


| Basic Information | |
|---|---|
| Family ID | F081469 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 114 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MGLKGDKSGEMSVSNALTALTKSNQVRREGGKYRAAA |
| Number of Associated Samples | 90 |
| Number of Associated Scaffolds | 114 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 19.30 % |
| % of genes near scaffold ends (potentially truncated) | 67.54 % |
| % of genes from short scaffolds (< 2000 bps) | 93.86 % |
| Associated GOLD sequencing projects | 85 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (63.158 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (14.912 % of family members) |
| Environment Ontology (ENVO) | Unclassified (36.842 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (57.895 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 15.38% β-sheet: 12.31% Coil/Unstructured: 72.31% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 114 Family Scaffolds |
|---|---|---|
| PF08447 | PAS_3 | 4.39 |
| PF12728 | HTH_17 | 3.51 |
| PF13975 | gag-asp_proteas | 3.51 |
| PF01695 | IstB_IS21 | 2.63 |
| PF13650 | Asp_protease_2 | 2.63 |
| PF02805 | Ada_Zn_binding | 0.88 |
| PF00501 | AMP-binding | 0.88 |
| PF04536 | TPM_phosphatase | 0.88 |
| PF13410 | GST_C_2 | 0.88 |
| PF02775 | TPP_enzyme_C | 0.88 |
| PF10609 | ParA | 0.88 |
| PF05598 | DUF772 | 0.88 |
| PF13545 | HTH_Crp_2 | 0.88 |
| PF05406 | WGR | 0.88 |
| PF00211 | Guanylate_cyc | 0.88 |
| PF00378 | ECH_1 | 0.88 |
| PF02668 | TauD | 0.88 |
| PF03328 | HpcH_HpaI | 0.88 |
| PF00313 | CSD | 0.88 |
| PF00239 | Resolvase | 0.88 |
| PF08448 | PAS_4 | 0.88 |
| PF05930 | Phage_AlpA | 0.88 |
| PF04909 | Amidohydro_2 | 0.88 |
| PF01255 | Prenyltransf | 0.88 |
| PF13417 | GST_N_3 | 0.88 |
| PF07883 | Cupin_2 | 0.88 |
| PF13827 | DUF4189 | 0.88 |
| PF01527 | HTH_Tnp_1 | 0.88 |
| PF00950 | ABC-3 | 0.88 |
| PF12833 | HTH_18 | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 114 Family Scaffolds |
|---|---|---|---|
| COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 2.63 |
| COG0020 | Undecaprenyl pyrophosphate synthase | Lipid transport and metabolism [I] | 0.88 |
| COG0469 | Pyruvate kinase | Carbohydrate transport and metabolism [G] | 0.88 |
| COG0609 | ABC-type Fe3+-siderophore transport system, permease component | Inorganic ion transport and metabolism [P] | 0.88 |
| COG1108 | ABC-type Mn2+/Zn2+ transport system, permease component | Inorganic ion transport and metabolism [P] | 0.88 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.88 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.88 |
| COG2169 | Methylphosphotriester-DNA--protein-cysteine methyltransferase (N-terminal fragment of Ada), contains Zn-binding and two AraC-type DNA-binding domains | Replication, recombination and repair [L] | 0.88 |
| COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.88 |
| COG2301 | Citrate lyase beta subunit | Carbohydrate transport and metabolism [G] | 0.88 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.88 |
| COG3311 | DNA-binding transcriptional regulator AlpA | Transcription [K] | 0.88 |
| COG3831 | WGR domain, predicted DNA-binding domain in MolR | Transcription [K] | 0.88 |
| COG3836 | 2-keto-3-deoxy-L-rhamnonate aldolase RhmA | Carbohydrate transport and metabolism [G] | 0.88 |
| COG4606 | ABC-type enterochelin transport system, permease component | Inorganic ion transport and metabolism [P] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 63.16 % |
| Unclassified | root | N/A | 36.84 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004081|Ga0063454_101007372 | Not Available | 671 | Open in IMG/M |
| 3300004153|Ga0063455_100848783 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 640 | Open in IMG/M |
| 3300004153|Ga0063455_101708487 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300004643|Ga0062591_102688492 | Not Available | 526 | Open in IMG/M |
| 3300004803|Ga0058862_10642029 | Not Available | 529 | Open in IMG/M |
| 3300005175|Ga0066673_10315262 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 912 | Open in IMG/M |
| 3300005179|Ga0066684_10392386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 931 | Open in IMG/M |
| 3300005329|Ga0070683_101110756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga | 759 | Open in IMG/M |
| 3300005335|Ga0070666_10218966 | Not Available | 1342 | Open in IMG/M |
| 3300005353|Ga0070669_101378864 | Not Available | 611 | Open in IMG/M |
| 3300005458|Ga0070681_10852823 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 829 | Open in IMG/M |
| 3300005471|Ga0070698_101065669 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 756 | Open in IMG/M |
| 3300005541|Ga0070733_10331416 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1008 | Open in IMG/M |
| 3300005569|Ga0066705_10465602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 792 | Open in IMG/M |
| 3300005617|Ga0068859_101728116 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 691 | Open in IMG/M |
| 3300005618|Ga0068864_100810395 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
| 3300005618|Ga0068864_101609932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 653 | Open in IMG/M |
| 3300005841|Ga0068863_101683500 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 644 | Open in IMG/M |
| 3300006031|Ga0066651_10347813 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 795 | Open in IMG/M |
| 3300006237|Ga0097621_101640183 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300006804|Ga0079221_11709662 | Not Available | 513 | Open in IMG/M |
| 3300006893|Ga0073928_10048608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 3848 | Open in IMG/M |
| 3300006914|Ga0075436_100568194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 834 | Open in IMG/M |
| 3300009090|Ga0099827_10348759 | All Organisms → cellular organisms → Bacteria | 1259 | Open in IMG/M |
| 3300009090|Ga0099827_10689874 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 882 | Open in IMG/M |
| 3300009090|Ga0099827_11391415 | Not Available | 611 | Open in IMG/M |
| 3300009100|Ga0075418_10294012 | All Organisms → cellular organisms → Bacteria | 1731 | Open in IMG/M |
| 3300009143|Ga0099792_10397985 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 842 | Open in IMG/M |
| 3300009143|Ga0099792_11187156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 517 | Open in IMG/M |
| 3300009148|Ga0105243_11062340 | Not Available | 816 | Open in IMG/M |
| 3300009551|Ga0105238_12906553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 515 | Open in IMG/M |
| 3300009553|Ga0105249_12251056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 618 | Open in IMG/M |
| 3300009789|Ga0126307_11183697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 619 | Open in IMG/M |
| 3300009789|Ga0126307_11410333 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 564 | Open in IMG/M |
| 3300010037|Ga0126304_11167711 | Not Available | 527 | Open in IMG/M |
| 3300010040|Ga0126308_11103225 | Not Available | 559 | Open in IMG/M |
| 3300010166|Ga0126306_10212012 | Not Available | 1466 | Open in IMG/M |
| 3300010371|Ga0134125_11832666 | Not Available | 660 | Open in IMG/M |
| 3300010379|Ga0136449_103779825 | Not Available | 570 | Open in IMG/M |
| 3300012199|Ga0137383_10291189 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1196 | Open in IMG/M |
| 3300012200|Ga0137382_11106612 | Not Available | 566 | Open in IMG/M |
| 3300012206|Ga0137380_10504215 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1066 | Open in IMG/M |
| 3300012212|Ga0150985_100511335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 694 | Open in IMG/M |
| 3300012212|Ga0150985_101810399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 919 | Open in IMG/M |
| 3300012212|Ga0150985_103957336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 502 | Open in IMG/M |
| 3300012212|Ga0150985_111124678 | Not Available | 526 | Open in IMG/M |
| 3300012212|Ga0150985_116650232 | Not Available | 500 | Open in IMG/M |
| 3300012212|Ga0150985_117654261 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300012212|Ga0150985_120895695 | Not Available | 500 | Open in IMG/M |
| 3300012212|Ga0150985_122560003 | Not Available | 689 | Open in IMG/M |
| 3300012350|Ga0137372_10582073 | Not Available | 823 | Open in IMG/M |
| 3300012350|Ga0137372_11189706 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 516 | Open in IMG/M |
| 3300012362|Ga0137361_11397372 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 623 | Open in IMG/M |
| 3300012363|Ga0137390_10010983 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 8031 | Open in IMG/M |
| 3300012469|Ga0150984_105130171 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 661 | Open in IMG/M |
| 3300012469|Ga0150984_108900209 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 761 | Open in IMG/M |
| 3300012469|Ga0150984_117138394 | Not Available | 614 | Open in IMG/M |
| 3300012469|Ga0150984_122849791 | Not Available | 528 | Open in IMG/M |
| 3300012915|Ga0157302_10004597 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3123 | Open in IMG/M |
| 3300012917|Ga0137395_10905325 | Not Available | 637 | Open in IMG/M |
| 3300012917|Ga0137395_11223896 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 524 | Open in IMG/M |
| 3300012937|Ga0162653_100023481 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales | 848 | Open in IMG/M |
| 3300012957|Ga0164303_10722622 | Not Available | 674 | Open in IMG/M |
| 3300012957|Ga0164303_11424122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 519 | Open in IMG/M |
| 3300012984|Ga0164309_11311801 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 613 | Open in IMG/M |
| 3300012986|Ga0164304_10768301 | Not Available | 740 | Open in IMG/M |
| 3300013306|Ga0163162_12577242 | Not Available | 585 | Open in IMG/M |
| 3300013503|Ga0120127_10188130 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 508 | Open in IMG/M |
| 3300013764|Ga0120111_1060575 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 931 | Open in IMG/M |
| 3300014150|Ga0134081_10052486 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1220 | Open in IMG/M |
| 3300014497|Ga0182008_10546700 | Not Available | 643 | Open in IMG/M |
| 3300014968|Ga0157379_10258508 | Not Available | 1582 | Open in IMG/M |
| 3300014969|Ga0157376_12082566 | Not Available | 606 | Open in IMG/M |
| 3300015374|Ga0132255_105086333 | Not Available | 557 | Open in IMG/M |
| 3300017792|Ga0163161_10643062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 878 | Open in IMG/M |
| 3300018468|Ga0066662_10795434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 917 | Open in IMG/M |
| 3300019356|Ga0173481_10477214 | Not Available | 630 | Open in IMG/M |
| 3300019361|Ga0173482_10627624 | Not Available | 544 | Open in IMG/M |
| 3300019888|Ga0193751_1056311 | Not Available | 1667 | Open in IMG/M |
| 3300019888|Ga0193751_1175616 | Not Available | 743 | Open in IMG/M |
| 3300022557|Ga0212123_10096162 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2435 | Open in IMG/M |
| 3300022557|Ga0212123_10496661 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 793 | Open in IMG/M |
| 3300022557|Ga0212123_10726683 | Not Available | 607 | Open in IMG/M |
| 3300024310|Ga0247681_1025131 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 869 | Open in IMG/M |
| 3300025903|Ga0207680_10840406 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 658 | Open in IMG/M |
| 3300025903|Ga0207680_11165514 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 550 | Open in IMG/M |
| 3300025917|Ga0207660_10280844 | All Organisms → cellular organisms → Bacteria | 1321 | Open in IMG/M |
| 3300025918|Ga0207662_11029768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 585 | Open in IMG/M |
| 3300025925|Ga0207650_10330042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga | 1251 | Open in IMG/M |
| 3300025930|Ga0207701_10157403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidisphaera → unclassified Acidisphaera → Acidisphaera sp. S103 | 2011 | Open in IMG/M |
| 3300025930|Ga0207701_10935627 | Not Available | 724 | Open in IMG/M |
| 3300025936|Ga0207670_11166729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 651 | Open in IMG/M |
| 3300025972|Ga0207668_10944748 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 769 | Open in IMG/M |
| 3300026023|Ga0207677_12256214 | Not Available | 507 | Open in IMG/M |
| 3300026075|Ga0207708_11735556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 548 | Open in IMG/M |
| 3300026078|Ga0207702_10281251 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → unclassified Haliangium → Haliangium sp. UPWRP_2 | 1573 | Open in IMG/M |
| 3300026095|Ga0207676_10057379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3065 | Open in IMG/M |
| 3300026118|Ga0207675_102535809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 523 | Open in IMG/M |
| 3300026316|Ga0209155_1284374 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 513 | Open in IMG/M |
| 3300026527|Ga0209059_1012900 | All Organisms → cellular organisms → Bacteria | 3781 | Open in IMG/M |
| 3300026557|Ga0179587_11193647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 501 | Open in IMG/M |
| 3300027787|Ga0209074_10468908 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 541 | Open in IMG/M |
| 3300027867|Ga0209167_10239973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 971 | Open in IMG/M |
| 3300027875|Ga0209283_10734879 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 613 | Open in IMG/M |
| 3300027882|Ga0209590_10565169 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 733 | Open in IMG/M |
| 3300028379|Ga0268266_11170606 | Not Available | 744 | Open in IMG/M |
| 3300028592|Ga0247822_11930534 | Not Available | 506 | Open in IMG/M |
| 3300030986|Ga0308154_109816 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 618 | Open in IMG/M |
| 3300031122|Ga0170822_17048829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 666 | Open in IMG/M |
| 3300031671|Ga0307372_10166209 | Not Available | 1511 | Open in IMG/M |
| 3300031672|Ga0307373_10181303 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1555 | Open in IMG/M |
| 3300031708|Ga0310686_109937961 | Not Available | 565 | Open in IMG/M |
| 3300032515|Ga0348332_14462296 | Not Available | 876 | Open in IMG/M |
| 3300034678|Ga0314803_136157 | Not Available | 511 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 14.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.65% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 7.02% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 6.14% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 5.26% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 4.39% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 4.39% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 3.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.51% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 3.51% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.63% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.75% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.75% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.75% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 1.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.75% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.75% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.75% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 1.75% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.75% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.75% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.88% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.88% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.88% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.88% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.88% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.88% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.88% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.88% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.88% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.88% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.88% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.88% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.88% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.88% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.88% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.88% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.88% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.88% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012937 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t5i015 | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013503 | Permafrost microbial communities from Nunavut, Canada - A23_5cm_12M | Environmental | Open in IMG/M |
| 3300013764 | Permafrost microbial communities from Nunavut, Canada - A28_35cm_6M | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300024310 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK22 | Environmental | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300030986 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_143 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031671 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-1 | Environmental | Open in IMG/M |
| 3300031672 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-2 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300034678 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0063454_1010073722 | 3300004081 | Soil | LERMGLKGDKQGEMSVSNALTALAKRNQIRREGGKYYPGSQG* |
| Ga0063455_1008487831 | 3300004153 | Soil | EILERMGLKGDKSGEMSVSNALTTLTKSNQVHREGGKYRATK* |
| Ga0063455_1017084871 | 3300004153 | Soil | MGLKGDKAGEMSVSNALTALTKRNQVRREGGQILSGLPRCW* |
| Ga0062591_1026884921 | 3300004643 | Soil | GEILERMGLKGDKSGEMSVSNALTALTKRNEVRRDGGKYHSA* |
| Ga0058862_106420292 | 3300004803 | Host-Associated | AKMDLKGNKAGEMSVSNALTALTKAGVVVRRDGKYIGGVG* |
| Ga0066673_103152622 | 3300005175 | Soil | ILDKMGLKGNKTGEMSVSNALTALTKSKQVIRRDRKYIAS* |
| Ga0066684_103923862 | 3300005179 | Soil | RGEILDKMGLKGNKTGEMSVSNALTALTKSKQVIRRDRKYIAS* |
| Ga0070683_1011107561 | 3300005329 | Corn Rhizosphere | GEILERMGLKGDKSGEMSVSNALSALTKRNQLSRTGGKYRAA* |
| Ga0070666_102189663 | 3300005335 | Switchgrass Rhizosphere | LAKMGLKGDKAGEMSVSNALTALSKSNQVRREGGKYHVAA* |
| Ga0070669_1013788641 | 3300005353 | Switchgrass Rhizosphere | GELLQSLGLKGDKSGEMSVSNALSALTKSNQVRRGGGKYHAV* |
| Ga0070681_108528232 | 3300005458 | Corn Rhizosphere | LEKMGLKGDKAGEMSVSNALTALGKSNQVRREGGKYHIAA* |
| Ga0070698_1010656693 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | TRGEILDKMGLKGNKAGEMSVSNALTALTKSKQVARKDRKYVAA* |
| Ga0070733_103314162 | 3300005541 | Surface Soil | MGLKGNKTGEMSVSNALTALTKGNQISRRDGKYHAS* |
| Ga0066705_104656021 | 3300005569 | Soil | EILEKMGLKGNKAGEMSVSNALTALTKSKQVARRDRKYVAG* |
| Ga0068859_1017281162 | 3300005617 | Switchgrass Rhizosphere | KMGLKGNKSGEMSVSNALTALTKAMHVRREGGKYHSA* |
| Ga0068864_1008103953 | 3300005618 | Switchgrass Rhizosphere | MGLKGDKSGEMSVSNALTALTKSNQVRREDGKYRAAM* |
| Ga0068864_1016099322 | 3300005618 | Switchgrass Rhizosphere | MGLKGDKSGEMSVSNALTALTKNNQVQRDGGKYRATT* |
| Ga0068863_1016835002 | 3300005841 | Switchgrass Rhizosphere | MGLKGDKSGEMSVSNALTALTKSNQVRREDGKYRAAT* |
| Ga0066651_103478131 | 3300006031 | Soil | LKGNKSGEMSVSNALTALTKNNQVRRDGRKYLAA* |
| Ga0097621_1016401831 | 3300006237 | Miscanthus Rhizosphere | EILERMGLKGDKSSEMSVSNALTALTKRNQVSRIGGKYRAA* |
| Ga0079221_117096622 | 3300006804 | Agricultural Soil | GEILERMGLKGDKSGEMSVSNALTALTKSNQVHREGGKYRAAM* |
| Ga0073928_100486083 | 3300006893 | Iron-Sulfur Acid Spring | MRLKGNKAGEMSVSNALTALTKGNQVVRADGRYRVA* |
| Ga0075436_1005681943 | 3300006914 | Populus Rhizosphere | GLKGNKAGEMSVSNALTALTKTNQVTRKDGKYAAA* |
| Ga0099827_103487591 | 3300009090 | Vadose Zone Soil | RGEIFQRMGLKGDKSGEMSVSNALTALTKANQVIRRDGPYSAA* |
| Ga0099827_106898742 | 3300009090 | Vadose Zone Soil | MGLKGDKSGEMSVSNALTALTKANQVIRRDGRYSAA* |
| Ga0099827_113914151 | 3300009090 | Vadose Zone Soil | LKGNKTGEMSVSNALTALTKGNQVARRDGKYVTA* |
| Ga0075418_102940123 | 3300009100 | Populus Rhizosphere | MGLKGDKSGEMAVSNALTALFKGGQVRREGGKYHAA* |
| Ga0099792_103979852 | 3300009143 | Vadose Zone Soil | LKGDKSGEMSVSNALTALTKANEVTRRDGRYITA* |
| Ga0099792_111871561 | 3300009143 | Vadose Zone Soil | RGQILEKMGLKGNKAGEMSVSNALTALTKGNQVRREGRSYHSA* |
| Ga0105243_110623402 | 3300009148 | Miscanthus Rhizosphere | MGLKGDKSREMSVSNALTALTKRNQVSRIGGKYRAA* |
| Ga0105238_129065531 | 3300009551 | Corn Rhizosphere | SRREILDKMRLKGNKSGEMSVSNALTALTKAMHVRREGGKYHSA* |
| Ga0105249_122510561 | 3300009553 | Switchgrass Rhizosphere | MGLKGDKSSEMSVSNALTALTKRNQVSRIGGKYRAA* |
| Ga0126307_111836972 | 3300009789 | Serpentine Soil | MGLKGNKSGEMSVSNALTALTKSNQVRRNEERKYVAA* |
| Ga0126307_114103331 | 3300009789 | Serpentine Soil | MGLKGNKSGEMSVSNALTALTKSNQLRRNEERKYVAA* |
| Ga0126304_111677112 | 3300010037 | Serpentine Soil | ILERMGLKGDKSGEMSVSNALTALTKSNQVSRSGGKYRGA* |
| Ga0126308_111032252 | 3300010040 | Serpentine Soil | KGDKSGEMSVSNALTALTKRNEVRREGGRYLPAS* |
| Ga0126306_102120121 | 3300010166 | Serpentine Soil | LKGDKSGEMSVSNALTALTKSNQVSRSGGKYRGA* |
| Ga0134125_118326663 | 3300010371 | Terrestrial Soil | ERMGLKGDKSGEMSVSNALTALTKRNQVRREGGKYHPAS* |
| Ga0136449_1037798251 | 3300010379 | Peatlands Soil | MGLKGDRLAEKSVSNALTALTKSNQVSRREGKYVIDG* |
| Ga0137383_102911891 | 3300012199 | Vadose Zone Soil | MGLKGNKTGEMSVSNALTALTKSKQVIRRDRKYIAS* |
| Ga0137382_111066123 | 3300012200 | Vadose Zone Soil | LKGNKSGEMSVSNALTALTKGKQVARKDRKYVAA* |
| Ga0137380_105042151 | 3300012206 | Vadose Zone Soil | ILEKMGLKGNKLGEMSVSNALTALTKGNQVRREGGKYLSS* |
| Ga0150985_1005113352 | 3300012212 | Avena Fatua Rhizosphere | MGLKGDKSSEMSVSNALTALTKSNQVHREGGKYRAAT* |
| Ga0150985_1018103991 | 3300012212 | Avena Fatua Rhizosphere | RMGLKGNKSGEMSVSNALTALTKTNQVSRHEGRYIAQGG* |
| Ga0150985_1039573361 | 3300012212 | Avena Fatua Rhizosphere | MGLKGNKAGEMSVSNALTALTKTNQIARRDRKYVVG* |
| Ga0150985_1111246781 | 3300012212 | Avena Fatua Rhizosphere | GEILERMGLKGDKSGEMSVSNALTALTKRNQVRREGGKYLPAG* |
| Ga0150985_1166502321 | 3300012212 | Avena Fatua Rhizosphere | LERMGLKGDKSGEMSVSNALTALTKRNQVRRDGGKYHPAS* |
| Ga0150985_1176542612 | 3300012212 | Avena Fatua Rhizosphere | MGLKGDKSGEMSVSNALTALTKRNQVRRDGGRYHPAS* |
| Ga0150985_1208956952 | 3300012212 | Avena Fatua Rhizosphere | EILTKMGLKGDKAGEMAISNALTALTKNNQIRRDGGKYHAG* |
| Ga0150985_1225600033 | 3300012212 | Avena Fatua Rhizosphere | LKGDKSGEMSVSNALTALTKSNQVFRDGGKYRAAM* |
| Ga0137372_105820733 | 3300012350 | Vadose Zone Soil | GLKGNKTGEMSVSNALTALTKGNQVARRDGKYVAA* |
| Ga0137372_111897062 | 3300012350 | Vadose Zone Soil | GLKGNKSDEMSVSNALTALTKANHVQRNSDRKYVVA* |
| Ga0137361_113973722 | 3300012362 | Vadose Zone Soil | MGLKGNKAGEMSVSNALTALTKSNQVSRHEGKYRASA* |
| Ga0137390_100109838 | 3300012363 | Vadose Zone Soil | GLKGNKTGEMSVSNALTALTKAGQVHRQDGKYRSA* |
| Ga0150984_1051301711 | 3300012469 | Avena Fatua Rhizosphere | MGLKGDKSGEMSVSNALTALTKSNQVRREDGKYRAAA* |
| Ga0150984_1089002091 | 3300012469 | Avena Fatua Rhizosphere | MGLKGDKSGEMSVSNALTALTKSNQVHRDGGKYRIADGDG |
| Ga0150984_1171383941 | 3300012469 | Avena Fatua Rhizosphere | LSRGEILERMGLKGDKSGEMSVSNALTALTKRNEVRREGGKYLPA* |
| Ga0150984_1228497911 | 3300012469 | Avena Fatua Rhizosphere | RGEILERMGLKGDKSGEMSVSNALTALTKANQVNRRDGKYIAA* |
| Ga0157302_100045971 | 3300012915 | Soil | MGLKGDKAGEMSVSNALTALTKSNQVQREGGKYRAAT* |
| Ga0137395_109053251 | 3300012917 | Vadose Zone Soil | EILDNMGLEGNKAGEMSVSNALTALTKSKQVALNDRKYMAA* |
| Ga0137395_112238961 | 3300012917 | Vadose Zone Soil | ILEEMGLKGNKSGEMSVSNALTALTKSQQVTRREGKYVIA* |
| Ga0162653_1000234813 | 3300012937 | Soil | QKMGLKGDKAGEMSVSNALTALSKSNQVRREGGKYHLAP* |
| Ga0164303_107226222 | 3300012957 | Soil | LERMGLKGDKSGETSVSNALTALTKSNQLRREGGKYRTAA* |
| Ga0164303_114241222 | 3300012957 | Soil | MGLKGDKSGEMSVSNALTALTKSNQVHREGGKYRAM* |
| Ga0164309_113118012 | 3300012984 | Soil | GLKGDKSGEMSVSNALTALTKSNQVHREGGKYRAM* |
| Ga0164304_107683012 | 3300012986 | Soil | MGLKGDKSGEMSVSNALTALTKSNQVRREGGKYRAAA* |
| Ga0163162_125772422 | 3300013306 | Switchgrass Rhizosphere | MGLKGDKAGEMSVSNALTALSKSNQVRREGGKYHVAA* |
| Ga0120127_101881302 | 3300013503 | Permafrost | LLDKMGLKGNKSGEMSVSNALTALTKGNQVVRRDGKYVASMG* |
| Ga0120111_10605751 | 3300013764 | Permafrost | MGLKGNKAGEMSVSNALTALTKGNQVRRDGGKYLAA* |
| Ga0134081_100524862 | 3300014150 | Grasslands Soil | RGEILDKMGLKGNKSGEMSVSNALTALTKSKQVTRRDRKYVAS* |
| Ga0182008_105467002 | 3300014497 | Rhizosphere | MGLKGDKSGEMSVSNALTALTKSGQVSRNEGKYTAA* |
| Ga0157379_102585084 | 3300014968 | Switchgrass Rhizosphere | MGLKGDKSSEMSVSNALTALTKRNQVSRIEGKYRAA* |
| Ga0157376_120825661 | 3300014969 | Miscanthus Rhizosphere | MGLKGDKAGEMSVSNALTALSKSNQVRREGGKYHLAA* |
| Ga0132255_1050863331 | 3300015374 | Arabidopsis Rhizosphere | MGLKGDKAGEMSISNALTALTKSNQVRREDGKYHRA* |
| Ga0163161_106430622 | 3300017792 | Switchgrass Rhizosphere | MGLKGDKSSEMSVSNALTALTKRNQVSRIEGKYRAA |
| Ga0066662_107954341 | 3300018468 | Grasslands Soil | GLKGNKSGEMSVSNALTALTKSKQVTRRDRKYVAS |
| Ga0173481_104772142 | 3300019356 | Soil | TRGEILERMELKGDKSSEMSVSNALTALTKRNQVSRIGGKYRAA |
| Ga0173482_106276242 | 3300019361 | Soil | LLQKMGLKGDKAGEMSVSNALTALSKNNQVRREGGKYHVQA |
| Ga0193751_10563112 | 3300019888 | Soil | MGLKGDKSGEMSISNALTALIKANQISRRDGKYTSA |
| Ga0193751_11756162 | 3300019888 | Soil | LLDKMGLKGDKTGEMSVSNALTALTKADQVARHDGKYVSA |
| Ga0212123_100961622 | 3300022557 | Iron-Sulfur Acid Spring | MGLKGNKSGEMSVSNALTALTKAKEVVRAEGRYRVA |
| Ga0212123_104966613 | 3300022557 | Iron-Sulfur Acid Spring | MRLKGNKAGEMSVSNALTALTKASQVVRADGRYRAA |
| Ga0212123_107266832 | 3300022557 | Iron-Sulfur Acid Spring | KMGLKGNKAGEMSVSNALTALTKASQVVRADGRYRAA |
| Ga0247681_10251311 | 3300024310 | Soil | LEQMGLKGDKSGEMSVSNALTALAKTSQVTRRDGRYVTG |
| Ga0207680_108404062 | 3300025903 | Switchgrass Rhizosphere | LEKMGLKGDKSGEMSVSNALTALTKTSQVSRHEGRYRSG |
| Ga0207680_111655142 | 3300025903 | Switchgrass Rhizosphere | MGLKGDKSGEMSVSNALTALTKRNQVRRDGGKYHSA |
| Ga0207660_102808441 | 3300025917 | Corn Rhizosphere | MGLKGDKSGAMSVSNALTALTKANQVQREGGKYRIAA |
| Ga0207662_110297682 | 3300025918 | Switchgrass Rhizosphere | MGLKGDKSGEMSVSNALTALTKTSQVSRHEGRYRSG |
| Ga0207650_103300422 | 3300025925 | Switchgrass Rhizosphere | MGLKGDKSSEMSVSNALTALTKRNQVSRIGGKYRAA |
| Ga0207701_101574033 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MGLKGDKSSEMSVSNALTALTKRNQLSRTGGKYRAA |
| Ga0207701_109356272 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MGLKGDKAGEMSVSNVLTALSKSNQVRRDGGKYHVAA |
| Ga0207670_111667292 | 3300025936 | Switchgrass Rhizosphere | MGLKGDKSREMSVSNALTALTKRNQVSRIGGKYRAA |
| Ga0207668_109447482 | 3300025972 | Switchgrass Rhizosphere | GEILDRMGLKGDKSSEMSVSNALTALTKRNQVSRIGGKYRAA |
| Ga0207677_122562141 | 3300026023 | Miscanthus Rhizosphere | MGLKGDKAGEMSVSNALTALAKGNQVHRDGGKYRMTA |
| Ga0207708_117355561 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MGLKGDKSGEMSVSNALSALTKRNQLSRTGGKYRAA |
| Ga0207702_102812512 | 3300026078 | Corn Rhizosphere | MGLKGDKSGEMSVSNALSALTKRNQLSRTGGKYRTA |
| Ga0207676_100573791 | 3300026095 | Switchgrass Rhizosphere | MGLKGDKSGEMSVSNALTALTKNNQVQRDGGKYRATT |
| Ga0207675_1025358091 | 3300026118 | Switchgrass Rhizosphere | ILERMGLKGDKSGEMSVSNALTALTKRNQVRRDGGKYHSA |
| Ga0209155_12843742 | 3300026316 | Soil | ILDKMGLKGNKTGEMSVSNALTALTKSKQVIRRDRKYIAS |
| Ga0209059_10129001 | 3300026527 | Soil | HIKGNKAGETSVSNALTALLKREQIVRRERKYRVE |
| Ga0179587_111936471 | 3300026557 | Vadose Zone Soil | EILDKMGLKGNKAGEMSVSNALTALTKSKQVSRKDRKYIAA |
| Ga0209074_104689081 | 3300027787 | Agricultural Soil | MGLKGNKTGEMSVSNALTALTKSKQVIRRDRKYIAS |
| Ga0209167_102399732 | 3300027867 | Surface Soil | MGLKGNKTGEMSVSNALTALTKGNQISRRDGKYHAS |
| Ga0209283_107348793 | 3300027875 | Vadose Zone Soil | ILEKMGLKGNKSGEMSVSNALTALTKANQVSRRDGKYHAA |
| Ga0209590_105651692 | 3300027882 | Vadose Zone Soil | MGLKGDKSGEMSVSNALTALTKANQVIRRDGRYSAA |
| Ga0268266_111706062 | 3300028379 | Switchgrass Rhizosphere | ILEKMGLKGDKSGEMSVSNALTALTKSNQVRRNAERKYVAA |
| Ga0247822_119305341 | 3300028592 | Soil | GLKGDKSGEMSVSNALTALTKSNQVRREGGKYRTAM |
| Ga0308154_1098161 | 3300030986 | Soil | EILERMGLKGDKSGEMSVSNALTALTKSNQVRREDGKYRAAT |
| Ga0170822_170488291 | 3300031122 | Forest Soil | LEKLRLKGDKSGEMSVSNALTALIKGNQVRRDDRKYVAA |
| Ga0307372_101662093 | 3300031671 | Soil | MGLKGDKAGEMSVSNALTALTKVNQVMRREGKYVAA |
| Ga0307373_101813031 | 3300031672 | Soil | IIERMGLKGDKTGEMSVSNALTALIKANQLTRRDGRYIAA |
| Ga0310686_1099379611 | 3300031708 | Soil | MGLKGDKSGAMSVSNALTALSKANQVVRRDGRYIAHEGMTA |
| Ga0348332_144622961 | 3300032515 | Plant Litter | KGDKSGAMSVSNALTALSKANQVVRRDGKYIAHEGIAA |
| Ga0314803_136157_2_118 | 3300034678 | Soil | EKLGLKGDKSGEMSVSNALTALTKGSHIRRDGGKYHAA |
| ⦗Top⦘ |