


| Basic Information | |
|---|---|
| Family ID | F081282 |
| Family Type | Metagenome |
| Number of Sequences | 114 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MSKQTDNDMIPRLALGLAIFVAMRFAPRVIAWWNKRKEKTI |
| Number of Associated Samples | 75 |
| Number of Associated Scaffolds | 114 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 77.39 % |
| % of genes near scaffold ends (potentially truncated) | 28.95 % |
| % of genes from short scaffolds (< 2000 bps) | 69.30 % |
| Associated GOLD sequencing projects | 61 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (75.439 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (52.632 % of family members) |
| Environment Ontology (ENVO) | Unclassified (81.579 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (97.368 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.17% β-sheet: 0.00% Coil/Unstructured: 47.83% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 114 Family Scaffolds |
|---|---|---|
| PF03796 | DnaB_C | 34.21 |
| PF12684 | DUF3799 | 1.75 |
| PF08299 | Bac_DnaA_C | 0.88 |
| PF00145 | DNA_methylase | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 114 Family Scaffolds |
|---|---|---|---|
| COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 34.21 |
| COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 34.21 |
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 0.88 |
| COG0593 | Chromosomal replication initiation ATPase DnaA | Replication, recombination and repair [L] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 75.44 % |
| All Organisms | root | All Organisms | 24.56 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 52.63% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 14.91% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 10.53% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 6.14% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 3.51% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.63% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 2.63% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.75% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 1.75% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.88% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.88% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.88% |
| Marine Water | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine Water | 0.88% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300004829 | Marine water microbial communities from the Pohang Bay, Korea with extracellular vesicles - Pohang-EVs | Environmental | Open in IMG/M |
| 3300005747 | Seawater microbial communities from Vineyard Sound, MA, USA - control T14 | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006868 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006869 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006870 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006874 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006922 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG | Environmental | Open in IMG/M |
| 3300006924 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG | Environmental | Open in IMG/M |
| 3300006925 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG | Environmental | Open in IMG/M |
| 3300006990 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG | Environmental | Open in IMG/M |
| 3300007234 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007236 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009496 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 | Environmental | Open in IMG/M |
| 3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300010316 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300017709 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27 | Environmental | Open in IMG/M |
| 3300017719 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 | Environmental | Open in IMG/M |
| 3300017742 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21 | Environmental | Open in IMG/M |
| 3300017743 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17 | Environmental | Open in IMG/M |
| 3300017746 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29 | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300017951 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017952 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017968 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071409AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017969 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018039 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071402CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018415 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011508AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018421 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018428 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019703 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRC_7-8_MG | Environmental | Open in IMG/M |
| 3300020054 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071413BT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020176 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011505AT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020182 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160502_2 | Environmental | Open in IMG/M |
| 3300020187 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160512_1 | Environmental | Open in IMG/M |
| 3300021373 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282 | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300022068 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2) | Environmental | Open in IMG/M |
| 3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300025083 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025084 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025626 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes) | Environmental | Open in IMG/M |
| 3300025652 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025751 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025771 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025818 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_1001730310 | 3300000101 | Marine | MTKPNDNDMVPRLALGLTVFLAMKLAPKVFAWWNKRKETQPRTPH* |
| DelMOSum2010_100487265 | 3300000101 | Marine | MSKQTDNDMVPRLALGLTVFLAMKLAPKVIDWWNKRKETQPRTPH* |
| DelMOWin2010_100806434 | 3300000117 | Marine | MSKQTDNDMVPRIALGLTVFLAMKLAPRVFAWWNNRKDKTI* |
| Ga0068515_1013975 | 3300004829 | Marine Water | MSKQDNDMLPRLALGLAIFVAMKCAPKVIAWWNKRKEKTI* |
| Ga0076924_11155921 | 3300005747 | Marine | DNDMVPRLALGLAIFVAMKCAPRLIEWWNKRKEKAG* |
| Ga0075478_101006952 | 3300006026 | Aqueous | MAKQTDNDMIPRLALGLAIFVAMRFAPRLIAWWNKRKETI* |
| Ga0075462_100048205 | 3300006027 | Aqueous | MAKQTDNDMIPRLALGLAIFVAMRFAPRVIEWWNKRKGRT* |
| Ga0075462_100165193 | 3300006027 | Aqueous | MSSKQDNDMIPRLALGLAIFVAMKCAPRLIAWWNKRKEKAI* |
| Ga0075462_102451783 | 3300006027 | Aqueous | MSKQTDNDMIPRLALGLAIFVAMRFAPRLIEWWNKRKEK |
| Ga0075461_101159682 | 3300006637 | Aqueous | MAKQTDNDMIPRLALGLAIFVAMRFAPKVIAWWNKRKEKTI* |
| Ga0075461_101229712 | 3300006637 | Aqueous | MSKQTDNDMIPRLALGLAIFVAMRFAPRLIEWWNKRKEKAI* |
| Ga0075461_102459621 | 3300006637 | Aqueous | MSKQDNDMIPRLALGLAIFVAMRFAPKVIAWWNKRK |
| Ga0098048_10740592 | 3300006752 | Marine | MSKQTDNDMVPRLALGLAVFLAMKLAPRVLAWWTKRKDNQPRNPV* |
| Ga0098048_10899133 | 3300006752 | Marine | MSKQDNDMIPRLALGLAIFVAMRFAPKVIAWWNKRKEKT* |
| Ga0098048_11268852 | 3300006752 | Marine | MAKQTDNDMIPRLALGLAIFVAMRFAPKVIEWWNKRKERYEYT* |
| Ga0070749_100637304 | 3300006802 | Aqueous | MSKQDNDMIPRLALGLAIFVAMRFAPKVIAWWNKRKETI* |
| Ga0070749_101521392 | 3300006802 | Aqueous | MAKQTDNDMIPRLALGLAIFVAMRFAPRLIAWWNKRKNLQPRTPR* |
| Ga0070749_101786153 | 3300006802 | Aqueous | MAKQTDNDMIPRLALGLAIFVAMRFAPRLIEWWNKRKEKTI* |
| Ga0070749_102672194 | 3300006802 | Aqueous | MSKQTDNDMIPRLALGLAIFVAMRFAPRVIAWWNKRKEKTI* |
| Ga0070749_103425334 | 3300006802 | Aqueous | MSKTDNDMIPRLALGLAIFVAMRFAPKVIAWWNKRK |
| Ga0070749_107209891 | 3300006802 | Aqueous | PMAKQTDNDMIPRLALGLAIFVAMRFAPKVIDWWNKRKEKTI* |
| Ga0070749_107618753 | 3300006802 | Aqueous | MAKQTDNDMIPRLALGLAIFVAMRFAPKVIAWWNKR |
| Ga0070754_100350543 | 3300006810 | Aqueous | MTKRNDNDMIPRLALGLAIFVAMKCAPRLIEWWNKRKEKTI* |
| Ga0070754_102969294 | 3300006810 | Aqueous | MAKQTDNDMIPRLALGLAIFVAMRFAPKVIDWWNKRKEKTI* |
| Ga0070754_103525652 | 3300006810 | Aqueous | MSKTDNDMVPRLALGLAIFVAMKCAPRLIKWWNKRKEKA* |
| Ga0070754_104174441 | 3300006810 | Aqueous | MSKQDNDMVPRLALGLAIFVAMKCAPRLIEWWNKRKEKAG* |
| Ga0075481_100361043 | 3300006868 | Aqueous | MAKQTDNDMIPRLALGLAIFVAMRFAPRLIAWWNKRKEKTI* |
| Ga0075477_103556192 | 3300006869 | Aqueous | MSKQDNDMVPRLALGLAIFVAMKCAPKVIEWWNKRKEKTI* |
| Ga0075479_101179483 | 3300006870 | Aqueous | MSKTDNDLIPRLALGLAIFVAMRFAPKVIAWWNKRKEKTI* |
| Ga0075475_101884261 | 3300006874 | Aqueous | MAKQTDNDMIPRLALGLAIFVAMRFAPRLIAWWNKRKE |
| Ga0070750_100792476 | 3300006916 | Aqueous | MTKRNDNDMVPRLALGLAIFVAMKCAPRLIEWWNKRKE |
| Ga0070750_101754963 | 3300006916 | Aqueous | MAKQTDNDMIPRLALGLAIFVAMRFAPKVIAWWNKRKEKAI* |
| Ga0070750_103067053 | 3300006916 | Aqueous | MSKTDNDMIPRLALGLAIFVAMRFAPKVIAWWNKRKDLQPRTPR* |
| Ga0070750_104402773 | 3300006916 | Aqueous | MSKTDNDMIPRIALGLAIFVAMRFAPRVIAWWNKRKEKTI* |
| Ga0070746_103396121 | 3300006919 | Aqueous | AKQTDNDMIPRLALGLAIFVAMRFAPRLIAWWNKRKEKTI* |
| Ga0098045_10843001 | 3300006922 | Marine | RKAMSSKETDNDMVPRLALGLAIFVAMRFAPRLIAWWNKRKEKTI* |
| Ga0098051_10035639 | 3300006924 | Marine | HRKAMSSKETDNDMVPRLALGLAIFVAMRFAPRLIAWWNKRKEKTI* |
| Ga0098051_11047724 | 3300006924 | Marine | MSSKETDNDMVPRLALGLAIFVAMRFAPKVIEWWNKRKEKTI* |
| Ga0098050_11005332 | 3300006925 | Marine | MSSKETDNDMVPRLALGLAIFVAMRFAPRLIAWWNKRKEKTI* |
| Ga0098046_11380933 | 3300006990 | Marine | MEFTTMAKQTDNDMIPRLALGLAIFVAMRFAPKVIEWWNKRKE |
| Ga0075460_103006023 | 3300007234 | Aqueous | KEKPMAKQTDNDMIPRLALGLAIFVAMRFAPRLIEWWNKRKEKTI* |
| Ga0075463_100078215 | 3300007236 | Aqueous | MTKQTDNDMIPRLALGLAIFVAMRFAPKVIAWWNKRKEKTI* |
| Ga0070745_11770393 | 3300007344 | Aqueous | MSKTDNDMIPRIALGLAIFVAMRFAPKVIEWWNKRKEKTI* |
| Ga0070752_11453121 | 3300007345 | Aqueous | DNDMVPRLALGLAIFVAMKCAPKVIEWWNKRKEKTI* |
| Ga0070753_10028623 | 3300007346 | Aqueous | MSKQDNDMVPRLALGLAIFVAMKCAPRLIEWWNKRKEKTI* |
| Ga0070753_10522773 | 3300007346 | Aqueous | MSKTDNDMIPRIALGLAIFVAMRFAPKVIEWWNKRKKTI* |
| Ga0099851_102077913 | 3300007538 | Aqueous | MSKQDNDMIPRLALGLAIFVAMRFAPKVIAWWNKRKEKSESAP* |
| Ga0099849_11326573 | 3300007539 | Aqueous | MTKQTDNDMIPRLALGLAIFVAMRFAPKVIAWWNKRKEKV* |
| Ga0099848_10238629 | 3300007541 | Aqueous | MSKQDNDMIPRLALGLAIFVAMRFAPKVIAWWNKRKEKAI* |
| Ga0070751_12032573 | 3300007640 | Aqueous | MTKRNDNDMVPRLALGLTVFLAMKLAPKVFAWWNKRKDKTI* |
| Ga0070751_12099661 | 3300007640 | Aqueous | MQAMSKTDNDMIPRLALGLAIFVAMRFAPKVIEWWNKRKKTI* |
| Ga0115566_100556102 | 3300009071 | Pelagic Marine | MTKPNDNDMVPRLALGLTVFLAMKLAPRVFAWWNKRKETQPRTPH* |
| Ga0115570_100243119 | 3300009496 | Pelagic Marine | MTKPNDNDMVPRLALGLTVFLAMKLAPRVFAWWNKRKDKTI* |
| Ga0115572_100615831 | 3300009507 | Pelagic Marine | MTKRNDNDMVPRLALGLTVFLAMKLAPRVFAWWNKRKDKTI* |
| Ga0098049_11418323 | 3300010149 | Marine | MSSKETDNDMVPRLALGLAVFLAMKLAPRVFAWWTKRKDKQV* |
| Ga0129348_10134105 | 3300010296 | Freshwater To Marine Saline Gradient | MSKQDNDMIPRLALGLAIFVAMKCAPRLIAWWNKRKERYGN* |
| Ga0129351_12128131 | 3300010300 | Freshwater To Marine Saline Gradient | TDNDMIPRLALGLAIFVAMRFAPKVIAWWNKRKEKTI* |
| Ga0136655_11958411 | 3300010316 | Freshwater To Marine Saline Gradient | MSKQTDNDMIPRLALGLAIFVAMRFAPKVIDWWNKRKGRT* |
| Ga0181387_10040968 | 3300017709 | Seawater | MSKPNDNDMVPRLALGLTVFLAMKLAPRVFAWWNKRKDKTI |
| Ga0181390_11145491 | 3300017719 | Seawater | MSSKQTDNDMVPRLALGLTVFLAMKLAPRVFVWWNKRKEKTI |
| Ga0181399_10945921 | 3300017742 | Seawater | MTKPNDNDMVPRIALGLAVFLAMKLAPRVFDWWNKRKETQPRTPI |
| Ga0181402_100035915 | 3300017743 | Seawater | MAKQTDNDMVPRLALGLAIFVAMRFAPKVIEWWNKRKEKTI |
| Ga0181389_10068496 | 3300017746 | Seawater | MNKQTDNDMVPRLALGLTVFLAMKLAPRVFAWWNKRKEKTESAP |
| Ga0181380_100014242 | 3300017782 | Seawater | MSKQTDNDMIPRLALGLAIFVAMRFAPKVIDWWNKRKGRT |
| Ga0181380_12535231 | 3300017782 | Seawater | QTDNDMIPRLALGLAIFVAMRFAPRLIEWWNKRKEKTI |
| Ga0181577_100698343 | 3300017951 | Salt Marsh | MSKTDNDMIPRLALGLAIFVAMRFAPKVIAWWNKRKEKAI |
| Ga0181577_101767163 | 3300017951 | Salt Marsh | MTKQTDNDMIPRLALGLAIFVAMRFAPKVIAWWNKRKEKV |
| Ga0181577_105483741 | 3300017951 | Salt Marsh | DNDMIPRLALGLAIFVAMRFAPRLIAWWNKRKEKAI |
| Ga0181583_102796421 | 3300017952 | Salt Marsh | MSKTDNDMIPRLALGLAIFVAMRFAPRLIAWWNKRN |
| Ga0181587_110301282 | 3300017968 | Salt Marsh | MSKTDDDMIPRIALGLAIFVAMRFAPKLIAWWNKRKEKTI |
| Ga0181585_103257051 | 3300017969 | Salt Marsh | RFDHAMQVMSSKQDNDMIPRIALGLAIFVAMRFAPRLIAWWNKRKEKTI |
| Ga0181579_100234537 | 3300018039 | Salt Marsh | MSSKQDNDMIPRIALGLAIFVAMRFAPRLIAWWNKRKEKTI |
| Ga0181559_1001616110 | 3300018415 | Salt Marsh | MAKQTDNDMIPRLALGLAIFVAMRFAPKVIDWWNKRKEKT |
| Ga0181563_104319243 | 3300018420 | Salt Marsh | MSSKQDNDMIPRLALGLAIFVAMRFAPKVIAWWNKRK |
| Ga0181563_105345923 | 3300018420 | Salt Marsh | MSKQTDNDMIPRLALGLAIFVAMRFAPKVIDWWNKRT |
| Ga0181563_106235612 | 3300018420 | Salt Marsh | MAKQTDNDMIPRIALGLAIFVAMRFAPKVIDWWNKRKEKT |
| Ga0181563_107798861 | 3300018420 | Salt Marsh | MSKTDNDMIPRLALGLAIFVAMRFAPKVIAWWNNRKEKTI |
| Ga0181592_102291323 | 3300018421 | Salt Marsh | MSSKQDNDMIPRLALGLAIFVAMRFAPRLIEWWNKRKEKTI |
| Ga0181568_103336323 | 3300018428 | Salt Marsh | MQAMSKTDNDMIPRLALGLAIFVAMRFAPKVIAWWNKRKNLQPRTPR |
| Ga0181568_110590841 | 3300018428 | Salt Marsh | RFNHAMQAMSKTDNDMIPRLALGLAIFVAMRFAPRLIEWWNKRKEKTI |
| Ga0194021_10200153 | 3300019703 | Sediment | MAKQTDNDMIPRLALGLAIFVAMRFAPKVIAWWNKRKEKTI |
| Ga0181594_103471073 | 3300020054 | Salt Marsh | MSSKQDNDMIPRIALGLAIFVAMRFAPKVIAWWNKRKNLQPRTPR |
| Ga0181556_12687524 | 3300020176 | Salt Marsh | MAKQTDNDMIPRLALGLAIFVAMRFAPKVIDWWNKRKG |
| Ga0206129_102385503 | 3300020182 | Seawater | MTKPNDNDMVPRLALGLTVFLAMKLAPRVFAWWNKRKDKTI |
| Ga0206130_1002975110 | 3300020187 | Seawater | MSKPSDNDMVPRIALGLTVFLAMKLAPRVFAWWNKRKDKTI |
| Ga0213865_103294561 | 3300021373 | Seawater | MSSKQDNDMIPRLALGLAIFVAMRFAPKVIAWWNKRKE |
| Ga0222718_100436728 | 3300021958 | Estuarine Water | MAKQTDNDMIPRIALGLAIFVAMRFAPKVIEWWNKRKEKSESAP |
| Ga0222718_100762363 | 3300021958 | Estuarine Water | MAKQTDNDMIPRLALGLMVFLAMKLAPRVLAWWNKRKEKTI |
| Ga0212021_10564532 | 3300022068 | Aqueous | MSSKQDNDMIPRLALGLAIFVAMKCAPRLIAWWNKRKEKAI |
| Ga0212021_10753023 | 3300022068 | Aqueous | MSKQTDNDMIPRLALGLAIFVAMRFAPRVIAWWNKRKEKTI |
| Ga0212021_10969733 | 3300022068 | Aqueous | MSKQTDNDMIPRLALGLAIFVAMRFAPRLIEWWNKRKEKAI |
| Ga0196899_10634744 | 3300022187 | Aqueous | MSKQDNDMVPRLALGLAIFVAMKCAPKVIEWWNKRKEKTI |
| Ga0196905_10265703 | 3300022198 | Aqueous | MSKTDNDMIPRLALGLAIFVAMRFAPKVIEWWNKRKETI |
| Ga0196905_10317684 | 3300022198 | Aqueous | MSKQDNDMIPRLALGLAIFVAMRFAPKVIAWWNKRKEKAI |
| Ga0208791_10415753 | 3300025083 | Marine | RKAMSSKETDNDMVPRLALGLAIFVAMRFAPRLIAWWNKRKEKTI |
| Ga0208298_10238533 | 3300025084 | Marine | MAKQTDNDMIPRLALGLAIFVAMRFAPKVIEWWNKRKERYEYT |
| Ga0208793_10415773 | 3300025108 | Marine | MSSKETDNDMVPRLALGLAIFVAMRFAPRLIAWWNKRKEKTI |
| Ga0209716_101754010 | 3300025626 | Pelagic Marine | MTKPNDNDMVPRLALGLTVFLAMKLAPRVFAWWNKRKETQPRTPH |
| Ga0208134_10474063 | 3300025652 | Aqueous | MTKQTDNDMIPRLALGLAIFVAMRFAPKVIAWWNKRKEKTI |
| Ga0208162_10056415 | 3300025674 | Aqueous | MSKQDNDMIPRLALGLAIFVAMKCAPRLIAWWNKRKERYGN |
| Ga0208150_11258014 | 3300025751 | Aqueous | KAMSKTDNDLIPRLALGLAIFVAMRFAPKVIAWWNKRKEKTI |
| Ga0208899_102089811 | 3300025759 | Aqueous | MSKQDNDMIPRLALGLAIFVAMRFAPKVIAWWNKRKEKTI |
| Ga0208899_10353783 | 3300025759 | Aqueous | MSKQTDNDMIPRLALGLAIFVAMRFAPRVIAWWNNRKEKTI |
| Ga0208767_10670393 | 3300025769 | Aqueous | MAKQTDNDMIPRLALGLAIFVAMRFAPRLIEWWNKRKEKTI |
| Ga0208767_12656192 | 3300025769 | Aqueous | MAKQTDNDMIPRLALGLAIFVAMRFAPKVIAWWNKRKEKV |
| Ga0208427_10243651 | 3300025771 | Aqueous | RFNHAMQAMSKTDNDMIPRLALGLAIFVAMRFAPRLIAWWNKRKETI |
| Ga0208425_10879831 | 3300025803 | Aqueous | FITMAKQTDNDMIPRLALGLAIFVAMRFAPRVIEWWNKRKGRT |
| Ga0208542_100573310 | 3300025818 | Aqueous | MAKQTDNDMIPRLALGLAIFVAMRFAPRLIAWWNKRKNLQPRTPR |
| Ga0208542_10085952 | 3300025818 | Aqueous | MSKQDNDMIPRLALGLAIFVAMRFAPKVIAWWNKRKETI |
| Ga0208542_10286728 | 3300025818 | Aqueous | MSKTDNDMIPRLALGLAIFVAMRFAPKVIAWWNKR |
| Ga0208542_11621631 | 3300025818 | Aqueous | AKQTDNDMIPRLALGLAIFVAMRFAPRLIAWWNKRKEKTI |
| Ga0208644_10283612 | 3300025889 | Aqueous | MSKTDNDMIPRLALGLAIFVAMRFAPKVIAWWNKRKEKTI |
| Ga0348335_014203_2_109 | 3300034374 | Aqueous | MAKQTDNDMIPRLALGLAIFVAMRFAPRLIAWWNKR |
| Ga0348335_047083_765_884 | 3300034374 | Aqueous | MSKTDNDMIPRIALGLAIFVAMRFAPKVIEWWNKRKKTI |
| ⦗Top⦘ |