


| Basic Information | |
|---|---|
| Family ID | F081224 |
| Family Type | Metagenome |
| Number of Sequences | 114 |
| Average Sequence Length | 44 residues |
| Representative Sequence | DAAEEWAACLKQVMEEAEAKWLGDIPALAEVSIGKTWMETH |
| Number of Associated Samples | 99 |
| Number of Associated Scaffolds | 114 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 88.60 % |
| Associated GOLD sequencing projects | 83 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (53.509 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (25.439 % of family members) |
| Environment Ontology (ENVO) | Unclassified (72.807 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (83.333 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.58% β-sheet: 0.00% Coil/Unstructured: 59.42% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 114 Family Scaffolds |
|---|---|---|
| PF13392 | HNH_3 | 14.91 |
| PF04542 | Sigma70_r2 | 5.26 |
| PF04545 | Sigma70_r4 | 3.51 |
| PF00476 | DNA_pol_A | 2.63 |
| PF13529 | Peptidase_C39_2 | 0.88 |
| PF01402 | RHH_1 | 0.88 |
| PF00959 | Phage_lysozyme | 0.88 |
| PF14279 | HNH_5 | 0.88 |
| PF06559 | DCD | 0.88 |
| PF01844 | HNH | 0.88 |
| PF12385 | Peptidase_C70 | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 114 Family Scaffolds |
|---|---|---|---|
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 5.26 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 5.26 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 5.26 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 5.26 |
| COG0749 | DNA polymerase I, 3'-5' exonuclease and polymerase domains | Replication, recombination and repair [L] | 2.63 |
| COG0717 | dCTP deaminase | Nucleotide transport and metabolism [F] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 53.51 % |
| All Organisms | root | All Organisms | 46.49 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000117|DelMOWin2010_c10024371 | Not Available | 3076 | Open in IMG/M |
| 3300000949|BBAY94_10205343 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured phage MedDCM-OCT-S01-C29 | 530 | Open in IMG/M |
| 3300001748|JGI11772J19994_1003234 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales | 3262 | Open in IMG/M |
| 3300002488|JGI25128J35275_1095246 | Not Available | 603 | Open in IMG/M |
| 3300004460|Ga0066222_1000953 | Not Available | 5211 | Open in IMG/M |
| 3300004951|Ga0068513_1024547 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 652 | Open in IMG/M |
| 3300005512|Ga0074648_1176339 | Not Available | 617 | Open in IMG/M |
| 3300005942|Ga0070742_10085546 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 866 | Open in IMG/M |
| 3300006025|Ga0075474_10081761 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1058 | Open in IMG/M |
| 3300006735|Ga0098038_1283993 | Not Available | 517 | Open in IMG/M |
| 3300006737|Ga0098037_1062470 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured phage MedDCM-OCT-S04-C491 | 1327 | Open in IMG/M |
| 3300006749|Ga0098042_1052878 | All Organisms → Viruses → Predicted Viral | 1098 | Open in IMG/M |
| 3300006793|Ga0098055_1272736 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 634 | Open in IMG/M |
| 3300006810|Ga0070754_10361768 | Not Available | 640 | Open in IMG/M |
| 3300006810|Ga0070754_10410084 | Not Available | 592 | Open in IMG/M |
| 3300006810|Ga0070754_10428631 | Not Available | 576 | Open in IMG/M |
| 3300006870|Ga0075479_10125589 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1055 | Open in IMG/M |
| 3300006874|Ga0075475_10178708 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 918 | Open in IMG/M |
| 3300006916|Ga0070750_10199364 | Not Available | 887 | Open in IMG/M |
| 3300006920|Ga0070748_1137568 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 913 | Open in IMG/M |
| 3300006924|Ga0098051_1027575 | All Organisms → Viruses | 1619 | Open in IMG/M |
| 3300007344|Ga0070745_1210470 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 715 | Open in IMG/M |
| 3300007344|Ga0070745_1247538 | Not Available | 645 | Open in IMG/M |
| 3300007539|Ga0099849_1071386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1417 | Open in IMG/M |
| 3300007640|Ga0070751_1258954 | Not Available | 658 | Open in IMG/M |
| 3300008012|Ga0075480_10325259 | Not Available | 774 | Open in IMG/M |
| 3300009001|Ga0102963_1226561 | Not Available | 742 | Open in IMG/M |
| 3300009508|Ga0115567_10059303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 2845 | Open in IMG/M |
| 3300009512|Ga0115003_10131535 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1526 | Open in IMG/M |
| 3300009703|Ga0114933_10923164 | Not Available | 554 | Open in IMG/M |
| 3300010148|Ga0098043_1019452 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2189 | Open in IMG/M |
| 3300010149|Ga0098049_1054769 | Not Available | 1270 | Open in IMG/M |
| 3300010299|Ga0129342_1145373 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 867 | Open in IMG/M |
| 3300010354|Ga0129333_10993672 | Not Available | 705 | Open in IMG/M |
| 3300010368|Ga0129324_10348633 | Not Available | 576 | Open in IMG/M |
| 3300010389|Ga0136549_10378914 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300012919|Ga0160422_10339708 | Not Available | 928 | Open in IMG/M |
| 3300012919|Ga0160422_10358706 | Not Available | 903 | Open in IMG/M |
| 3300012919|Ga0160422_10556681 | Not Available | 725 | Open in IMG/M |
| 3300012953|Ga0163179_11496967 | Not Available | 607 | Open in IMG/M |
| 3300017708|Ga0181369_1072911 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 740 | Open in IMG/M |
| 3300017708|Ga0181369_1079005 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 702 | Open in IMG/M |
| 3300017709|Ga0181387_1023122 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1211 | Open in IMG/M |
| 3300017717|Ga0181404_1040285 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1188 | Open in IMG/M |
| 3300017732|Ga0181415_1076837 | Not Available | 754 | Open in IMG/M |
| 3300017732|Ga0181415_1110261 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 620 | Open in IMG/M |
| 3300017738|Ga0181428_1055111 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 927 | Open in IMG/M |
| 3300017739|Ga0181433_1101810 | Not Available | 696 | Open in IMG/M |
| 3300017744|Ga0181397_1108677 | Not Available | 726 | Open in IMG/M |
| 3300017748|Ga0181393_1080024 | Not Available | 857 | Open in IMG/M |
| 3300017750|Ga0181405_1071708 | Not Available | 893 | Open in IMG/M |
| 3300017752|Ga0181400_1051280 | Not Available | 1278 | Open in IMG/M |
| 3300017755|Ga0181411_1019211 | Not Available | 2226 | Open in IMG/M |
| 3300017756|Ga0181382_1055753 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1130 | Open in IMG/M |
| 3300017757|Ga0181420_1160441 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 667 | Open in IMG/M |
| 3300017762|Ga0181422_1208936 | Not Available | 586 | Open in IMG/M |
| 3300017763|Ga0181410_1166197 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 615 | Open in IMG/M |
| 3300017767|Ga0181406_1027335 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage MEDS1 group | 1791 | Open in IMG/M |
| 3300017768|Ga0187220_1197834 | Not Available | 605 | Open in IMG/M |
| 3300017769|Ga0187221_1146192 | Not Available | 701 | Open in IMG/M |
| 3300017781|Ga0181423_1000333 | Not Available | 23974 | Open in IMG/M |
| 3300017951|Ga0181577_10176568 | All Organisms → cellular organisms → Bacteria | 1439 | Open in IMG/M |
| 3300017986|Ga0181569_10898519 | Not Available | 576 | Open in IMG/M |
| 3300018049|Ga0181572_10310662 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1000 | Open in IMG/M |
| 3300018420|Ga0181563_10208038 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1189 | Open in IMG/M |
| 3300018428|Ga0181568_10818209 | Not Available | 719 | Open in IMG/M |
| 3300019739|Ga0194012_1060268 | Not Available | 544 | Open in IMG/M |
| 3300019745|Ga0194002_1101257 | Not Available | 507 | Open in IMG/M |
| 3300019751|Ga0194029_1022079 | Not Available | 976 | Open in IMG/M |
| 3300020246|Ga0211707_1039257 | Not Available | 644 | Open in IMG/M |
| 3300020410|Ga0211699_10328987 | Not Available | 599 | Open in IMG/M |
| 3300020410|Ga0211699_10420159 | Not Available | 530 | Open in IMG/M |
| 3300020410|Ga0211699_10429554 | Not Available | 524 | Open in IMG/M |
| 3300020417|Ga0211528_10196172 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 777 | Open in IMG/M |
| 3300020436|Ga0211708_10391492 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 570 | Open in IMG/M |
| 3300020461|Ga0211535_10391295 | Not Available | 630 | Open in IMG/M |
| 3300020474|Ga0211547_10322096 | Not Available | 783 | Open in IMG/M |
| 3300021335|Ga0213867_1004968 | Not Available | 5743 | Open in IMG/M |
| 3300021356|Ga0213858_10134399 | Not Available | 1208 | Open in IMG/M |
| 3300021373|Ga0213865_10088961 | All Organisms → cellular organisms → Bacteria | 1661 | Open in IMG/M |
| 3300021959|Ga0222716_10015133 | Not Available | 5793 | Open in IMG/M |
| 3300021959|Ga0222716_10475511 | Not Available | 708 | Open in IMG/M |
| 3300021960|Ga0222715_10058666 | Not Available | 2621 | Open in IMG/M |
| 3300022057|Ga0212025_1026098 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 969 | Open in IMG/M |
| 3300022149|Ga0196907_101110 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1240 | Open in IMG/M |
| 3300022158|Ga0196897_1042201 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 542 | Open in IMG/M |
| 3300022167|Ga0212020_1063002 | Not Available | 627 | Open in IMG/M |
| 3300022187|Ga0196899_1032867 | All Organisms → Viruses → Predicted Viral | 1807 | Open in IMG/M |
| 3300024346|Ga0244775_10513575 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 978 | Open in IMG/M |
| 3300025101|Ga0208159_1013347 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2140 | Open in IMG/M |
| 3300025127|Ga0209348_1160920 | Not Available | 653 | Open in IMG/M |
| 3300025132|Ga0209232_1226619 | Not Available | 554 | Open in IMG/M |
| 3300025132|Ga0209232_1254137 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 505 | Open in IMG/M |
| 3300025751|Ga0208150_1246026 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 540 | Open in IMG/M |
| 3300025751|Ga0208150_1272117 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Slopekvirinae → Drulisvirus | 507 | Open in IMG/M |
| 3300025771|Ga0208427_1029650 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2099 | Open in IMG/M |
| 3300025771|Ga0208427_1220777 | Not Available | 594 | Open in IMG/M |
| 3300025815|Ga0208785_1056902 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1072 | Open in IMG/M |
| 3300025840|Ga0208917_1075423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1277 | Open in IMG/M |
| 3300025853|Ga0208645_1277436 | Not Available | 540 | Open in IMG/M |
| 3300025881|Ga0209309_10086164 | All Organisms → Viruses → Predicted Viral | 1740 | Open in IMG/M |
| 3300026187|Ga0209929_1177107 | Not Available | 506 | Open in IMG/M |
| 3300027571|Ga0208897_1123812 | Not Available | 649 | Open in IMG/M |
| 3300027675|Ga0209077_1207099 | Not Available | 547 | Open in IMG/M |
| 3300028197|Ga0257110_1054138 | Not Available | 1742 | Open in IMG/M |
| 3300029309|Ga0183683_1028490 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1010 | Open in IMG/M |
| 3300031539|Ga0307380_11170757 | Not Available | 598 | Open in IMG/M |
| 3300031566|Ga0307378_10295422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1534 | Open in IMG/M |
| 3300031673|Ga0307377_10697793 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 713 | Open in IMG/M |
| 3300031952|Ga0315294_10093880 | Not Available | 3116 | Open in IMG/M |
| 3300034374|Ga0348335_103032 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 891 | Open in IMG/M |
| 3300034374|Ga0348335_121314 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300034374|Ga0348335_152017 | Not Available | 631 | Open in IMG/M |
| 3300034375|Ga0348336_156690 | Not Available | 668 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 25.44% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 16.67% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 13.16% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 7.89% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 4.39% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater | 2.63% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 2.63% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.63% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 2.63% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.63% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 2.63% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 1.75% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 1.75% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 1.75% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment | 1.75% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.88% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.88% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.88% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.88% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.88% |
| Marine Water | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Water | 0.88% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.88% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.88% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 0.88% |
| Marine Methane Seep Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Methane Seep Sediment | 0.88% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.88% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300000949 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94 | Host-Associated | Open in IMG/M |
| 3300001748 | Saline surface water microbial communities from Etoliko Lagoon, Greece - surface water (0 m) | Environmental | Open in IMG/M |
| 3300002488 | Marine viral communities from the Pacific Ocean - ETNP_2_60 | Environmental | Open in IMG/M |
| 3300004460 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300004951 | Marine water microbial communities from the East Sea, Korea with extracellular vesicles - East-Sea-EVs | Environmental | Open in IMG/M |
| 3300005512 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_water | Environmental | Open in IMG/M |
| 3300005942 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.757 | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006870 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006874 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300006924 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009508 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 | Environmental | Open in IMG/M |
| 3300009512 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 | Environmental | Open in IMG/M |
| 3300009703 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaG | Environmental | Open in IMG/M |
| 3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010389 | Marine sediment microbial communities from methane seeps within Baltimore Canyon, US Atlantic Margin - Baltimore Canyon MUC-11 12-14 cmbsf | Environmental | Open in IMG/M |
| 3300012919 | Marine microbial communities from the Central Pacific Ocean - Fk160115 60m metaG | Environmental | Open in IMG/M |
| 3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
| 3300017708 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG | Environmental | Open in IMG/M |
| 3300017709 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27 | Environmental | Open in IMG/M |
| 3300017717 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25 | Environmental | Open in IMG/M |
| 3300017732 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 38 SPOT_SRF_2012-12-11 | Environmental | Open in IMG/M |
| 3300017738 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12 | Environmental | Open in IMG/M |
| 3300017739 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 | Environmental | Open in IMG/M |
| 3300017744 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23 | Environmental | Open in IMG/M |
| 3300017748 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21 | Environmental | Open in IMG/M |
| 3300017750 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29 | Environmental | Open in IMG/M |
| 3300017752 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22 | Environmental | Open in IMG/M |
| 3300017755 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09 | Environmental | Open in IMG/M |
| 3300017756 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 | Environmental | Open in IMG/M |
| 3300017757 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22 | Environmental | Open in IMG/M |
| 3300017762 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18 | Environmental | Open in IMG/M |
| 3300017763 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20 | Environmental | Open in IMG/M |
| 3300017767 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20 | Environmental | Open in IMG/M |
| 3300017768 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2) | Environmental | Open in IMG/M |
| 3300017769 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2) | Environmental | Open in IMG/M |
| 3300017781 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14 | Environmental | Open in IMG/M |
| 3300017951 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017986 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018049 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018428 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019739 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLC_8-9_MG | Environmental | Open in IMG/M |
| 3300019745 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLT_8-9_MG | Environmental | Open in IMG/M |
| 3300019751 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW18Oct16_MG | Environmental | Open in IMG/M |
| 3300020246 | Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX555934-ERR599105) | Environmental | Open in IMG/M |
| 3300020410 | Marine microbial communities from Tara Oceans - TARA_B100000519 (ERX555959-ERR599148) | Environmental | Open in IMG/M |
| 3300020417 | Marine microbial communities from Tara Oceans - TARA_B100000073 (ERX556034-ERR599082) | Environmental | Open in IMG/M |
| 3300020436 | Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX556009-ERR598984) | Environmental | Open in IMG/M |
| 3300020461 | Marine microbial communities from Tara Oceans - TARA_B100000401 (ERX556127-ERR599150) | Environmental | Open in IMG/M |
| 3300020474 | Marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001564 (ERX555957-ERR598976) | Environmental | Open in IMG/M |
| 3300021335 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540 | Environmental | Open in IMG/M |
| 3300021356 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245 | Environmental | Open in IMG/M |
| 3300021373 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282 | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300022057 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v2) | Environmental | Open in IMG/M |
| 3300022149 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022158 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v3) | Environmental | Open in IMG/M |
| 3300022167 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v2) | Environmental | Open in IMG/M |
| 3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300025101 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025127 | Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300025751 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025771 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025815 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025840 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300025881 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 (SPAdes) | Environmental | Open in IMG/M |
| 3300026187 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300027571 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 (SPAdes) | Environmental | Open in IMG/M |
| 3300027675 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300028197 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_10m | Environmental | Open in IMG/M |
| 3300029309 | Marine viral communities collected during Tara Oceans survey from station TARA_100 - TARA_R100001440 | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031566 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-1 | Environmental | Open in IMG/M |
| 3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
| 3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| 3300034375 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOWin2010_100243711 | 3300000117 | Marine | EEKAQHWADQLKQVMESAEAKWLGDIPPLAEPSIGKRWSEIH* |
| BBAY94_102053431 | 3300000949 | Macroalgal Surface | LLLVREDAAEEGAATLKQAMEEAEAKWLGEIPALAEVSFGKTWQETH* |
| JGI11772J19994_10032349 | 3300001748 | Saline Water And Sediment | WAAKLKRIMEDAEAQWLGDVPPLAEPSVGKRWSEIH* |
| JGI25128J35275_10952461 | 3300002488 | Marine | EDIADEWAQILKTTMEKAEAKWLGEIPALAEVSIGDKWSEVH* |
| Ga0066222_100095316 | 3300004460 | Marine | EVKIGGWLHDEILLLIREGKAQQWGGQVKQVMESAEAKWLGDIPPLAEPSIGKRWSEIH* |
| Ga0068513_10245473 | 3300004951 | Marine Water | AEEWAATLKQVMEEAEAKWLGEIPALAEVSFGKTWQETH* |
| Ga0074648_11763391 | 3300005512 | Saline Water And Sediment | AKLKRIMEDAEAQWLGDVPPLAEPSVGKRWSEIH* |
| Ga0070742_100855464 | 3300005942 | Estuarine | WALQLKQVMESAEAKWLGDIPPLAEPSIGKRWSEIH* |
| Ga0075474_100817614 | 3300006025 | Aqueous | VKEDKAQYWAEQLKRIMESAEAKWLGEIPPLAEPSVGKRWSEIH* |
| Ga0098038_12839931 | 3300006735 | Marine | ELLLLVKEDIADEWAQILKTTMEKAEAKWLGEIPALAEVSIGNKWSEVH* |
| Ga0098037_10624701 | 3300006737 | Marine | EDAAQEWAGVLKQVMEAAEARWLGEIPALAEVSIGKTWDEAH* |
| Ga0098042_10528783 | 3300006749 | Marine | LLVKEDLADEWAQILKTTMEKAEAKWLGDVPALAEVSIGDKWSEVH* |
| Ga0098055_12727361 | 3300006793 | Marine | DEWAAVLKQVMEEAEAKWLGEIPSLAEVSIGKTWREVH*LQ* |
| Ga0070754_103617682 | 3300006810 | Aqueous | HDEVVLLVREGYENRWAEILKDVMEKAEAKWLGEIPALAEVHVGKTWSDVH* |
| Ga0070754_104100842 | 3300006810 | Aqueous | AAILKEIMEAAEAKWLGDIPALAEVNVGKRWSDTH* |
| Ga0070754_104286311 | 3300006810 | Aqueous | KAQHWAAELKRIMESAEAKWLGEIPPLAEPSVGKRWSEIH* |
| Ga0075479_101255891 | 3300006870 | Aqueous | VVLLVREGYEKRWAEILKDVMERAEAKWLGDIPALAEVNVGKRWSDTH* |
| Ga0075475_101787081 | 3300006874 | Aqueous | VHDEVVLLVREGYENRWAEILKDVMERAEAKWLGDIPALAEVNVGKRWSDTH* |
| Ga0070750_101993643 | 3300006916 | Aqueous | ANEWAARLKQVMESAEAKWLGTVPPLAEPQVGKRWSEIH* |
| Ga0070748_11375684 | 3300006920 | Aqueous | LLLVKEDKAQHWAAELKRIMESAEAKWLGEIPPLAEPSVGKRWSEIH* |
| Ga0098051_10275751 | 3300006924 | Marine | ACLKQVMEEAEAKWLGDIPALAEVSIGKTWMETH* |
| Ga0070745_12104701 | 3300007344 | Aqueous | DEILLLVREGYEERWAAILKEVMEAAEAKWLGDIPALAEVNVGKRWSDTH* |
| Ga0070745_12475382 | 3300007344 | Aqueous | EERWAAILKEIMEAAEAKWLGDIPALAEVNVGKRWSETH* |
| Ga0099849_10713861 | 3300007539 | Aqueous | LVREGYEKRWAEILKDVMERAEAKWLGEIPALAEVHVGKTWSEVH* |
| Ga0070751_12589542 | 3300007640 | Aqueous | QGYEERWAAILKEVMEAAEAKWLGDIPALAEVNVGKRWSETH* |
| Ga0075480_103252593 | 3300008012 | Aqueous | GYEERWAAILKEIMEAAEAKWLGDIPALAEVNVGKRWSETH* |
| Ga0102963_12265611 | 3300009001 | Pond Water | EGYEEKWAKILTDVMEQAEAKWLGDIPPLAEAHYGKTWAAAKG* |
| Ga0115567_100593036 | 3300009508 | Pelagic Marine | IHDEILLLVREDKAQQWALQLKQVMESAEAKWLGDIPPLAEPSVGKRWSEIH* |
| Ga0115003_101315355 | 3300009512 | Marine | REDKAQQWADQLKQVMESAEAKWLGDIPPLAEPSIGKRWSEIH* |
| Ga0114933_109231642 | 3300009703 | Deep Subsurface | ELILLVKEDLADEWAQILKTTMEKAEAKWLGDVPALAEVSIGDKWSEVH* |
| Ga0098043_10194526 | 3300010148 | Marine | HDELILLVKEDLADEWAQILKTTMEKAEAKWLGDVPALAEVSIGDKWSEVH* |
| Ga0098049_10547691 | 3300010149 | Marine | AAEEWAACLKQVMEEAEAKWLGDIPALAEVSIGKTWMETH* |
| Ga0129342_11453733 | 3300010299 | Freshwater To Marine Saline Gradient | DEILLLVRDGLAQHWADQLKQVMEAAEAKWLGEVPPLAEVKVGKTWAETH* |
| Ga0129333_109936721 | 3300010354 | Freshwater To Marine Saline Gradient | VLLLVREGQEQEWAATLKRVMEEAEAKWLGDIPALAEVHTGTRWSETH* |
| Ga0129324_103486331 | 3300010368 | Freshwater To Marine Saline Gradient | DEILLLVKEDKAQEWAAKLKRIMEDAEAMWLGDIPPLAEPSIGKRWSEIH* |
| Ga0136549_103789142 | 3300010389 | Marine Methane Seep Sediment | ADHLKRVMEAAEAKWLGDIPALAEVHIGKVWSETH* |
| Ga0160422_103397084 | 3300012919 | Seawater | LVKEDLADEWAEILKTTMEKAEAKWLGDVPALAEVSIGDKWSEVH* |
| Ga0160422_103587061 | 3300012919 | Seawater | DEWAEILKTTMENAEAKWLGDVPALAEVSIGDRWSEVH* |
| Ga0160422_105566811 | 3300012919 | Seawater | ILLVKEDIANEWAEILKETMEKAEAKWLGDVPALAEVSVGDKWSEVH* |
| Ga0163179_114969671 | 3300012953 | Seawater | AAVHDELLLLVKEDIADEWAQILKTTMEKAEAKWLGEIPALAEVSIGNKWSEVH* |
| Ga0181369_10729111 | 3300017708 | Marine | KAEEWAAKLKRVMEDAEAMWLDDIPPLAEPSIGKRWSEIH |
| Ga0181369_10790051 | 3300017708 | Marine | AEEWAACLKQVMEEAEAKWLGDIPALAEVSIGKTWMETH |
| Ga0181387_10231221 | 3300017709 | Seawater | LLLLVKEDIADEWAQILKTTMEKAEAKWLGEIPALAEVSIGDKWSEVH |
| Ga0181404_10402855 | 3300017717 | Seawater | EEWAAVLKQVMEEAEAIWLEDIPALAEVSIGKTWMETH |
| Ga0181415_10768371 | 3300017732 | Seawater | EDIADEWAEILKNTMEKAEAKWLGEIPALAEVSIGNKWSEVH |
| Ga0181415_11102613 | 3300017732 | Seawater | LLLVREDAAEEWAAALKKVMEEAEAKWLGEIPALAEVSVGKTWSDVH |
| Ga0181428_10551111 | 3300017738 | Seawater | AQEWAATLKQVMEEAEAQWLGEIPALAEVSIGKTWMETH |
| Ga0181433_11018105 | 3300017739 | Seawater | EWAQILKTTMEKAEAKWLGEIPALAEVSIGNKWSEVH |
| Ga0181397_11086771 | 3300017744 | Seawater | DIADEWAQILKTTMEKAEAKWLGEIPALAEVSIGDKWSEVH |
| Ga0181393_10800244 | 3300017748 | Seawater | AAAVHDELLLLVKEDIADEWAQILKTTMEKAEAKWLGEIPALAEVSIGDKWSEVH |
| Ga0181405_10717081 | 3300017750 | Seawater | VKEDIADEWAQILKTTMEKAEAKWLGEIPALAEVSIGDKWSEVH |
| Ga0181400_10512805 | 3300017752 | Seawater | AREDAAEEWAACLNHVMEEAEAKWLGDLPALAEVSIGKTWMETH |
| Ga0181411_10192114 | 3300017755 | Seawater | LVREDAAEEWAACLKQVMEEAEAKWLGDIPPLAEVSIGKTWMETH |
| Ga0181382_10557531 | 3300017756 | Seawater | EWAACLKQEMEEAEAKWLGDIPALAEVSIGKTWMETH |
| Ga0181420_11604411 | 3300017757 | Seawater | NTTKWASILKESMEEAEYKWLGNIPSLAEVSIGKTWSEVH |
| Ga0181422_12089361 | 3300017762 | Seawater | DEILLLVREDVAEEWAKTLKQVMEEAEAKWLGDIPALAEVSIGKTWMETH |
| Ga0181410_11661972 | 3300017763 | Seawater | DAAEEWAACLKQVMEEAEAKWLGDIPALAEVSIGKTWMETH |
| Ga0181406_10273351 | 3300017767 | Seawater | AAAVHDELLLLVKEDIADEWAQILKTTMEKAEAKWLGEIPALAEVSIGNKWSEVH |
| Ga0187220_11978343 | 3300017768 | Seawater | DIADEWAEILKNTMEKAEAKWLGEIPALAEVSIGNKWSEVH |
| Ga0187221_11461921 | 3300017769 | Seawater | AVHDELLLLVKEDIADEWAQILKTTMEKAEAKWLGEIPALAEVSIGDKWSEVH |
| Ga0181423_10003331 | 3300017781 | Seawater | AAEEWAKTLKQVMEEAEAHWLGDIPALAEVSTGKTWEETH |
| Ga0181577_101765686 | 3300017951 | Salt Marsh | AATLKQVMEEAEAKWLGEIPALAEVSFGKTWQETH |
| Ga0181569_108985193 | 3300017986 | Salt Marsh | CVHDEILLLVKEDKAQHWAAELKRIMESAEAKWLGEIPPLAEPSVGKRWSEIH |
| Ga0181572_103106624 | 3300018049 | Salt Marsh | WAAELKRIMESAEAKWLGEIPPLAEPSVGKRWSEIH |
| Ga0181563_102080384 | 3300018420 | Salt Marsh | LLVREDAAQEWAATLKQVMEEAEAQWLGEIPALAEVSIGKTWMETH |
| Ga0181568_108182091 | 3300018428 | Salt Marsh | LVKEDKAQHWAAELKRIMESAEAKWLGEIPPLAEPSVGKRWSEIH |
| Ga0194012_10602683 | 3300019739 | Sediment | AACVHDEILLLVKEDKAQHWAAELKRIMESAEAKWLGEIPPLAEPSVGKRWSEIH |
| Ga0194002_11012571 | 3300019745 | Sediment | CVHDEILLLVREPKANEWAARLKQVMESAEAMWLGDVPPLAEPQVGKRWSEIH |
| Ga0194029_10220794 | 3300019751 | Freshwater | KAQQWALQLKQVMESAEAKWLGDIPPLAEPSVGKRWSEIH |
| Ga0211707_10392571 | 3300020246 | Marine | KEDLADEWAEILKTTMENAEAKWLGDVPALAEVSIGDRWSEVH |
| Ga0211699_103289873 | 3300020410 | Marine | ILLVKEDLADEWAQILKTTMEKAEAKWLGNVPALAEVSIGDKWSEVH |
| Ga0211699_104201591 | 3300020410 | Marine | HDELILLVKEDLADEWAEILKTTMENAEAKWLGDVPALAEVSIGDRWSEVH |
| Ga0211699_104295542 | 3300020410 | Marine | HDELILLVKEDLADEWAEILKTTMEKAEAKWLGDVPALAEVSIGDRWSEVH |
| Ga0211528_101961724 | 3300020417 | Marine | AAQEWAATLKQVMEEAEAQWLGEIPALAEVSIGKTWMETH |
| Ga0211708_103914924 | 3300020436 | Marine | DEWAKILKTTMENAEAKWLGDVPALAEVSIGDKWSEVH |
| Ga0211535_103912951 | 3300020461 | Marine | DELILLVKEDLADEWAEILKTTMEKAEAKWLGDVPALAEVSIGDKWSEVH |
| Ga0211547_103220964 | 3300020474 | Marine | VKEDSADEWAEILKTTMEKSEAKWLGDVPALAEVSIGNRWSEVH |
| Ga0213867_100496816 | 3300021335 | Seawater | LIVKEDRAEEWAAKLKRIMEDAEAMWLGDIPPLAEPSIGKRWSEIH |
| Ga0213858_101343995 | 3300021356 | Seawater | EDAAQEWAATLEQVMEDAEAKWLGEIPALAEVSVGKTWSEVH |
| Ga0213865_100889611 | 3300021373 | Seawater | QEWAATLKQVMEDAEAKWLGKIPALAEVSVGKTWSEVH |
| Ga0222716_1001513317 | 3300021959 | Estuarine Water | IHDEILLLVREEKAQQWADQLKQVMESAEAKWLGDIPPLAEPSIGKRWSEIH |
| Ga0222716_104755111 | 3300021959 | Estuarine Water | LVREDKAQRWADQLKQVMETAESKWLGDIPPLAEPSIGKRWSEIH |
| Ga0222715_100586667 | 3300021960 | Estuarine Water | EDKAQQLALQLKQVMENAEAKWLGDIPPLAEPSVGKRWSEIH |
| Ga0212025_10260984 | 3300022057 | Aqueous | WAEHLKRVMEAAEAKWLGDIPALAEPQIGKRWSEAH |
| Ga0196907_1011101 | 3300022149 | Aqueous | ILLLVKEDKAQYWAEQLKRIMESAEAKWLGEIPPLAEPSVGKRWSEIH |
| Ga0196897_10422011 | 3300022158 | Aqueous | YEKRWAEILKDVMERAEAKWLGDIPALAEVNVGKRWSDTH |
| Ga0212020_10630021 | 3300022167 | Aqueous | LVREGYEKRWAEILKDVMERAEAKWLGDIPALAEVNVGKRWSDTH |
| Ga0196899_10328671 | 3300022187 | Aqueous | VVKIAAAVHDELLLLVREDHAQWWAEHLKRVMEAAEAKWLGDIPALAEPQIGKRWSEAH |
| Ga0244775_105135754 | 3300024346 | Estuarine | WAEHLKRVMEAAEAKWLGDIPAVAEPQIGKRWSEAH |
| Ga0208159_10133476 | 3300025101 | Marine | KEDLADEWAQILKTTMEKAEAKWLGDVPALAEVSIGDKWSEVH |
| Ga0209348_11609203 | 3300025127 | Marine | LADEWAQILKTTMEKAEAKWLGDVPALAEVSIGDKWSEVH |
| Ga0209232_12266191 | 3300025132 | Marine | EDLADDWAEILKTTMENAEAKWLGDVPALAEVSIGDRWSEVH |
| Ga0209232_12541373 | 3300025132 | Marine | WAATLKEVMEKAESKWLGKIPALAEVSIGKTWWEVH |
| Ga0208150_12460261 | 3300025751 | Aqueous | VVLLVREGYEKRWAEILKDVMERAEAKWLGDIPALAEVNVGKRWSDTH |
| Ga0208150_12721172 | 3300025751 | Aqueous | ILLLVREGYEERWAAILKEVMEAAEAKWLGDIPALAEVNVGKRWSETH |
| Ga0208427_10296501 | 3300025771 | Aqueous | LAAVVHDEVVLLVREGYEKRWAEILKDVMERAEAKWLGDIPALAEVNVGKRWSDTH |
| Ga0208427_12207773 | 3300025771 | Aqueous | EILLLVKEDKAQHWAAELKRIMESAEAKWLGEIPPLAEPSVGKRWSEIH |
| Ga0208785_10569024 | 3300025815 | Aqueous | KAQHWADQLKQVMESAEAKWLGDIPPLAEPSVGKRWSEIH |
| Ga0208917_10754234 | 3300025840 | Aqueous | VREGYEERWAAILKEIMEAAEAKWLGDIPALAEVNVGKRWSDTH |
| Ga0208645_12774361 | 3300025853 | Aqueous | REGYENRWAEILKDVMEKAEAKWLGEIPALAEVHVGKTWSDVH |
| Ga0209309_100861645 | 3300025881 | Pelagic Marine | IHDEILLLVREDKAQQWALQLKQVMESAEAKWLGDIPPLAEPSVGKRWSEIH |
| Ga0209929_11771072 | 3300026187 | Pond Water | EGYEEKWAKILTDVMEQAEAKWLGDIPPLAEAHYGKTWAAAKG |
| Ga0208897_11238121 | 3300027571 | Estuarine | WALQLKQVMESAEAKWLGDIPPLAEPSIGKRWSEIH |
| Ga0209077_12070991 | 3300027675 | Freshwater Sediment | IVLVREDKAEEWAEILTATMQDAEREWLGDVPALAEAGIGDSWDTAK |
| Ga0257110_10541381 | 3300028197 | Marine | EDAAEEWAKTLKQVMEEAEAMWLGDIPALAEVSIGKTWMETH |
| Ga0183683_10284901 | 3300029309 | Marine | VKEDIANEWAEILKETMEKAEAKWLGDVPALAEVSVGDKWSEVH |
| Ga0307380_111707573 | 3300031539 | Soil | QWADQLKQVMESAEAKWLGDIPPLAEPSIGKRWSEIH |
| Ga0307378_102954221 | 3300031566 | Soil | EEKAQQWADQLKQVMESAEAKWLGDIPPLAEPSIGKRWSEIH |
| Ga0307377_106977933 | 3300031673 | Soil | LVREEKAQQWADQLKHVMESAEAKWLGDIPPLAEPSIGKRWSEIH |
| Ga0315294_1009388011 | 3300031952 | Sediment | DRAEEWAEILTATMQDAEREWLGDVPALAEAGIGDSWDTAK |
| Ga0348335_103032_2_160 | 3300034374 | Aqueous | VHDEVVLLVREGYEKRWAEILKDVMERAEAKWLGDIPALAEVNVGKRWSDTH |
| Ga0348335_121314_615_773 | 3300034374 | Aqueous | VRDQVVLLVRDEHAEWWAEHLKRVMEAAEAKWLGEIPALAEVGIGKTWDESH |
| Ga0348335_152017_1_114 | 3300034374 | Aqueous | RWAAILKEIMEAAEAKWLGDIPALAEVNVGKRWSETH |
| Ga0348336_156690_509_667 | 3300034375 | Aqueous | VHDEILLLVREGYEERWAAILKEIMEAAEAKWLGDIPALAEVNVGKRWSETH |
| ⦗Top⦘ |