | Soil | CVLEPGGTLTFLGKKPTGEDLRHQELVGKLERLTQEIALLRGSQPPARA |
| Ga0179593_11729921 | 3300026555 | Vadose Zone Soil | FLGKKPTGEDVRHQELVGKLERLTQEIALLRGSQPPSRA |
| Ga0207949_10291972 | 3300026999 | Forest Soil | KPSGEDVRHQELLGKLEGLAQEIARLRGSQPPARA |
| Ga0209118_10867561 | 3300027674 | Forest Soil | EPGGTLTFLGKKPTGEDVRHQELVGKLERLTQEIALLRGAQPQARA |
| Ga0209177_102637722 | 3300027775 | Agricultural Soil | GTLTFLGKKPGVEDVRHQELLGKMESLAHEISLLRGSQPPARA |
| Ga0209773_101112773 | 3300027829 | Bog Forest Soil | LSFVGKKPATEDVRHQELLNRLEKLMEEVSRLRGSQPPARA |
| Ga0209180_104539151 | 3300027846 | Vadose Zone Soil | LCFVAKKPATEELRHQEVLLRIERLMEEVVRMRGVEPPARA |
| Ga0209180_107028682 | 3300027846 | Vadose Zone Soil | FVGKKPGTEDVRHKELLDRLDLLTKEISALRGSQPPARA |
| Ga0209693_102650071 | 3300027855 | Soil | PGGTLSFVGRKPGTEDVRHQELVSRLEKLMEEVARLRGSQPPARA |
| Ga0209283_107455661 | 3300027875 | Vadose Zone Soil | GKKPASEELRHQELLGKLERLAQEIALLRGSQPPARA |
| Ga0209590_110059081 | 3300027882 | Vadose Zone Soil | WTLTFLGKKPTGEDLRHQELVGKLERLTQEIALLRGSQPPARA |
| Ga0209380_103981492 | 3300027889 | Soil | VQRCILEPGGTLTFIAKKPATEDLRHQELLTRLETLMREVAMLRGGQPPVGA |
| Ga0209380_105333462 | 3300027889 | Soil | EPSGTLSFVGRKPATEDLRHRELLARLEKLMEEVVRLRGSQPPARA |
| Ga0209488_109918231 | 3300027903 | Vadose Zone Soil | AVERCVLEPGGTLTFLGKKPTGEDVRHQELVGKLERLTQEIALLRGSQPPSRA |
| Ga0247685_10178291 | 3300028065 | Soil | KCILEPSGTLSFTGKKPASEEVRHQELLARMEKLMEEIVRLRGSQPPARA |
| Ga0318561_100360071 | 3300031679 | Soil | LSDVSQCILEPGGTLTFLGKKPPAEEVRHRELLGKMESLAHEIALLRGSWPPARA |
| Ga0307476_103023871 | 3300031715 | Hardwood Forest Soil | LSFVGRKPATEDLRHQELIGRLERLMEEVVRLKGAQPPARA |
| Ga0307474_102397741 | 3300031718 | Hardwood Forest Soil | LGKKPSGEDVRHQELVGKLERLAQEIALLRGSQPPARA |
| Ga0307469_108795092 | 3300031720 | Hardwood Forest Soil | FTGKKPASEEVRHQELLARLEKLMEEIVRLRGSQPPTRA |
| Ga0307475_106037333 | 3300031754 | Hardwood Forest Soil | LGKKPSGEDVRHQELLGKLERLTQEISQLRGSQPPAHA |
| Ga0307475_106078981 | 3300031754 | Hardwood Forest Soil | GGTLTFVGKKPTGEDVRHQELLGKLERLGQEIALLRGSQPPARA |
| Ga0307475_111483592 | 3300031754 | Hardwood Forest Soil | GKKPTGEDVRHQELLGKLERLTQEIALLRGSQPPTRA |
| Ga0318576_100461273 | 3300031796 | Soil | LTFLGKKPPAEEVRHRELLGKMESLAHEIALLRGSWPPARA |
| Ga0307473_100446633 | 3300031820 | Hardwood Forest Soil | CVLEPGGTLTFVAKKPATEDVRHQELLNRLDVLVKEMTALRGSQPPARA |
| Ga0307479_100026651 | 3300031962 | Hardwood Forest Soil | PGGTLTFLGKKPTGEDVRHQELVGKLERLTQEIALLRSSQPPARA |
| Ga0318545_102440602 | 3300032042 | Soil | LEPGGTLTFLGKKPPAEEVRHRELLGKMESLAHEIALLRGSWPPARA |
| Ga0318513_102618461 | 3300032065 | Soil | PGGTLTFLGKKPPAEEVRHRELLGKMESLAHEIALLRGSWPPARA |
| Ga0335076_117130901 | 3300032955 | Soil | EPGGTLSFVAKRPATEDVRHQELVGRLEKLMEEVIRLKQVPPAKA |
| ⦗Top⦘ |