


| Basic Information | |
|---|---|
| Family ID | F081001 |
| Family Type | Metagenome |
| Number of Sequences | 114 |
| Average Sequence Length | 49 residues |
| Representative Sequence | AGRVAYEISSEKVKHRAERRAQNETFAPVPSFLQGHTSINTVSSGFLVA |
| Number of Associated Samples | 78 |
| Number of Associated Scaffolds | 114 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 44.34 % |
| % of genes near scaffold ends (potentially truncated) | 63.16 % |
| % of genes from short scaffolds (< 2000 bps) | 81.58 % |
| Associated GOLD sequencing projects | 76 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.20 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (83.333 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment (29.825 % of family members) |
| Environment Ontology (ENVO) | Unclassified (37.719 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) (66.667 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 31.17% β-sheet: 0.00% Coil/Unstructured: 68.83% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.20 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 114 Family Scaffolds |
|---|---|---|
| PF09084 | NMT1 | 7.89 |
| PF00005 | ABC_tran | 4.39 |
| PF02515 | CoA_transf_3 | 3.51 |
| PF14518 | Haem_oxygenas_2 | 2.63 |
| PF03745 | DUF309 | 2.63 |
| PF00106 | adh_short | 1.75 |
| PF13720 | Acetyltransf_11 | 1.75 |
| PF00080 | Sod_Cu | 1.75 |
| PF02784 | Orn_Arg_deC_N | 1.75 |
| PF00296 | Bac_luciferase | 1.75 |
| PF00483 | NTP_transferase | 1.75 |
| PF13343 | SBP_bac_6 | 1.75 |
| PF06240 | COXG | 1.75 |
| PF01070 | FMN_dh | 0.88 |
| PF00245 | Alk_phosphatase | 0.88 |
| PF10431 | ClpB_D2-small | 0.88 |
| PF13544 | Obsolete Pfam Family | 0.88 |
| PF05157 | T2SSE_N | 0.88 |
| PF01047 | MarR | 0.88 |
| PF03450 | CO_deh_flav_C | 0.88 |
| PF13419 | HAD_2 | 0.88 |
| PF14520 | HHH_5 | 0.88 |
| PF05402 | PqqD | 0.88 |
| PF00861 | Ribosomal_L18p | 0.88 |
| PF00364 | Biotin_lipoyl | 0.88 |
| PF11146 | DUF2905 | 0.88 |
| PF00472 | RF-1 | 0.88 |
| PF13432 | TPR_16 | 0.88 |
| PF14698 | ASL_C2 | 0.88 |
| PF04767 | Pox_F17 | 0.88 |
| PF05683 | Fumerase_C | 0.88 |
| PF17167 | Glyco_hydro_36 | 0.88 |
| PF05977 | MFS_3 | 0.88 |
| PF13472 | Lipase_GDSL_2 | 0.88 |
| PF00903 | Glyoxalase | 0.88 |
| PF01042 | Ribonuc_L-PSP | 0.88 |
| PF00892 | EamA | 0.88 |
| PF01636 | APH | 0.88 |
| PF05258 | DciA | 0.88 |
| PF02771 | Acyl-CoA_dh_N | 0.88 |
| PF00255 | GSHPx | 0.88 |
| PF00596 | Aldolase_II | 0.88 |
| PF16868 | NMT1_3 | 0.88 |
| PF02397 | Bac_transf | 0.88 |
| PF00557 | Peptidase_M24 | 0.88 |
| PF02954 | HTH_8 | 0.88 |
| PF01909 | NTP_transf_2 | 0.88 |
| PF01595 | CNNM | 0.88 |
| PF00355 | Rieske | 0.88 |
| PF01169 | UPF0016 | 0.88 |
| PF00528 | BPD_transp_1 | 0.88 |
| PF07332 | Phage_holin_3_6 | 0.88 |
| PF01408 | GFO_IDH_MocA | 0.88 |
| PF13414 | TPR_11 | 0.88 |
| PF06500 | FrsA-like | 0.88 |
| PF01479 | S4 | 0.88 |
| PF02824 | TGS | 0.88 |
| PF06745 | ATPase | 0.88 |
| PF01632 | Ribosomal_L35p | 0.88 |
| PF13751 | DDE_Tnp_1_6 | 0.88 |
| PF12911 | OppC_N | 0.88 |
| PF08802 | Obsolete Pfam Family | 0.88 |
| PF07883 | Cupin_2 | 0.88 |
| PF07726 | AAA_3 | 0.88 |
| PF01977 | UbiD | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 114 Family Scaffolds |
|---|---|---|---|
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 7.89 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 7.89 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 3.51 |
| COG1547 | Predicted metal-dependent hydrolase | Function unknown [S] | 2.63 |
| COG0019 | Diaminopimelate decarboxylase | Amino acid transport and metabolism [E] | 1.75 |
| COG1166 | Arginine decarboxylase (spermidine biosynthesis) | Amino acid transport and metabolism [E] | 1.75 |
| COG2032 | Cu/Zn superoxide dismutase | Inorganic ion transport and metabolism [P] | 1.75 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 1.75 |
| COG3427 | Carbon monoxide dehydrogenase subunit CoxG | Energy production and conversion [C] | 1.75 |
| COG0043 | 3-polyprenyl-4-hydroxybenzoate decarboxylase | Coenzyme transport and metabolism [H] | 0.88 |
| COG0069 | Glutamate synthase domain 2 | Amino acid transport and metabolism [E] | 0.88 |
| COG0216 | Protein chain release factor RF1 | Translation, ribosomal structure and biogenesis [J] | 0.88 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.88 |
| COG0256 | Ribosomal protein L18 | Translation, ribosomal structure and biogenesis [J] | 0.88 |
| COG0291 | Ribosomal protein L35 | Translation, ribosomal structure and biogenesis [J] | 0.88 |
| COG0386 | Thioredoxin/glutathione peroxidase BtuE, reduces lipid peroxides | Defense mechanisms [V] | 0.88 |
| COG1186 | Protein chain release factor PrfB | Translation, ribosomal structure and biogenesis [J] | 0.88 |
| COG1304 | FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase | Energy production and conversion [C] | 0.88 |
| COG1785 | Alkaline phosphatase | Inorganic ion transport and metabolism [P] | 0.88 |
| COG1838 | Tartrate dehydratase beta subunit/Fumarate hydratase class I, C-terminal domain | Energy production and conversion [C] | 0.88 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.88 |
| COG2119 | Putative Ca2+/H+ antiporter, TMEM165/GDT1 family | General function prediction only [R] | 0.88 |
| COG2148 | Sugar transferase involved in LPS biosynthesis (colanic, teichoic acid) | Cell wall/membrane/envelope biogenesis [M] | 0.88 |
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 0.88 |
| COG5512 | Predicted nucleic acid-binding protein, contains Zn-ribbon domain (includes truncated derivatives) | General function prediction only [R] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 83.33 % |
| Unclassified | root | N/A | 16.67 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002104|C687J26621_10152081 | Not Available | 707 | Open in IMG/M |
| 3300004022|Ga0055432_10188260 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 589 | Open in IMG/M |
| 3300004062|Ga0055500_10030588 | All Organisms → cellular organisms → Bacteria | 1006 | Open in IMG/M |
| 3300005183|Ga0068993_10282018 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 596 | Open in IMG/M |
| 3300005295|Ga0065707_10001087 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 10668 | Open in IMG/M |
| 3300005295|Ga0065707_10146360 | All Organisms → cellular organisms → Bacteria | 1709 | Open in IMG/M |
| 3300005345|Ga0070692_11248519 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300005353|Ga0070669_100858258 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300005438|Ga0070701_11391313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 504 | Open in IMG/M |
| 3300005444|Ga0070694_100275038 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1282 | Open in IMG/M |
| 3300005518|Ga0070699_101647369 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300005543|Ga0070672_100929224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 769 | Open in IMG/M |
| 3300006847|Ga0075431_100940402 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
| 3300006847|Ga0075431_101411726 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300006852|Ga0075433_11785907 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 529 | Open in IMG/M |
| 3300006876|Ga0079217_10013893 | All Organisms → cellular organisms → Bacteria | 2677 | Open in IMG/M |
| 3300007004|Ga0079218_10179886 | All Organisms → cellular organisms → Bacteria | 1586 | Open in IMG/M |
| 3300009100|Ga0075418_11437589 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. | 748 | Open in IMG/M |
| 3300009609|Ga0105347_1176180 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 848 | Open in IMG/M |
| 3300010391|Ga0136847_12758553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1112 | Open in IMG/M |
| 3300010391|Ga0136847_13420459 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300011410|Ga0137440_1093574 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300011419|Ga0137446_1046646 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 960 | Open in IMG/M |
| 3300011423|Ga0137436_1194797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 534 | Open in IMG/M |
| 3300011427|Ga0137448_1002465 | Not Available | 3236 | Open in IMG/M |
| 3300011427|Ga0137448_1011042 | All Organisms → cellular organisms → Bacteria | 1918 | Open in IMG/M |
| 3300011427|Ga0137448_1020103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1529 | Open in IMG/M |
| 3300011427|Ga0137448_1091360 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 815 | Open in IMG/M |
| 3300011427|Ga0137448_1239448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 502 | Open in IMG/M |
| 3300011436|Ga0137458_1143608 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300012034|Ga0137453_1078325 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300012035|Ga0137445_1123636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 528 | Open in IMG/M |
| 3300012040|Ga0137461_1000009 | All Organisms → cellular organisms → Bacteria | 35929 | Open in IMG/M |
| 3300012040|Ga0137461_1000523 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 8304 | Open in IMG/M |
| 3300012040|Ga0137461_1000889 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6185 | Open in IMG/M |
| 3300012040|Ga0137461_1173097 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300012041|Ga0137430_1129142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 723 | Open in IMG/M |
| 3300012133|Ga0137329_1044703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 574 | Open in IMG/M |
| 3300012146|Ga0137322_1027946 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300012172|Ga0137320_1016833 | All Organisms → cellular organisms → Bacteria | 1438 | Open in IMG/M |
| 3300012179|Ga0137334_1082909 | Not Available | 711 | Open in IMG/M |
| 3300012226|Ga0137447_1133673 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300012228|Ga0137459_1104380 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300012232|Ga0137435_1024226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1743 | Open in IMG/M |
| 3300012350|Ga0137372_10031455 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4859 | Open in IMG/M |
| 3300013297|Ga0157378_11146089 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
| 3300014873|Ga0180066_1055312 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300014878|Ga0180065_1166657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 507 | Open in IMG/M |
| 3300015251|Ga0180070_1069007 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300015371|Ga0132258_12440436 | All Organisms → cellular organisms → Bacteria | 1309 | Open in IMG/M |
| 3300018028|Ga0184608_10532807 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300018031|Ga0184634_10218912 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
| 3300018031|Ga0184634_10279985 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | 765 | Open in IMG/M |
| 3300018053|Ga0184626_10002260 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6998 | Open in IMG/M |
| 3300018053|Ga0184626_10013642 | All Organisms → cellular organisms → Bacteria | 3216 | Open in IMG/M |
| 3300018053|Ga0184626_10021533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2620 | Open in IMG/M |
| 3300018053|Ga0184626_10126092 | Not Available | 1088 | Open in IMG/M |
| 3300018053|Ga0184626_10133800 | All Organisms → cellular organisms → Bacteria | 1054 | Open in IMG/M |
| 3300018056|Ga0184623_10085906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1450 | Open in IMG/M |
| 3300018056|Ga0184623_10142352 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1108 | Open in IMG/M |
| 3300018056|Ga0184623_10161619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1034 | Open in IMG/M |
| 3300018056|Ga0184623_10184626 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
| 3300018056|Ga0184623_10267202 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300018063|Ga0184637_10019552 | All Organisms → cellular organisms → Bacteria | 4077 | Open in IMG/M |
| 3300018063|Ga0184637_10038759 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2893 | Open in IMG/M |
| 3300018063|Ga0184637_10300425 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 972 | Open in IMG/M |
| 3300018063|Ga0184637_10582581 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300018063|Ga0184637_10794444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 505 | Open in IMG/M |
| 3300018071|Ga0184618_10133887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1001 | Open in IMG/M |
| 3300018074|Ga0184640_10548212 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 505 | Open in IMG/M |
| 3300018076|Ga0184609_10550460 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300018077|Ga0184633_10365088 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300018078|Ga0184612_10193443 | All Organisms → cellular organisms → Bacteria | 1058 | Open in IMG/M |
| 3300018078|Ga0184612_10405495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 684 | Open in IMG/M |
| 3300018078|Ga0184612_10483045 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300018079|Ga0184627_10300494 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300018082|Ga0184639_10068064 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1856 | Open in IMG/M |
| 3300018082|Ga0184639_10134446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1312 | Open in IMG/M |
| 3300018084|Ga0184629_10113145 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1342 | Open in IMG/M |
| 3300018084|Ga0184629_10209083 | All Organisms → cellular organisms → Bacteria | 1010 | Open in IMG/M |
| 3300018084|Ga0184629_10315775 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 822 | Open in IMG/M |
| 3300018084|Ga0184629_10559617 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300020003|Ga0193739_1150954 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300021051|Ga0206224_1011191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 995 | Open in IMG/M |
| 3300021051|Ga0206224_1066051 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300021063|Ga0206227_1108236 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05 | 552 | Open in IMG/M |
| 3300021081|Ga0210379_10145727 | Not Available | 1005 | Open in IMG/M |
| 3300025160|Ga0209109_10036487 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2642 | Open in IMG/M |
| 3300025289|Ga0209002_10093254 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1994 | Open in IMG/M |
| 3300025313|Ga0209431_10327055 | All Organisms → cellular organisms → Bacteria | 1195 | Open in IMG/M |
| 3300025314|Ga0209323_10481162 | Not Available | 729 | Open in IMG/M |
| 3300025322|Ga0209641_10127783 | All Organisms → cellular organisms → Bacteria | 1937 | Open in IMG/M |
| 3300025322|Ga0209641_10379270 | Not Available | 1024 | Open in IMG/M |
| 3300025322|Ga0209641_10392144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1003 | Open in IMG/M |
| 3300025535|Ga0207423_1067131 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 642 | Open in IMG/M |
| 3300025580|Ga0210138_1037354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1088 | Open in IMG/M |
| 3300027815|Ga0209726_10299606 | Not Available | 786 | Open in IMG/M |
| 3300027909|Ga0209382_11626446 | Not Available | 637 | Open in IMG/M |
| 3300028803|Ga0307281_10064040 | All Organisms → cellular organisms → Bacteria | 1181 | Open in IMG/M |
| 3300030006|Ga0299907_10207750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1615 | Open in IMG/M |
| 3300031943|Ga0310885_10874392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 514 | Open in IMG/M |
| 3300031965|Ga0326597_10566919 | All Organisms → cellular organisms → Bacteria | 1222 | Open in IMG/M |
| 3300032180|Ga0307471_102497788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas syringae group | 654 | Open in IMG/M |
| 3300034165|Ga0364942_0203887 | Not Available | 646 | Open in IMG/M |
| 3300034178|Ga0364934_0305064 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300034178|Ga0364934_0417498 | Not Available | 508 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 29.82% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 24.56% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.26% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 4.39% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.51% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.51% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 3.51% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 3.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.63% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.63% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 2.63% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 1.75% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.75% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.88% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.88% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.88% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.88% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.88% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.88% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.88% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.88% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.88% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002104 | Groundwater microbial communities from Rifle, Colorado - Rifle CSP2_plank lowO2_0.2 | Environmental | Open in IMG/M |
| 3300004022 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1 | Environmental | Open in IMG/M |
| 3300004062 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300005183 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009609 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300011410 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT222_2 | Environmental | Open in IMG/M |
| 3300011419 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT357_2 | Environmental | Open in IMG/M |
| 3300011423 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT119_2 | Environmental | Open in IMG/M |
| 3300011427 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT418_2 | Environmental | Open in IMG/M |
| 3300011436 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT642_2 | Environmental | Open in IMG/M |
| 3300012034 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT526_2 | Environmental | Open in IMG/M |
| 3300012035 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT338_2 | Environmental | Open in IMG/M |
| 3300012040 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT746_2 | Environmental | Open in IMG/M |
| 3300012041 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT754_2 | Environmental | Open in IMG/M |
| 3300012133 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT121_2 | Environmental | Open in IMG/M |
| 3300012134 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT142_2 | Environmental | Open in IMG/M |
| 3300012146 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT400_2 | Environmental | Open in IMG/M |
| 3300012172 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT366_2 | Environmental | Open in IMG/M |
| 3300012179 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT262_2 | Environmental | Open in IMG/M |
| 3300012226 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT400_2 | Environmental | Open in IMG/M |
| 3300012228 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT700_2 | Environmental | Open in IMG/M |
| 3300012232 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT100_2 | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014873 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200B_16_10D | Environmental | Open in IMG/M |
| 3300014878 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200A_16_10D | Environmental | Open in IMG/M |
| 3300015251 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT293_16_10D | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300020003 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2 | Environmental | Open in IMG/M |
| 3300021051 | Subsurface sediment microbial communities from Mancos shale, Colorado, United States - Mancos A1 | Environmental | Open in IMG/M |
| 3300021063 | Subsurface sediment microbial communities from Mancos shale, Colorado, United States - Mancos D4 | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300025160 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2 | Environmental | Open in IMG/M |
| 3300025289 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 2 | Environmental | Open in IMG/M |
| 3300025313 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300025314 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 2 | Environmental | Open in IMG/M |
| 3300025322 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025535 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025580 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027815 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300034165 | Sediment microbial communities from East River floodplain, Colorado, United States - 19_s17 | Environmental | Open in IMG/M |
| 3300034178 | Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10216J12902_1076020892 | 3300000956 | Soil | TLPERRQSSCALKMPAGQVACENSSEKVKHRAEPRAQNETFALVPSLLQGHTAIDRVSSGSVVACYE* |
| C687J26621_101520811 | 3300002104 | Groundwater | AYEISSEKVKHRAERRAQNETFAPMPSFLQGHTSINKVSSGFLVA* |
| Ga0055432_101882602 | 3300004022 | Natural And Restored Wetlands | MQAGLIAYEISSEKVKHRAERQAQNETFAPVPSFLQGHTSI |
| Ga0055500_100305881 | 3300004062 | Natural And Restored Wetlands | AEQVGYAISSEKFEHRAERQAQNEIFASMPSYLQGHTPIDGVSSGFHVT* |
| Ga0068993_102820182 | 3300005183 | Natural And Restored Wetlands | MQAGLIAYEISSEKVKHRAERQAQNETFAPVPSFLQGHTSIDALS* |
| Ga0065705_101113132 | 3300005294 | Switchgrass Rhizosphere | MAKQRCVEDASGRVAHEGSSEKVKHRAGRRDPFEIFAPVPSFLQGHDPINRLLSDFLVAVA* |
| Ga0065707_100010879 | 3300005295 | Switchgrass Rhizosphere | MQAGQSAREVRSEKVRQRAERREQNKTFAPVPSFLQGHTSIDRVPSSFLVA* |
| Ga0065707_101463602 | 3300005295 | Switchgrass Rhizosphere | MPAGRVAHEISSEKVAHRAERRAQKETFALVPSFLQSYTSMAALK* |
| Ga0070692_112485192 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | EAASAAAAYESSSGKVKHRAKRRAQNQIFALVPSFLQGHTPID* |
| Ga0070669_1008582581 | 3300005353 | Switchgrass Rhizosphere | TYNPSGTKGSEMVKHRAECRAQNEKLALVPWFLPDHTSITRVSPDFLVA* |
| Ga0070701_113913132 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | ELFKVRSEKVKHRVERREQNETFAPVPSFLQGHTSIDTLS* |
| Ga0070694_1002750381 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | LCLEDASGQAAYEISSEKVKHRAKRRAQNKTFALVPLFLQDHTSINRVSSGFL |
| Ga0070699_1016473692 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | KTPAGQVASEISSAKVKHRAERRAQNETSALVPSSLQGHAAIDALY* |
| Ga0070672_1009292242 | 3300005543 | Miscanthus Rhizosphere | VDRVAYEGTSEKFQHRAERRIQNETLAPVPSFLQGHTSINAV* |
| Ga0075431_1009404022 | 3300006847 | Populus Rhizosphere | MPAERVAYEIGSEKVKHRPEHRKQNETFAPVPSFLQSYTSINKVSSGFLLA* |
| Ga0075431_1014117261 | 3300006847 | Populus Rhizosphere | LKTPAGQVDYEISTEKINHLAERRAQNETFAPVPSFLQGH |
| Ga0075433_117859072 | 3300006852 | Populus Rhizosphere | LKVHAQNLSTEISSEKVKHRTECSAQNEIFAPVPSFLQGRTSIYKVLSGFLVA* |
| Ga0079217_100138931 | 3300006876 | Agricultural Soil | MMPGEELLEMSSEKVKHRAEHRAYDETFAPMPSFLQDHTSIDRMLSFFLVA* |
| Ga0079218_101798862 | 3300007004 | Agricultural Soil | MPARREAYEISSEKIKDGAERRAQNEIFAPLPSFLQGHTSIDTAS* |
| Ga0075418_114375892 | 3300009100 | Populus Rhizosphere | MPARQIACEIGSEKVKHRAERRAQNETFALVPSFLQGHTAIGALY* |
| Ga0075423_124854681 | 3300009162 | Populus Rhizosphere | ISFENVKQPTERRAQNEIFAPLPSFLQGHSSVDTELSGFFVA* |
| Ga0105347_11761802 | 3300009609 | Soil | MYARRVAHEISSAKVKHRAELGAQNETFAPLPSFLQDHTSINTD* |
| Ga0136847_127585532 | 3300010391 | Freshwater Sediment | ISSEKVKHRAERRAQNETLAPVPSFDVLVLWGHTSINKVSSGFLAP* |
| Ga0136847_134204592 | 3300010391 | Freshwater Sediment | EISSEKVKHRAQRRTQNKTFALVPSFDVLVLCGRTSIESVSSGFLVA* |
| Ga0137440_10935741 | 3300011410 | Soil | LPERRQSSCAFKLQARRVAYEISCEKVKHRAERRAQNQTFAPVPSFLQGHTSIWRVYQFSSAHE* |
| Ga0137446_10466461 | 3300011419 | Soil | RRQSSCALKMQAGRVGYEISGKKVNHRAERRAQTETFAPVPSFLQGHTSIDTVSSGFLVA |
| Ga0137436_11947971 | 3300011423 | Soil | AAGRVAYATTSEEFKRRAECRAQHETFALVPSFLQGHASIDTLSFVFLVA* |
| Ga0137448_10024654 | 3300011427 | Soil | MKAGRVGYEISSEKVKHRAECRAQNETFAPVPSFLQGHTSINTVSSGFLVAMNN |
| Ga0137448_10110423 | 3300011427 | Soil | MHAGRVAYEISSEKVKHRAERRAQNETIAPVPSFLQGHTSINILSSGFLVA* |
| Ga0137448_10201031 | 3300011427 | Soil | MQAERVGYEISGEKVKHRAERRAQNETFALVPSLLQGHTSIDRVSRVFLEA* |
| Ga0137448_10913602 | 3300011427 | Soil | YEISSEKVKHRAERRAQNETFAPVPSFLQGHTSINTASSGFS* |
| Ga0137448_12394481 | 3300011427 | Soil | MQAGRVGYEVSSEKVKHRAEHRAQNQTFALVPSFLRGRASIDSVSSGFL |
| Ga0137458_11436081 | 3300011436 | Soil | MQAGRVAYEISREKVKHRAERGDQYESLAPVPSFDGLVLLGHTSINRVSSGFL |
| Ga0137453_10783252 | 3300012034 | Soil | QSSCALKMQAEQVSYEITGETVKHRAERRAQNETFALVPSLLQGHTSINRAW* |
| Ga0137445_11236362 | 3300012035 | Soil | MHAGRVAYEISSEKVKHRAERRAQNETIAPVPSFLQGHTSINTLSSGF |
| Ga0137461_100000920 | 3300012040 | Soil | MQSSCALKMQARRVAYEISSEKVKHRAERRAQNETFAPVPSFLQGHTSINTVSSGFLVA* |
| Ga0137461_10005233 | 3300012040 | Soil | MHAGRVAYEISSEKVKHRAERRAQNETIAPVPSFLQGHTSINTLSSGFLVA* |
| Ga0137461_10008896 | 3300012040 | Soil | MQAERVGYEISGEKVKHRAERRAQNETFALVPSLLQGHTSINTVSSGFLVAMNNPGQNSIAGRSID* |
| Ga0137461_11730971 | 3300012040 | Soil | TTCEKIKHRAERRAGNETFALVPSLLQGHTSIDRVSRVFLVA* |
| Ga0137430_11291422 | 3300012041 | Soil | AGQVAYEISSEKVKRRAECRAQNETFAPVPSFLQGHTSIDRVSSGFLLA* |
| Ga0137329_10447032 | 3300012133 | Soil | GRVAYEISSEKVKHRAEHRAQNQTFALVPSFLQGHTSIDSASSGFLVA* |
| Ga0137330_10504202 | 3300012134 | Soil | VAHEISSEKVKHRTDCQAQYETFALVPSFLQGNTPIDTLP* |
| Ga0137322_10279461 | 3300012146 | Soil | MQAQQVSYEITGETVKHRAERRAQNETFALVPSLLQGHTSINRAW* |
| Ga0137320_10168331 | 3300012172 | Soil | MQAGQVADEISSEKVKPRAEWRAQNETFEPVPSSLQGHTS |
| Ga0137334_10829092 | 3300012179 | Soil | PKRRQSRCALKMHAGRIAYEISSEKVKPCTERRAQNETFAPLPSFLQGHTSIDTLSSVLLVA* |
| Ga0137447_11336731 | 3300012226 | Soil | ISSEKVKHRAERRARNETFVLVPSFLQGHTSINTVSSGFLVA* |
| Ga0137459_11043802 | 3300012228 | Soil | GQVAYEISSKKVDHRAERRAQNETFALVPSFLQGHTSINRVSSGFLRA* |
| Ga0137435_10242265 | 3300012232 | Soil | CFEITSEKVKRRAGCQAQNETFAPVPSFDVFVLWGHTSIDRVSSGFLVA* |
| Ga0137372_100314554 | 3300012350 | Vadose Zone Soil | MPARRVVYEISSEKVKDCAERRTQNETFAPLPSFLQGHTSIDRAS* |
| Ga0157378_111460892 | 3300013297 | Miscanthus Rhizosphere | RTQSCFALKLQAGQVACEISGEKFKHRAECWTQNETFAPVPSFHQGRTSINTVS* |
| Ga0180066_10553121 | 3300014873 | Soil | MPAGQVAYEISSEKIKHRGECRAQNEIFAPVPSFLQGHTSIDSVISSPRS |
| Ga0180065_11666571 | 3300014878 | Soil | MQAGRVAYEISSEKVKHRAERRAQNETFASVPSFFQGHASIKRVSSGILVASIVQAY |
| Ga0180070_10690072 | 3300015251 | Soil | YEISSEKVKHRAERRAQNEIFAPVPSFLQGRTSINRVSSGFLVA* |
| Ga0132258_124404361 | 3300015371 | Arabidopsis Rhizosphere | MPAGQVACAISSEKVKHRAERRAQNETFAPVPSFLQGDAAIDRMSSGFVAP* |
| Ga0184608_102712591 | 3300018028 | Groundwater Sediment | ISCEKVKHRAERPAQNETFAPLPSFLQGHASIDTVLSGFLVA |
| Ga0184608_105328071 | 3300018028 | Groundwater Sediment | MQARRVADEISSEKVKHRAERRAQNETFAPVPSFLQGYTSINRVSSG |
| Ga0184634_102189121 | 3300018031 | Groundwater Sediment | SSCALKMPAGQVAYEISSEKVKHRAERRAQNETFAPMPSFLQGHTSIDRASSGFLVA |
| Ga0184634_102799853 | 3300018031 | Groundwater Sediment | MQARRVAYDNSSEKVKHRAERRAQNETFAPVPSFLQGCTSINRVSPGFLAAMNNPG |
| Ga0184634_103747882 | 3300018031 | Groundwater Sediment | SEKVKHRAERRAQNETFAPLPSFLQGHTSIDRASSGFFVHE |
| Ga0184626_100022606 | 3300018053 | Groundwater Sediment | MQAKQVSYEITGEKVKHRAERRAQNETFAPVPSFLQGHTSINTLSSVLLVV |
| Ga0184626_100136423 | 3300018053 | Groundwater Sediment | MQAGQVSYEITGEKVKHRAEGRAQYETFELVPSLLQGHTSIDRVSRVFLEA |
| Ga0184626_100215332 | 3300018053 | Groundwater Sediment | MHAGRVANEIGSEKIKHRAERRAQNETFTPVPSFDVLVLWGHTSINRVSSGFLVA |
| Ga0184626_101260922 | 3300018053 | Groundwater Sediment | ALKMHVGRVAYEISSEKVKHRAERRAPNETFAPVPSFLQGHTSINKVSSGFLVA |
| Ga0184626_101338001 | 3300018053 | Groundwater Sediment | MHARRVAYEISSEKVKHRAERRAQNETFAPVPSFLQGRTSINSVSSVFLVA |
| Ga0184623_100859062 | 3300018056 | Groundwater Sediment | MHAGRVANEIGSEKTKHRAERRAQNETFTPVPSFDVLVLWGHTSIN |
| Ga0184623_101423521 | 3300018056 | Groundwater Sediment | AGRVAYEISSEKVKHRAERRAQNETFAPVPSFLQGHTSINTVSSGFLVA |
| Ga0184623_101616191 | 3300018056 | Groundwater Sediment | LKVQARRVAYEISSEKVKHRAARRAQNETFAPVPSFGALVLWGRTSINR |
| Ga0184623_101846262 | 3300018056 | Groundwater Sediment | HAARVANGISSEKVKHRAKRRAQNETVAPVPSFDVLVLWGHTSINSVSSGFLVA |
| Ga0184623_102672022 | 3300018056 | Groundwater Sediment | MQARRVADEISSEKVKHRAERRAQNETFAPVPSFFQAHTSITKVSSGFLVA |
| Ga0184637_100195526 | 3300018063 | Groundwater Sediment | MQAGQISYEITGEKVIHRAERRAQNETFALVPSLLQGNTSIDRVS |
| Ga0184637_100387594 | 3300018063 | Groundwater Sediment | GRVAYEISSEKVKHRAERRAQNETFAPVPSFLQGHTSINRVSSGFLVA |
| Ga0184637_103004251 | 3300018063 | Groundwater Sediment | MHAARVANGISSEKVKHRAKRRAQNETVAPVPSFDVLVLWGHTSINRVSSGF |
| Ga0184637_105825811 | 3300018063 | Groundwater Sediment | MHAGRVAYEISSEKVKHRAERRAQNETFAPVPSFLQGHTSINRV |
| Ga0184637_107944441 | 3300018063 | Groundwater Sediment | VAYEISSEKVKHRAERRAQNETFAPVPSFDVFVLWGRTSINRVSSGFLVA |
| Ga0184618_101338872 | 3300018071 | Groundwater Sediment | MPAGQVAYEISSEKFKHRAERRAQNEIFAPVPSFLQGYTSIVSVRFPHSMNNPG |
| Ga0184640_105482121 | 3300018074 | Groundwater Sediment | GQVAYEISSEKVKHRAERRAQNETFAPVPSFLQGHTSIDRVSSSFLVA |
| Ga0184609_105504602 | 3300018076 | Groundwater Sediment | MRAGQVVYEISSEKVKHRAERRTQNETSPPMPSFLQSHTSIVSVLSG |
| Ga0184633_103650882 | 3300018077 | Groundwater Sediment | ERRQNSCALKMQAEQVYYEIIGEKVKHRAERRAQNEPFALVPSFLQGHTSINRVSSGFLV |
| Ga0184612_101934432 | 3300018078 | Groundwater Sediment | MQAKQVSYEITGEKVKHRAERRAQNETFAPVPSFLQGHTSINRAW |
| Ga0184612_104054952 | 3300018078 | Groundwater Sediment | LKVHVGRVANEISSEKVKHRAERRAQNETFAPVPSFLQGHTSINSVSSGFLVA |
| Ga0184612_104830452 | 3300018078 | Groundwater Sediment | MQARRVADEISSEKVKHRAERRAQNETFAPVPSFLQGHTSI |
| Ga0184627_103004941 | 3300018079 | Groundwater Sediment | MRARRVAYEISSEKVKHCAERRAQNETFAPLPSFLQGRTSI |
| Ga0184639_100680641 | 3300018082 | Groundwater Sediment | SCALKLQAGRVAYEISSEKVKHRTECRAQNETFAPVPSFLQGHTSIDRVP |
| Ga0184639_101344463 | 3300018082 | Groundwater Sediment | RQSSCALKLPAGRVAYEISSAKVKHRAERQAQNATFALVPSFLQGHTSIDRVSSVSS |
| Ga0184629_101131451 | 3300018084 | Groundwater Sediment | LKTQPGQFAFEISSEKVKHRAERPAQNETFAPVPSFLQGRTSIDRVRQVF |
| Ga0184629_102090831 | 3300018084 | Groundwater Sediment | SEKVKHRAERRAQNETFAPVPSFLQGYTSINTVSSGFLVA |
| Ga0184629_103157752 | 3300018084 | Groundwater Sediment | LKLQAGRVAYEISSEKVKHRAEHRAQNQTFALVPSFLQGHTSIDSASSGFLVA |
| Ga0184629_105596172 | 3300018084 | Groundwater Sediment | MQAGQVSYEITGEKVKHRAEGRAQYETFELVPSLLQGHTSIDR |
| Ga0193739_11509541 | 3300020003 | Soil | SGTKAKRCALKMQAGRVGYEISSEKVKHRAERRAQNETFAPMPSFDVLVH |
| Ga0206224_10111912 | 3300021051 | Deep Subsurface Sediment | QAGRSAYEISSEKVKQRAERRTQNETFALVPSFLQGHTAIDTLSSVLLVV |
| Ga0206224_10660512 | 3300021051 | Deep Subsurface Sediment | YEISSEKVKHRAERRAQDETFAPVPSFGALVLWGHTSINRVSSGFRVA |
| Ga0206227_11082362 | 3300021063 | Deep Subsurface Sediment | MQAQQVSYEITGETVKHRAERRAQNETFALVPSFLQAHTSID |
| Ga0210379_101457271 | 3300021081 | Groundwater Sediment | LKMHARRVAYEISSEKVKHRAERRAQNETFAPMPSYLQGYTSIDKVSSGFLVE |
| Ga0209109_100364875 | 3300025160 | Soil | MPAGRVAYEISREKVKHRAERRAQNETFALVPSFLQGYASTD |
| Ga0209002_100932541 | 3300025289 | Soil | SSEKVKHRAERRAQNETFALVPSFLQGYTSIDRVSSGSLVA |
| Ga0209431_103270554 | 3300025313 | Soil | MPAGRVVYEISSEKVKHRAERRAQNETFAPVPSFLQGHTSIDRVSSGSLV |
| Ga0209323_104811622 | 3300025314 | Soil | VAYEISSEKVKHRAERRAQNETFAPMPSFLQGHTSIDKVSSGFLVA |
| Ga0209641_101277831 | 3300025322 | Soil | LCLEDACGRVAYEISSEKVKHRAERRAQNETFAPMPSFLQGHTSINKVSSGFLVA |
| Ga0209641_103792702 | 3300025322 | Soil | VVYEISSEKVKHRAERRAQNETFAPVPSFLQGHTSIDRVSSGSLVA |
| Ga0209641_103921442 | 3300025322 | Soil | MPAGRVAYEISSEKVKHRAERRAQNETFAPMPSFLQGHTSINKVS |
| Ga0207423_10671311 | 3300025535 | Natural And Restored Wetlands | MQAGLIAYEISSEKVKHRAERQAQNETFAPVPSFLQGHTSIDALS |
| Ga0210138_10373543 | 3300025580 | Natural And Restored Wetlands | MQAGLIAYEISSEKVEHRAERQAQNETFAPVPSFLQGHTPIDTLRCVVPIGKIGRIKL |
| Ga0209726_102996061 | 3300027815 | Groundwater | LKPQARRVAYAISSEKVKHRAERRAQYETFAPLPSFLQGHTSINTVTSGFLV |
| Ga0209382_116264462 | 3300027909 | Populus Rhizosphere | RWCLEDAQWRVAFKISSEKVKYQANRWAENETFAPLPSFLPDHTSINRVASGFLEA |
| Ga0307281_100640401 | 3300028803 | Soil | IPAGRVVNEASSEKVIHCAECHAHNETVAPVPSFLQGHTSIGRVAPGRLVV |
| Ga0299907_102077502 | 3300030006 | Soil | EIASEKVKQRAELQSETETFALLPSLLQVHTSIYRVSRVFLEA |
| Ga0310907_105816591 | 3300031847 | Soil | IAMRAALPERRQSCFALKLQAGQVACEISGEKFKHRAECWTQNETFAPVPSFHQGRTSINTVS |
| Ga0310885_108743922 | 3300031943 | Soil | KDASGGVAYEISSEKVKHRAERRAQNEIFAPVPTFLQGRTSINRVSSAFLVA |
| Ga0326597_105669193 | 3300031965 | Soil | MPAGQVTYEITSEKVEHRAERRAQDETFALVPSLLPDYTTIDKVS |
| Ga0307471_1024977881 | 3300032180 | Hardwood Forest Soil | MRAGRVAYEISSEKVNHRAERRAQNEIFAPLPSFLQGHTSINTVSSGFL |
| Ga0364942_0203887_360_515 | 3300034165 | Sediment | MHAGRVGYEISSEKVKHRAERRDQNETFAPVPSFLQGHTSINGVSSGFLVT |
| Ga0364934_0106698_755_937 | 3300034178 | Sediment | VAEKGLCPEDVSGRVAYEISSEKFKHRAERRAQNETFAPLPSFLQDYTSIDTLSSVLLVA |
| Ga0364934_0305064_36_191 | 3300034178 | Sediment | MHAGRVAYEISSEKVKHRAERRDQNETFAPVPSFLQGHTSINGVSSGFLVT |
| Ga0364934_0417498_3_155 | 3300034178 | Sediment | FCALKVQARRVAYEISSEKVKHRAERRAQNETFAPVPSFLQGFTSIDVVS |
| ⦗Top⦘ |