


| Basic Information | |
|---|---|
| Family ID | F081499 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 114 |
| Average Sequence Length | 40 residues |
| Representative Sequence | VKVFSLENAYVVEQAQVIKNTEGSNEAIVTGEMADTPPGS |
| Number of Associated Samples | 90 |
| Number of Associated Scaffolds | 114 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 64.04 % |
| % of genes near scaffold ends (potentially truncated) | 27.19 % |
| % of genes from short scaffolds (< 2000 bps) | 80.70 % |
| Associated GOLD sequencing projects | 86 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.26 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (62.281 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment (19.298 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.070 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (32.456 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 26.47% β-sheet: 0.00% Coil/Unstructured: 73.53% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.26 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 114 Family Scaffolds |
|---|---|---|
| PF08388 | GIIM | 13.16 |
| PF00078 | RVT_1 | 9.65 |
| PF00106 | adh_short | 1.75 |
| PF03401 | TctC | 0.88 |
| PF00501 | AMP-binding | 0.88 |
| PF02744 | GalP_UDP_tr_C | 0.88 |
| PF01661 | Macro | 0.88 |
| PF00440 | TetR_N | 0.88 |
| PF07646 | Kelch_2 | 0.88 |
| PF01609 | DDE_Tnp_1 | 0.88 |
| PF00557 | Peptidase_M24 | 0.88 |
| PF11453 | DUF2950 | 0.88 |
| PF13414 | TPR_11 | 0.88 |
| PF00210 | Ferritin | 0.88 |
| PF13098 | Thioredoxin_2 | 0.88 |
| PF02353 | CMAS | 0.88 |
| PF01266 | DAO | 0.88 |
| PF13669 | Glyoxalase_4 | 0.88 |
| PF14236 | DUF4338 | 0.88 |
| PF02515 | CoA_transf_3 | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 114 Family Scaffolds |
|---|---|---|---|
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.88 |
| COG2110 | O-acetyl-ADP-ribose deacetylase (regulator of RNase III), contains Macro domain | Translation, ribosomal structure and biogenesis [J] | 0.88 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.88 |
| COG2227 | 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase | Coenzyme transport and metabolism [H] | 0.88 |
| COG2230 | Cyclopropane fatty-acyl-phospholipid synthase and related methyltransferases | Lipid transport and metabolism [I] | 0.88 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.88 |
| COG3055 | N-acetylneuraminic acid mutarotase | Cell wall/membrane/envelope biogenesis [M] | 0.88 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.88 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.88 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.88 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.88 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.88 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 66.67 % |
| Unclassified | root | N/A | 33.33 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908035|B3_GZOS_CLC_ConsensusfromContig82742 | Not Available | 763 | Open in IMG/M |
| 2140918008|ConsensusfromContig3145 | Not Available | 901 | Open in IMG/M |
| 3300000229|TB_LI09_3DRAFT_1057320 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Thermodesulfovibrionia → Thermodesulfovibrionales → Thermodesulfovibrionaceae → Thermodesulfovibrio → unclassified Thermodesulfovibrio → Thermodesulfovibrio sp. RBG_19FT_COMBO_42_12 | 876 | Open in IMG/M |
| 3300000491|ML8_100867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 2940 | Open in IMG/M |
| 3300000493|MLSed_106020 | Not Available | 620 | Open in IMG/M |
| 3300000558|Draft_10083530 | All Organisms → cellular organisms → Bacteria | 2513 | Open in IMG/M |
| 3300001580|Draft_10354121 | Not Available | 615 | Open in IMG/M |
| 3300001580|Draft_10354654 | Not Available | 615 | Open in IMG/M |
| 3300002538|JGI24132J36420_10000815 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 14526 | Open in IMG/M |
| 3300002549|JGI24130J36418_10090680 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Thermodesulfovibrionia → Thermodesulfovibrionales → Thermodesulfovibrionaceae → Thermodesulfovibrio → unclassified Thermodesulfovibrio → Thermodesulfovibrio sp. RBG_19FT_COMBO_42_12 | 711 | Open in IMG/M |
| 3300002569|JGI24136J36422_10148757 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Thermodesulfovibrionia → Thermodesulfovibrionales → Thermodesulfovibrionaceae → Thermodesulfovibrio → unclassified Thermodesulfovibrio → Thermodesulfovibrio sp. RBG_19FT_COMBO_42_12 | 608 | Open in IMG/M |
| 3300002703|draft_10957164 | Not Available | 818 | Open in IMG/M |
| 3300002703|draft_10957219 | Not Available | 819 | Open in IMG/M |
| 3300002703|draft_11059126 | Not Available | 2405 | Open in IMG/M |
| 3300003852|Ga0031655_10336342 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300005601|Ga0070722_10504943 | Not Available | 543 | Open in IMG/M |
| 3300005821|Ga0078746_1097491 | Not Available | 676 | Open in IMG/M |
| 3300005832|Ga0074469_11172422 | All Organisms → cellular organisms → Bacteria | 1295 | Open in IMG/M |
| 3300005833|Ga0074472_11404381 | All Organisms → cellular organisms → Bacteria | 965 | Open in IMG/M |
| 3300005938|Ga0066795_10156367 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Thermodesulfovibrionia → Thermodesulfovibrionales → Thermodesulfovibrionaceae → Thermodesulfovibrio → unclassified Thermodesulfovibrio → Thermodesulfovibrio sp. RBG_19FT_COMBO_42_12 | 680 | Open in IMG/M |
| 3300005938|Ga0066795_10224273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella | 557 | Open in IMG/M |
| 3300006094|Ga0082037_1010880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1742 | Open in IMG/M |
| 3300006224|Ga0079037_101501693 | Not Available | 672 | Open in IMG/M |
| 3300006972|Ga0075518_1047755 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Thermodesulfovibrionia → Thermodesulfovibrionales → Thermodesulfovibrionaceae → Thermodesulfovibrio → unclassified Thermodesulfovibrio → Thermodesulfovibrio sp. RBG_19FT_COMBO_42_12 | 857 | Open in IMG/M |
| 3300008517|Ga0111034_1238490 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium S5133MH4 | 1028 | Open in IMG/M |
| 3300009034|Ga0115863_1244492 | All Organisms → cellular organisms → Bacteria | 2137 | Open in IMG/M |
| 3300009034|Ga0115863_1381429 | All Organisms → cellular organisms → Bacteria | 1639 | Open in IMG/M |
| 3300009034|Ga0115863_1393157 | Not Available | 1609 | Open in IMG/M |
| 3300009034|Ga0115863_1684093 | All Organisms → cellular organisms → Bacteria | 1152 | Open in IMG/M |
| 3300009039|Ga0105152_10038106 | All Organisms → cellular organisms → Bacteria | 1910 | Open in IMG/M |
| 3300009039|Ga0105152_10126821 | Not Available | 1042 | Open in IMG/M |
| 3300009091|Ga0102851_10352701 | Not Available | 1462 | Open in IMG/M |
| 3300009135|Ga0118736_10006862 | All Organisms → cellular organisms → Bacteria | 2509 | Open in IMG/M |
| 3300009150|Ga0114921_10066601 | All Organisms → cellular organisms → Bacteria | 2305 | Open in IMG/M |
| 3300009150|Ga0114921_10093831 | All Organisms → cellular organisms → Bacteria | 1981 | Open in IMG/M |
| 3300009150|Ga0114921_10686048 | Not Available | 756 | Open in IMG/M |
| 3300009171|Ga0105101_10341940 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300009388|Ga0103809_1050388 | Not Available | 500 | Open in IMG/M |
| 3300009499|Ga0114930_10529561 | Not Available | 528 | Open in IMG/M |
| 3300010392|Ga0118731_109880520 | Not Available | 899 | Open in IMG/M |
| 3300010429|Ga0116241_10086919 | Not Available | 2747 | Open in IMG/M |
| 3300010430|Ga0118733_102715734 | Not Available | 977 | Open in IMG/M |
| 3300010932|Ga0137843_1044014 | All Organisms → cellular organisms → Archaea → environmental samples → uncultured archaeon GZfos18F2 | 999 | Open in IMG/M |
| 3300011118|Ga0114922_10767141 | Not Available | 789 | Open in IMG/M |
| 3300011407|Ga0137450_1058477 | Not Available | 717 | Open in IMG/M |
| 3300012931|Ga0153915_12314113 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Thermodesulfovibrionia → Thermodesulfovibrionales → Thermodesulfovibrionaceae → Thermodesulfovibrio → unclassified Thermodesulfovibrio → Thermodesulfovibrio sp. RBG_19FT_COMBO_42_12 | 629 | Open in IMG/M |
| 3300012964|Ga0153916_10906770 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
| 3300014656|Ga0180007_10656107 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Thermodesulfovibrionia → Thermodesulfovibrionales → Thermodesulfovibrionaceae → Thermodesulfovibrio → unclassified Thermodesulfovibrio → Thermodesulfovibrio sp. RBG_19FT_COMBO_42_12 | 624 | Open in IMG/M |
| 3300014913|Ga0164310_10508504 | Not Available | 700 | Open in IMG/M |
| 3300014914|Ga0164311_10428286 | Not Available | 766 | Open in IMG/M |
| 3300015370|Ga0180009_10018267 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 5825 | Open in IMG/M |
| 3300017931|Ga0187877_1360183 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Thermodesulfovibrionia → Thermodesulfovibrionales → Thermodesulfovibrionaceae → Thermodesulfovibrio → unclassified Thermodesulfovibrio → Thermodesulfovibrio sp. RBG_19FT_COMBO_42_12 | 551 | Open in IMG/M |
| 3300017989|Ga0180432_10624917 | Not Available | 765 | Open in IMG/M |
| 3300018005|Ga0187878_1063789 | All Organisms → cellular organisms → Bacteria | 1606 | Open in IMG/M |
| 3300018015|Ga0187866_1284754 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Thermodesulfovibrionia → Thermodesulfovibrionales → Thermodesulfovibrionaceae → Thermodesulfovibrio → unclassified Thermodesulfovibrio → Thermodesulfovibrio sp. RBG_19FT_COMBO_42_12 | 584 | Open in IMG/M |
| 3300018055|Ga0184616_10088330 | All Organisms → cellular organisms → Bacteria | 1093 | Open in IMG/M |
| 3300018064|Ga0187773_10608251 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Thermodesulfovibrionia → Thermodesulfovibrionales → Thermodesulfovibrionaceae → Thermodesulfovibrio → unclassified Thermodesulfovibrio → Thermodesulfovibrio sp. RBG_19FT_COMBO_42_12 | 669 | Open in IMG/M |
| 3300018068|Ga0184636_1028973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1742 | Open in IMG/M |
| 3300018068|Ga0184636_1082507 | Not Available | 1086 | Open in IMG/M |
| 3300018088|Ga0187771_11049370 | Not Available | 691 | Open in IMG/M |
| 3300022553|Ga0212124_10174557 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium | 1174 | Open in IMG/M |
| 3300022650|Ga0236339_1245043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella | 574 | Open in IMG/M |
| 3300024263|Ga0209978_10344454 | Not Available | 735 | Open in IMG/M |
| (restricted) 3300024300|Ga0233420_10017916 | All Organisms → cellular organisms → Bacteria | 2210 | Open in IMG/M |
| (restricted) 3300024528|Ga0255045_10207899 | Not Available | 765 | Open in IMG/M |
| 3300025159|Ga0209619_10073334 | All Organisms → cellular organisms → Bacteria | 2094 | Open in IMG/M |
| 3300025308|Ga0209211_10094740 | All Organisms → cellular organisms → Bacteria | 2346 | Open in IMG/M |
| 3300025322|Ga0209641_10452240 | Not Available | 918 | Open in IMG/M |
| 3300025326|Ga0209342_10191113 | All Organisms → cellular organisms → Bacteria | 1831 | Open in IMG/M |
| 3300025600|Ga0209125_1020360 | All Organisms → cellular organisms → Bacteria | 2731 | Open in IMG/M |
| 3300025843|Ga0209182_10021487 | All Organisms → cellular organisms → Bacteria | 1926 | Open in IMG/M |
| 3300027888|Ga0209635_10289647 | Not Available | 1304 | Open in IMG/M |
| 3300027897|Ga0209254_10558833 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 815 | Open in IMG/M |
| 3300027899|Ga0209668_10312909 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium HGW-Deltaproteobacteria-13 | 1011 | Open in IMG/M |
| 3300027900|Ga0209253_10110393 | All Organisms → cellular organisms → Bacteria | 2248 | Open in IMG/M |
| 3300027900|Ga0209253_10156388 | All Organisms → cellular organisms → Bacteria | 1843 | Open in IMG/M |
| 3300027917|Ga0209536_101629444 | Not Available | 782 | Open in IMG/M |
| 3300029288|Ga0265297_10081949 | All Organisms → cellular organisms → Bacteria | 2646 | Open in IMG/M |
| 3300029288|Ga0265297_10247012 | All Organisms → cellular organisms → Bacteria | 1271 | Open in IMG/M |
| 3300030613|Ga0299915_10678024 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300031255|Ga0315554_1039026 | All Organisms → cellular organisms → Archaea → environmental samples → uncultured archaeon GZfos18F2 | 1981 | Open in IMG/M |
| 3300031275|Ga0307437_1123597 | All Organisms → cellular organisms → Archaea → environmental samples → uncultured archaeon GZfos18F2 | 748 | Open in IMG/M |
| 3300031539|Ga0307380_10400091 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Deltaproteobacteria incertae sedis → Candidatus Desulfacyla → Candidatus Desulfacyla euxinica | 1239 | Open in IMG/M |
| 3300031565|Ga0307379_10040067 | All Organisms → cellular organisms → Bacteria | 5514 | Open in IMG/M |
| 3300031653|Ga0315550_1209028 | All Organisms → cellular organisms → Archaea → environmental samples → uncultured archaeon GZfos18F2 | 736 | Open in IMG/M |
| 3300031654|Ga0315549_1293889 | Not Available | 577 | Open in IMG/M |
| 3300031862|Ga0315280_10004589 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 20274 | Open in IMG/M |
| 3300031862|Ga0315280_10064683 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. PtaU1.Bin162 | 2924 | Open in IMG/M |
| 3300031862|Ga0315280_10077584 | All Organisms → cellular organisms → Bacteria | 2529 | Open in IMG/M |
| 3300031862|Ga0315280_10236648 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
| 3300031949|Ga0214473_10103111 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 3331 | Open in IMG/M |
| 3300031949|Ga0214473_10196619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2335 | Open in IMG/M |
| 3300031949|Ga0214473_10383638 | All Organisms → cellular organisms → Bacteria | 1589 | Open in IMG/M |
| 3300031999|Ga0315274_10811166 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 990 | Open in IMG/M |
| 3300032020|Ga0315296_10535288 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Thermodesulfovibrionia → Thermodesulfovibrionales → Thermodesulfovibrionaceae → Thermodesulfovibrio → unclassified Thermodesulfovibrio → Thermodesulfovibrio sp. RBG_19FT_COMBO_42_12 | 613 | Open in IMG/M |
| 3300032020|Ga0315296_10535456 | Not Available | 612 | Open in IMG/M |
| 3300032053|Ga0315284_10617409 | Not Available | 1290 | Open in IMG/M |
| 3300032069|Ga0315282_10245514 | All Organisms → cellular organisms → Bacteria | 1234 | Open in IMG/M |
| 3300032118|Ga0315277_11044689 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Thermodesulfovibrionia → Thermodesulfovibrionales → Thermodesulfovibrionaceae → Thermodesulfovibrio → unclassified Thermodesulfovibrio → Thermodesulfovibrio sp. RBG_19FT_COMBO_42_12 | 741 | Open in IMG/M |
| 3300032156|Ga0315295_10214213 | All Organisms → cellular organisms → Bacteria | 1937 | Open in IMG/M |
| 3300032156|Ga0315295_10589751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1126 | Open in IMG/M |
| 3300032163|Ga0315281_10522487 | All Organisms → cellular organisms → Bacteria | 1260 | Open in IMG/M |
| 3300032163|Ga0315281_10831109 | All Organisms → cellular organisms → Archaea → environmental samples → uncultured archaeon GZfos18F2 | 950 | Open in IMG/M |
| 3300032163|Ga0315281_11153554 | Not Available | 776 | Open in IMG/M |
| 3300032163|Ga0315281_12241832 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Thermodesulfovibrionia → Thermodesulfovibrionales → Thermodesulfovibrionaceae → Thermodesulfovibrio → unclassified Thermodesulfovibrio → Thermodesulfovibrio sp. RBG_19FT_COMBO_42_12 | 516 | Open in IMG/M |
| 3300032164|Ga0315283_10288744 | All Organisms → cellular organisms → Bacteria | 1777 | Open in IMG/M |
| 3300032177|Ga0315276_12349116 | Not Available | 537 | Open in IMG/M |
| 3300032397|Ga0315287_10264897 | All Organisms → cellular organisms → Bacteria | 2019 | Open in IMG/M |
| 3300032401|Ga0315275_10264141 | All Organisms → cellular organisms → Bacteria | 1923 | Open in IMG/M |
| 3300032516|Ga0315273_11860285 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_51_10 | 721 | Open in IMG/M |
| 3300032516|Ga0315273_12532835 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Thermodesulfovibrionia → Thermodesulfovibrionales → Thermodesulfovibrionaceae → Thermodesulfovibrio → unclassified Thermodesulfovibrio → Thermodesulfovibrio sp. RBG_19FT_COMBO_42_12 | 590 | Open in IMG/M |
| 3300033416|Ga0316622_100874399 | All Organisms → cellular organisms → Bacteria | 1046 | Open in IMG/M |
| 3300033433|Ga0326726_10452154 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Thermodesulfovibrionia → Thermodesulfovibrionales → Thermodesulfovibrionaceae → Thermodesulfovibrio → unclassified Thermodesulfovibrio → Thermodesulfovibrio sp. RBG_19FT_COMBO_42_12 | 1224 | Open in IMG/M |
| 3300033483|Ga0316629_11328597 | Not Available | 580 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 19.30% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 5.26% |
| Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 5.26% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 4.39% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 4.39% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 3.51% |
| Sediment, Intertidal | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Sediment, Intertidal | 3.51% |
| Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment | 2.63% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.63% |
| Salt Marsh Sediment | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment | 2.63% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 2.63% |
| Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 1.75% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.75% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 1.75% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 1.75% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 1.75% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 1.75% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 1.75% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 1.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 1.75% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.75% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.75% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.75% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 1.75% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 1.75% |
| Landfill Leachate | Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Landfill Leachate | 1.75% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.88% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.88% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.88% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Cave Water → Groundwater | 0.88% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 0.88% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.88% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 0.88% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 0.88% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.88% |
| Marine Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Sediment | 0.88% |
| Subsea Pool | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Subsea Pool | 0.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.88% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.88% |
| Petroleum Reservoir | Environmental → Terrestrial → Unclassified → Unclassified → Unclassified → Petroleum Reservoir | 0.88% |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 0.88% |
| Enrichment Culture | Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Enrichment Culture | 0.88% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908035 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog Site B3 | Environmental | Open in IMG/M |
| 2140918008 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog_all | Environmental | Open in IMG/M |
| 3300000229 | Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- LI09_3 | Environmental | Open in IMG/M |
| 3300000491 | Lentic microbial communities from White Lake grasslands, BC, Canada | Environmental | Open in IMG/M |
| 3300000493 | Lentic microbial communities from White Lake grasslands, BC, Canada | Environmental | Open in IMG/M |
| 3300000558 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - West In Pit SyncrudeMLSB2011 | Engineered | Open in IMG/M |
| 3300001580 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Microbes from Suncor taillings pond 6 2012TP6_6 | Engineered | Open in IMG/M |
| 3300002538 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-212 | Environmental | Open in IMG/M |
| 3300002549 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-212 | Environmental | Open in IMG/M |
| 3300002569 | Arctic peat soil from Barrow, Alaska, USA - Barrow Graham LP Ref core NGADG0011-212 | Environmental | Open in IMG/M |
| 3300002703 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Microbes from Oil sands tailings Tailings Pond 5 - 2012TP5 | Engineered | Open in IMG/M |
| 3300003852 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB | Environmental | Open in IMG/M |
| 3300005601 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.1 | Environmental | Open in IMG/M |
| 3300005821 | Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 25 cmbsf, PM1 | Environmental | Open in IMG/M |
| 3300005832 | Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.41_BBB | Environmental | Open in IMG/M |
| 3300005833 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBK | Environmental | Open in IMG/M |
| 3300005938 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 | Environmental | Open in IMG/M |
| 3300006094 | Petroleum reservoir microbial communities from Reconcavo Basin, Brazil, analyzing oil degradation - Bahia-well BA- 1 | Environmental | Open in IMG/M |
| 3300006224 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300006972 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB136-A | Environmental | Open in IMG/M |
| 3300008517 | Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 175 cmbsf. Combined Assembly of Gp0128389 and Gp0131431 MM4PM4 | Environmental | Open in IMG/M |
| 3300009034 | Intertidal mud flat sediment archaeal communities from Garolim Bay, Chungcheongnam-do, Korea | Environmental | Open in IMG/M |
| 3300009039 | Lake sediment microbial communities from Lake Baikal, Russia to study Microbial Dark Matter (Phase II) - Lake Baikal sediment 0-5 cm | Environmental | Open in IMG/M |
| 3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300009135 | Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 382 cmbsf | Environmental | Open in IMG/M |
| 3300009150 | Deep subsurface microbial communities from South Atlantic Ocean to uncover new lineages of life (NeLLi) - Benguela_00093 metaG | Environmental | Open in IMG/M |
| 3300009171 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009388 | Metatranscriptome sequencing of an Anaerobic Hexadecane-Degrading Microbial Consortia from University of California, San Diego, USA - Hexadecane | Engineered | Open in IMG/M |
| 3300009499 | Deep subsurface microbial communities from Anholt, Denmark to uncover new lineages of life (NeLLi) - Anholt_01485 metaG | Environmental | Open in IMG/M |
| 3300010392 | Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385 | Environmental | Open in IMG/M |
| 3300010429 | AD_USRAca | Engineered | Open in IMG/M |
| 3300010430 | Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples | Environmental | Open in IMG/M |
| 3300010932 | Freshwater microbial communities from the Kallisti Limnes subsea pool, Santorini, Greece - 2-BIOTECH-ROV7-P1 | Environmental | Open in IMG/M |
| 3300011118 | Deep subsurface microbial communities from Aarhus Bay to uncover new lineages of life (NeLLi) - Aarhus_00045 metaG | Environmental | Open in IMG/M |
| 3300011407 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT454_2 | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300014656 | Groundwater microbial communities from the Aspo Hard Rock Laboratory (HRL) deep subsurface site, Sweden - MM_PC_MetaG | Environmental | Open in IMG/M |
| 3300014913 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay1, Core 4569-9, 0-3 cm | Environmental | Open in IMG/M |
| 3300014914 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay2, Core 4569-9, 9-12 cm | Environmental | Open in IMG/M |
| 3300015370 | Groundwater microbial communities from the Aspo Hard Rock Laboratory (HRL) deep subsurface site, Sweden - OS_PC_MetaG | Environmental | Open in IMG/M |
| 3300017931 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100 | Environmental | Open in IMG/M |
| 3300017989 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_MS_2 metaG | Environmental | Open in IMG/M |
| 3300018005 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_150 | Environmental | Open in IMG/M |
| 3300018015 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_150 | Environmental | Open in IMG/M |
| 3300018055 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_coex | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018068 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_b2 | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300022553 | Powell_combined assembly | Environmental | Open in IMG/M |
| 3300022650 | Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Winter W3 | Environmental | Open in IMG/M |
| 3300024263 | Deep subsurface microbial communities from South Atlantic Ocean to uncover new lineages of life (NeLLi) - Benguela_00093 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024300 (restricted) | Freshwater microbial communities from Lake Matano, South Sulawesi, Indonesia - Watercolumn_Matano_2014_102_MG | Environmental | Open in IMG/M |
| 3300024528 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_23 | Environmental | Open in IMG/M |
| 3300025159 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 3 | Environmental | Open in IMG/M |
| 3300025308 | Soil microbial communities from Rifle, Colorado, USA - Groundwater A2 | Environmental | Open in IMG/M |
| 3300025322 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025326 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025600 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 11-31A (SPAdes) | Environmental | Open in IMG/M |
| 3300025843 | Lake sediment microbial communities from Lake Baikal, Russia to study Microbial Dark Matter (Phase II) - Lake Baikal sediment 0-5 cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027888 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-30_32 (SPAdes) | Environmental | Open in IMG/M |
| 3300027897 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes) | Environmental | Open in IMG/M |
| 3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
| 3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300029288 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 137-91 | Engineered | Open in IMG/M |
| 3300030613 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT92D227 | Environmental | Open in IMG/M |
| 3300031255 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1603-70 | Environmental | Open in IMG/M |
| 3300031275 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-90 | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
| 3300031653 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-90 | Environmental | Open in IMG/M |
| 3300031654 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-200 | Environmental | Open in IMG/M |
| 3300031862 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_40 | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032020 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_18 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032069 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_20 | Environmental | Open in IMG/M |
| 3300032118 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15 | Environmental | Open in IMG/M |
| 3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
| 3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
| 3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
| 3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
| 3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
| 3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300033416 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033483 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_A | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B3_GZOS_CLC_01734600 | 2124908035 | Soil | VKVFSLENAYVVERAQVIKNTEGSNDAIVKGEMADTPPGS |
| Bog_all_C_00352060 | 2140918008 | Soil | VKVFSPENPYFVEQAQVIKNTEGSNAAIVKGEMADTPPGS |
| TB_LI09_3DRAFT_10573201 | 3300000229 | Groundwater | VKVFSPENAYVVEQAQGIKNPEGSNEAIVRGEMGDTPPGS* |
| ML8_1008675 | 3300000491 | Lentic | VKAFSLENAYVVEKAQVVRNTEGSNESVVIGEMVDTPPGP* |
| MLSed_1060201 | 3300000493 | Lentic | VKAFSLENAYAVEKAQVVRNTEGSNESVVIGEMVDT |
| Draft_100835302 | 3300000558 | Hydrocarbon Resource Environments | VKVFSLENPYDVEQAQVIKNTEGSNEAIVKGXMADXPPGS* |
| Draft_103541211 | 3300001580 | Hydrocarbon Resource Environments | VFSLENPYDVEQAQVIKNTEGSNEAIVKGKMADSPPGS* |
| Draft_103546541 | 3300001580 | Hydrocarbon Resource Environments | VFSLENPYDVEQAQVIKNTEGSNEAIVKGEMADTPPGS* |
| JGI24132J36420_100008158 | 3300002538 | Arctic Peat Soil | VKVFSPENPYVVERAQVIKNTEGSNEAIVTGEMADTPPGS* |
| JGI24130J36418_100906801 | 3300002549 | Arctic Peat Soil | VKVFSLENAYVVERAQVLKTTEGSNDAIVTGEMADTPPGS* |
| JGI24136J36422_101487571 | 3300002569 | Arctic Peat Soil | VKVFSLENAYVVERAQVFKVTEGSNDAIVTGEMADTPPGS* |
| draft_109571641 | 3300002703 | Hydrocarbon Resource Environments | VKVFSLENPYDVEQAQVIKNTEGSNEAIVKGEMADTPPGS* |
| draft_109572191 | 3300002703 | Hydrocarbon Resource Environments | VKVFSLENPYDVEQAQVIKNTEGSNEAIVKGKMADSPPGS* |
| draft_110591263 | 3300002703 | Hydrocarbon Resource Environments | VKVFSLENAYDVELAQAIKNTEGSNDAIVKGEMVDTPPGS* |
| Ga0031655_103363421 | 3300003852 | Freshwater Lake Sediment | KEFSLENAYVVERAQVIKNTEGSNEAIATGEMADTPPGS* |
| Ga0070722_105049431 | 3300005601 | Marine Sediment | VKVFSPENAIIVEQAQVIKNMEGSNEAIVIGEMVETPPGS* |
| Ga0078746_10974911 | 3300005821 | Marine Sediment | VKVFSPENAIIVEQAQVIKNMEGSNETIVIGEMVETPPGS* |
| Ga0074469_111724221 | 3300005832 | Sediment (Intertidal) | VKVFSLENAYVVEQAQVVKNTEGSNEAIVIGEMVDTPPGS* |
| Ga0074472_114043811 | 3300005833 | Sediment (Intertidal) | VKVFSPENAYGVEQAQVIKNTEGSNVVIVKGEMADTPPGS* |
| Ga0066795_101563672 | 3300005938 | Soil | VKEFSLENPYVVERAQVIKNTEGSNEAIVKGEMADTPPGS* |
| Ga0066795_102242732 | 3300005938 | Soil | VKVFSLENPYVVERAQVIKNTEGSNEAIVTGEMVDTPPGS* |
| Ga0082037_10108803 | 3300006094 | Petroleum Reservoir | VKVFSPENTYVVEQAQVIKNTEGSNEAIVTGEKADTPPGS* |
| Ga0079037_1015016932 | 3300006224 | Freshwater Wetlands | VKVFSPENAYVVEQVQVIKNTEGSNAVIVKGEMADTPPGS* |
| Ga0075518_10477552 | 3300006972 | Arctic Peat Soil | VEVFSLENAYVVERAQVLKVTEGSNEAIDTGEMADTPPGS* |
| Ga0111034_12384901 | 3300008517 | Marine Sediment | VKVFSLENAYVVEQAQVIKNTEGSNETIVIGEMVD |
| Ga0115863_12444921 | 3300009034 | Sediment, Intertidal | RVKVFSLENAYVVEQAQVIKNMEGSNEAIVIGEMAETPPGS* |
| Ga0115863_13814291 | 3300009034 | Sediment, Intertidal | VKVFSLENAYDVEQAQVIKNTEGSNEAIVRGEMAETPPGS* |
| Ga0115863_13931571 | 3300009034 | Sediment, Intertidal | VFSPENAYGVERVDVVKNAEGSNEAIVIGEMAETPPGS* |
| Ga0115863_16840931 | 3300009034 | Sediment, Intertidal | VKVFSLENAYVVEQAQVIKNTEGSNEAIVIGEMVDTPPGS* |
| Ga0105152_100381062 | 3300009039 | Lake Sediment | VYSLENAYVVERAQVFKVTEGSNEAIVTGEMADTPPGS* |
| Ga0105152_101268213 | 3300009039 | Lake Sediment | VKEFSPENANVVEQAQGIKNPEGSNEAIVKGEMADTPPGS* |
| Ga0102851_103527012 | 3300009091 | Freshwater Wetlands | VKVFSPENAYGVEQAQVIKNTEGSNAVIVKGEMADTPPGS* |
| Ga0118736_100068622 | 3300009135 | Marine Sediment | VKVFSLENAYVVEQAQVIKNTEGSNETIVIGEMAETPPGS* |
| Ga0114921_100666011 | 3300009150 | Deep Subsurface | VFSFENAYVVEQAQVVKNTEGSNEAIVIGEMVETPPGS* |
| Ga0114921_100938312 | 3300009150 | Deep Subsurface | VKVFSLENAYVVEQAQVVKNTEGSNETIVIGEMVDTPPGS* |
| Ga0114921_106860481 | 3300009150 | Deep Subsurface | VKVYSSENANIVEQAQVIKNMEGSNETIDIGEMVEIPPGS* |
| Ga0105101_103419401 | 3300009171 | Freshwater Sediment | FSPENAYVVEQAQGIKNPEGSNEAIVKGEMADTPPGS* |
| Ga0103809_10503881 | 3300009388 | Enrichment Culture | VKVFSLENPYVVEQAQVIKNTEGSNEAIVKGEMADTLPGS* |
| Ga0114930_105295611 | 3300009499 | Deep Subsurface | VKVFSLENAYVVEQAQVIKNMEGSNEVIVIGEMVEAPPGS* |
| Ga0118731_1098805202 | 3300010392 | Marine | VKVFSPENAIIVEQAQVIKNMEGSNEAIVIGEMVETPLGS* |
| Ga0116241_100869193 | 3300010429 | Anaerobic Digestor Sludge | VKVFSLENAYVVEQAQVIKNTEGSNDAIVKGEMADTPPGS* |
| Ga0118733_1027157341 | 3300010430 | Marine Sediment | MVKVFSFENACVVEQAQVVKNTEGSNETIVIGEMVETPPGS* |
| Ga0137843_10440142 | 3300010932 | Subsea Pool | VKVFSLENAYVVEQAQVVKNTEGSNEAIVIGEMADNPPGS* |
| Ga0114922_107671412 | 3300011118 | Deep Subsurface | VKVFSLENAYVVEQAQVVKNTEDNNEVIIIGEMAETPSGS* |
| Ga0137450_10584772 | 3300011407 | Soil | VKVFSLENAYDVERAQVIKNTEGSNDAIVKGEMVDTPPGS* |
| Ga0153915_123141131 | 3300012931 | Freshwater Wetlands | ENANVVEQAQGIKNPEGSNEAIVKGEMADTPPGS* |
| Ga0153916_109067702 | 3300012964 | Freshwater Wetlands | VKEFSLENANVVEQAQGIKNPEGSNEAIVKGEMADTPPGS* |
| Ga0180007_106561071 | 3300014656 | Groundwater | VKVFSLENAYVVERAQVIKVTEGSNEAIVTGEMVDTPPGS* |
| Ga0164310_105085041 | 3300014913 | Marine Sediment | SARVKVFSPENAIIVEQAQVIKNMEGSNEAIVIGEMVETPPGS* |
| Ga0164311_104282861 | 3300014914 | Marine Sediment | MKVYNPKNALIVEQDQMIKNMEVSNKAIAIGEMVETPPGS* |
| Ga0180009_100182672 | 3300015370 | Groundwater | VKVFSLENPYVVEQAQVIKNTEGSNEAIVTGEMADTPPGS* |
| Ga0187877_13601831 | 3300017931 | Peatland | VKVFSPENVYVVEEVQGIKNPEGGNEAIVRGEMVDTPPGS |
| Ga0180432_106249171 | 3300017989 | Hypersaline Lake Sediment | VYSLENGYVVGKTQVVKNTEESNEAIVMGKIVDTPPAQ |
| Ga0187878_10637893 | 3300018005 | Peatland | VTAGRNPKWVKEFSLENAYVVERAQVIKNTEGSNEAIATGEMADTPPGS |
| Ga0187866_12847542 | 3300018015 | Peatland | VKVFSLENAYVVEQAQGIKNPEGSNEAIVKGEMADTPPGS |
| Ga0184616_100883301 | 3300018055 | Groundwater Sediment | VKEFSLENANVVEQAQVIKNTEGSNEAIVKGEMADTPPGS |
| Ga0187773_106082512 | 3300018064 | Tropical Peatland | VKVFSPENAYGVEQAQVIKNTEGSNEVIVKGEMADTPPGS |
| Ga0184636_10289732 | 3300018068 | Groundwater Sediment | VKEFSPENAKVVEQAQGIKNAEGSTEAIVKGEMADTPPGS |
| Ga0184636_10825072 | 3300018068 | Groundwater Sediment | VKVFSLENAYVVERAQVIKNTEGSNEAIVKGEMADTPPGS |
| Ga0187771_110493701 | 3300018088 | Tropical Peatland | VKVFSPENAYVVEQAQGIKNPEGSNEAIVKGEMADTPPGS |
| Ga0212124_101745571 | 3300022553 | Freshwater | VFSPENPYVVEQAQVFKATEGSNDAIVKGETADTPPGS |
| Ga0236339_12450431 | 3300022650 | Freshwater | VKVFSLENAYVVERAQVIKTTEGSNDAIVAGEMADTPPGS |
| Ga0209978_103444541 | 3300024263 | Deep Subsurface | VKVFSLENAYVVEQVQVIKNMEGSNEAIVIGEMAETPPGS |
| (restricted) Ga0233420_100179163 | 3300024300 | Freshwater | VKVFSPENAYGVEQAQVIKNTEGSNEAIVRGEMADTPPGS |
| (restricted) Ga0255045_102078991 | 3300024528 | Seawater | VKVFSPENAIIVEQAQVIKNMEGSNEAIVIGEMVETPPGS |
| Ga0209619_100733344 | 3300025159 | Soil | VKVSSPENAYVVEQGDVVRNTEYSNEAIVIGEKEVLS |
| Ga0209211_100947404 | 3300025308 | Soil | VKVSSPENAYVVEQGDVVRNTEYSNEVIVIGEKEVLS |
| Ga0209641_104522401 | 3300025322 | Soil | VKVSSPKNAYVVEQGDVVRNTEYSNEAIVIGEKEVLS |
| Ga0209342_101911131 | 3300025326 | Soil | SLENPYVVERAQVIKNTEGSNDAIVKGEMVDTPPGS |
| Ga0209125_10203601 | 3300025600 | Arctic Peat Soil | SVKVFSLENPYVVERAQVIKNTEGSNEAIVTGEMVDTPPGS |
| Ga0209182_100214872 | 3300025843 | Lake Sediment | VKEFSPENANVVEQAQGIKNPEGSNEAIVKGEMADTPPGS |
| Ga0209635_102896472 | 3300027888 | Marine Sediment | VKVFSLENAYVVEQAQVIKNTEGSNETIVIGKMVETPPGS |
| Ga0209254_105588332 | 3300027897 | Freshwater Lake Sediment | VTAGRNPKWVKEFSLENAYVVERTQVIKNTEGSNAAIVKGEMADTPPG |
| Ga0209668_103129093 | 3300027899 | Freshwater Lake Sediment | VKVFSLENAYVVEQAQVIKNTEGSNEAIVTGEMADTPPGS |
| Ga0209253_101103931 | 3300027900 | Freshwater Lake Sediment | PENANGVEQAQVIKNTEGSNEVIVRGEMADTLPGS |
| Ga0209253_101563881 | 3300027900 | Freshwater Lake Sediment | RVKVFSPENAYGVEQAQVIKNTEGSNAVIVKGEMADTPPGS |
| Ga0209536_1016294441 | 3300027917 | Marine Sediment | VKVFSLENAYVVEQAQVIKNTEGSNEVIVIGEMAETPPGS |
| Ga0265297_100819491 | 3300029288 | Landfill Leachate | VKVFSPENTYVVEQAQVIKNTEGSNEAIVTGEKADTPPGS |
| Ga0265297_102470122 | 3300029288 | Landfill Leachate | SVKVFSPENTYVVEQAQVIKNTEGSNEAIVTGEKADTPPGS |
| Ga0299915_106780241 | 3300030613 | Soil | VKEFSLENAYVVERAQVIKNTEGSNEAIATGEMADTPP |
| Ga0315554_10390263 | 3300031255 | Salt Marsh Sediment | VKVFSLENAYVVEQAQVIKNMEGSNEAIVIGEMAETPPGS |
| Ga0307437_11235971 | 3300031275 | Salt Marsh | VKVFSLENAYIVEQAHVIKNTEGSNETIVIGEMAETPPGS |
| Ga0307380_104000912 | 3300031539 | Soil | VKVFSLENAYVVEQAQVIKNMEGSNEVIVIGEMAEAPPGS |
| Ga0307379_100400673 | 3300031565 | Soil | VKVFSLENAYVVEQAQVIKNMEGSNEVIGIGEMAETPPGS |
| Ga0315550_12090281 | 3300031653 | Salt Marsh Sediment | VKVFSLENAYIVEQAHVIKNTGGSNETIVIGEMAETPPGS |
| Ga0315549_12938891 | 3300031654 | Salt Marsh Sediment | VKVYSLENAYVVEKAQVVKNTEGSNEAIVIGEMVDTPPGP |
| Ga0315280_100045898 | 3300031862 | Sediment | VTAGRNPERVKEFSPENAYVVERAQGIKNPEGSNEAIVKGEMVDTPPGS |
| Ga0315280_100646834 | 3300031862 | Sediment | PENAYVVEQAQGIKNPEGSNEAIVKGEMADTPPGS |
| Ga0315280_100775843 | 3300031862 | Sediment | VKEFSPENAYVVEQAQGIKNPEGSNEAIVKGEMVDTPPGS |
| Ga0315280_102366481 | 3300031862 | Sediment | VKEFSPENAYVVEQAQGIKNPEGSNEAIVKGEMADTPPGS |
| Ga0214473_101031113 | 3300031949 | Soil | VTAGRNPKWVKEFSLENANVVERAQGIKNPEGSNEAIVKGEMADTPPGS |
| Ga0214473_101966194 | 3300031949 | Soil | VKEFSPENANVVEQAQGIKNPEGSNEAIVKGEMVDTPPGS |
| Ga0214473_103836382 | 3300031949 | Soil | MFSPENAYGVEQAQVIKNTGGSNAVIVKGEMADTPPGA |
| Ga0315274_108111662 | 3300031999 | Sediment | VKVFSSENAYVVEPAQVIKNTEGANEAIVRGEMADT |
| Ga0315296_105352881 | 3300032020 | Sediment | MVIPPEAGLTVKVFSLENANVVEQAQGIKNPEGSNAVIVKGEMADTPPGS |
| Ga0315296_105354562 | 3300032020 | Sediment | VTAGRNPKWVKEFSLENANVVERAKGIKNPEGSNEAIVKGEMADTPPGS |
| Ga0315284_106174092 | 3300032053 | Sediment | VKEFSLENANVVEQAQGIKNPEGSNEAIVKGEMADTPPGS |
| Ga0315282_102455142 | 3300032069 | Sediment | VKEFSPENATVVEQAQGIKNPEGSNEAIVKGEMADTPPGS |
| Ga0315277_110446892 | 3300032118 | Sediment | VKVFSPENAYGVEQVQVMKNTEGSNAVIVKGEMADTPPGS |
| Ga0315295_102142131 | 3300032156 | Sediment | VKVFSPENAYGVEQAQVIKNTEGSNGVIVKGEMADTPPGS |
| Ga0315295_105897511 | 3300032156 | Sediment | PENAKVVEQTQGIKNPEGSNEAIVKGEMADTPPGS |
| Ga0315281_105224872 | 3300032163 | Sediment | VKVFSPENAYGVEQAQVIKNTEGSNAVIVKGEMADTPPGS |
| Ga0315281_108311091 | 3300032163 | Sediment | VKELSPENAYVVEPAQGIKNPEGSNEAIGKGEMVDTPPES |
| Ga0315281_111535541 | 3300032163 | Sediment | VKVFSLENAYGVERAQVMKNTEGSNEAIATGEMVDTPPGS |
| Ga0315281_122418322 | 3300032163 | Sediment | FSPENAYGVEQAQVIKNTEGSNAVIVKGEMADTPPGS |
| Ga0315283_102887443 | 3300032164 | Sediment | TAGRNPGRVKEFSPENANVVEQAQGIKNPEGSNEGIVRGEMADTSPGS |
| Ga0315276_123491162 | 3300032177 | Sediment | KVFSLENAYVVERAQVFKATEGRNEAIVIGEMADTPPGS |
| Ga0315287_102648972 | 3300032397 | Sediment | VKVFSLENAYVVEQAQVIKNTEGSNEAIVTGEMAETPPGS |
| Ga0315275_102641412 | 3300032401 | Sediment | VKVFSPENAYGVEQAQVIKNTEGSNEAIVKGEMADTPPGS |
| Ga0315273_118602851 | 3300032516 | Sediment | VKEFSLENANVVEQAQGIKNTEGSNEAIVKGEMEK |
| Ga0315273_125328351 | 3300032516 | Sediment | KVFSPENAYVVEQAQGIKNPEGSNEAIVRGEMADTPPGS |
| Ga0316622_1008743991 | 3300033416 | Soil | ARVKVFSPENAYVVEQAQGIKNPEGSNEAIVIGEMVDTPPGS |
| Ga0326726_104521542 | 3300033433 | Peat Soil | VKVFSPENAYVVEQAQGIKNREGSNEAIVKGEMADTPPGS |
| Ga0316629_113285971 | 3300033483 | Soil | VKVFSPENAYGVEQAQVIKNTEGSNEAVVKGEMADTLPGL |
| ⦗Top⦘ |