


| Basic Information | |
|---|---|
| Family ID | F080672 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 115 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MLTLARFSLGRVLLHLLAMTGDGAFRFHAAGILRELVSR |
| Number of Associated Samples | 82 |
| Number of Associated Scaffolds | 115 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 73.91 % |
| % of genes near scaffold ends (potentially truncated) | 19.13 % |
| % of genes from short scaffolds (< 2000 bps) | 80.87 % |
| Associated GOLD sequencing projects | 74 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.53 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (89.565 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil (41.739 % of family members) |
| Environment Ontology (ENVO) | Unclassified (53.913 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) (43.478 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 41.79% β-sheet: 0.00% Coil/Unstructured: 58.21% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 115 Family Scaffolds |
|---|---|---|
| PF02622 | DUF179 | 19.13 |
| PF05708 | Peptidase_C92 | 6.96 |
| PF13458 | Peripla_BP_6 | 6.09 |
| PF00563 | EAL | 5.22 |
| PF02416 | TatA_B_E | 4.35 |
| PF07286 | D-Glu_cyclase | 3.48 |
| PF06441 | EHN | 2.61 |
| PF01717 | Meth_synt_2 | 2.61 |
| PF11026 | DUF2721 | 2.61 |
| PF13191 | AAA_16 | 1.74 |
| PF12680 | SnoaL_2 | 1.74 |
| PF00486 | Trans_reg_C | 1.74 |
| PF06146 | PsiE | 1.74 |
| PF00691 | OmpA | 1.74 |
| PF08240 | ADH_N | 1.74 |
| PF13561 | adh_short_C2 | 0.87 |
| PF12536 | DUF3734 | 0.87 |
| PF09335 | SNARE_assoc | 0.87 |
| PF12146 | Hydrolase_4 | 0.87 |
| PF12706 | Lactamase_B_2 | 0.87 |
| PF00248 | Aldo_ket_red | 0.87 |
| PF06481 | COX_ARM | 0.87 |
| PF13560 | HTH_31 | 0.87 |
| PF02321 | OEP | 0.87 |
| PF01799 | Fer2_2 | 0.87 |
| PF02518 | HATPase_c | 0.87 |
| PF02678 | Pirin | 0.87 |
| PF13193 | AMP-binding_C | 0.87 |
| PF08447 | PAS_3 | 0.87 |
| PF06004 | DUF903 | 0.87 |
| PF00381 | PTS-HPr | 0.87 |
| COG ID | Name | Functional Category | % Frequency in 115 Family Scaffolds |
|---|---|---|---|
| COG1678 | Putative transcriptional regulator, AlgH/UPF0301 family | Transcription [K] | 19.13 |
| COG2200 | EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant) | Signal transduction mechanisms [T] | 5.22 |
| COG3434 | c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domains | Signal transduction mechanisms [T] | 5.22 |
| COG4943 | Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domains | Signal transduction mechanisms [T] | 5.22 |
| COG5001 | Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domain | Signal transduction mechanisms [T] | 5.22 |
| COG1826 | Twin-arginine protein secretion pathway components TatA and TatB | Intracellular trafficking, secretion, and vesicular transport [U] | 4.35 |
| COG4336 | Uncharacterized conserved protein YcsI, UPF0317/DUF1446 family | Function unknown [S] | 3.48 |
| COG0596 | 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase fold | Coenzyme transport and metabolism [H] | 2.61 |
| COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 2.61 |
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 1.74 |
| COG3223 | Phosphate starvation-inducible membrane PsiE (function unknown) | General function prediction only [R] | 1.74 |
| COG0398 | Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family | Function unknown [S] | 0.87 |
| COG0586 | Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family | Cell wall/membrane/envelope biogenesis [M] | 0.87 |
| COG1238 | Uncharacterized membrane protein YqaA, VTT domain | Function unknown [S] | 0.87 |
| COG1622 | Heme/copper-type cytochrome/quinol oxidase, subunit 2 | Energy production and conversion [C] | 0.87 |
| COG1741 | Redox-sensitive bicupin YhaK, pirin superfamily | General function prediction only [R] | 0.87 |
| COG1925 | HPr or related phosphotransfer protein | Signal transduction mechanisms [T] | 0.87 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 89.57 % |
| Unclassified | root | N/A | 10.43 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090014|GPIPI_16694791 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2158 | Open in IMG/M |
| 2088090014|GPIPI_16932214 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2502 | Open in IMG/M |
| 2162886006|SwRhRL3b_contig_2752787 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 907 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101599029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2300 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_105507313 | All Organisms → cellular organisms → Bacteria | 994 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_105680138 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1543 | Open in IMG/M |
| 3300000559|F14TC_104439789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 775 | Open in IMG/M |
| 3300000956|JGI10216J12902_106748961 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 989 | Open in IMG/M |
| 3300004463|Ga0063356_100014095 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7308 | Open in IMG/M |
| 3300005295|Ga0065707_10086774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 5309 | Open in IMG/M |
| 3300005713|Ga0066905_100009279 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4553 | Open in IMG/M |
| 3300005981|Ga0081538_10322053 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 563 | Open in IMG/M |
| 3300006845|Ga0075421_101003116 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 945 | Open in IMG/M |
| 3300006845|Ga0075421_102164350 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 588 | Open in IMG/M |
| 3300006847|Ga0075431_102141838 | Not Available | 514 | Open in IMG/M |
| 3300006894|Ga0079215_10525372 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 747 | Open in IMG/M |
| 3300007004|Ga0079218_11064726 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300009156|Ga0111538_10812882 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1184 | Open in IMG/M |
| 3300009157|Ga0105092_10021450 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3398 | Open in IMG/M |
| 3300009162|Ga0075423_13031681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → Candidatus Accumulibacter contiguus | 515 | Open in IMG/M |
| 3300009597|Ga0105259_1022846 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1314 | Open in IMG/M |
| 3300009609|Ga0105347_1008433 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 3584 | Open in IMG/M |
| 3300009609|Ga0105347_1111782 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1039 | Open in IMG/M |
| 3300009609|Ga0105347_1138912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 943 | Open in IMG/M |
| 3300009610|Ga0105340_1000220 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 28511 | Open in IMG/M |
| 3300009610|Ga0105340_1000463 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 19692 | Open in IMG/M |
| 3300009610|Ga0105340_1032633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2022 | Open in IMG/M |
| 3300009610|Ga0105340_1111432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1106 | Open in IMG/M |
| 3300009610|Ga0105340_1338183 | Not Available | 664 | Open in IMG/M |
| 3300009678|Ga0105252_10501848 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 560 | Open in IMG/M |
| 3300009678|Ga0105252_10553793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 531 | Open in IMG/M |
| 3300010037|Ga0126304_11283869 | Not Available | 502 | Open in IMG/M |
| 3300010046|Ga0126384_10765078 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 862 | Open in IMG/M |
| 3300010047|Ga0126382_10317551 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1178 | Open in IMG/M |
| 3300010047|Ga0126382_10666211 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 867 | Open in IMG/M |
| 3300010047|Ga0126382_11948979 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 557 | Open in IMG/M |
| 3300011403|Ga0137313_1109312 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 502 | Open in IMG/M |
| 3300011415|Ga0137325_1004492 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2825 | Open in IMG/M |
| 3300011415|Ga0137325_1011747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1713 | Open in IMG/M |
| 3300011417|Ga0137326_1045394 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 951 | Open in IMG/M |
| 3300011425|Ga0137441_1131571 | Not Available | 618 | Open in IMG/M |
| 3300011432|Ga0137428_1125032 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 744 | Open in IMG/M |
| 3300011438|Ga0137451_1043170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1318 | Open in IMG/M |
| 3300011439|Ga0137432_1053793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Competibacteraceae → Plasticicumulans → Plasticicumulans lactativorans | 1214 | Open in IMG/M |
| 3300011439|Ga0137432_1132281 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 796 | Open in IMG/M |
| 3300011439|Ga0137432_1164439 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300011440|Ga0137433_1054341 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1193 | Open in IMG/M |
| 3300011440|Ga0137433_1079641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1004 | Open in IMG/M |
| 3300011443|Ga0137457_1098557 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 926 | Open in IMG/M |
| 3300011445|Ga0137427_10253537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 737 | Open in IMG/M |
| 3300012021|Ga0120192_10032375 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 872 | Open in IMG/M |
| 3300012038|Ga0137431_1051748 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1124 | Open in IMG/M |
| 3300012164|Ga0137352_1035590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 962 | Open in IMG/M |
| 3300012172|Ga0137320_1116460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 569 | Open in IMG/M |
| 3300012175|Ga0137321_1138698 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 543 | Open in IMG/M |
| 3300012179|Ga0137334_1054665 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 854 | Open in IMG/M |
| 3300012203|Ga0137399_11081388 | Not Available | 675 | Open in IMG/M |
| 3300012231|Ga0137465_1062495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1105 | Open in IMG/M |
| 3300012685|Ga0137397_10751025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 724 | Open in IMG/M |
| 3300012922|Ga0137394_10003679 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 11564 | Open in IMG/M |
| 3300012927|Ga0137416_10892508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SCGC AG-212-J23 | 790 | Open in IMG/M |
| 3300012948|Ga0126375_11061432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 664 | Open in IMG/M |
| 3300012948|Ga0126375_11918777 | Not Available | 521 | Open in IMG/M |
| 3300014861|Ga0180061_1060158 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 631 | Open in IMG/M |
| 3300014867|Ga0180076_1109679 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 508 | Open in IMG/M |
| 3300014868|Ga0180088_1074635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 607 | Open in IMG/M |
| 3300014872|Ga0180087_1065633 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 692 | Open in IMG/M |
| 3300014876|Ga0180064_1060358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 769 | Open in IMG/M |
| 3300014879|Ga0180062_1088814 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 696 | Open in IMG/M |
| 3300014881|Ga0180094_1002928 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2971 | Open in IMG/M |
| 3300014965|Ga0120193_10077295 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 542 | Open in IMG/M |
| 3300015257|Ga0180067_1042988 | Not Available | 938 | Open in IMG/M |
| 3300015259|Ga0180085_1039534 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1338 | Open in IMG/M |
| 3300015371|Ga0132258_10143517 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5717 | Open in IMG/M |
| 3300015371|Ga0132258_13318616 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1107 | Open in IMG/M |
| 3300015372|Ga0132256_102951567 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax | 572 | Open in IMG/M |
| 3300015374|Ga0132255_101194348 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1145 | Open in IMG/M |
| 3300018083|Ga0184628_10021973 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3147 | Open in IMG/M |
| 3300018422|Ga0190265_10012402 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6482 | Open in IMG/M |
| 3300018422|Ga0190265_10016021 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5831 | Open in IMG/M |
| 3300018422|Ga0190265_10439361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Azotobacter group → Azotobacter → Azotobacter beijerinckii | 1409 | Open in IMG/M |
| 3300018422|Ga0190265_11648502 | Not Available | 752 | Open in IMG/M |
| 3300018422|Ga0190265_11696320 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300018432|Ga0190275_11241918 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 821 | Open in IMG/M |
| 3300018432|Ga0190275_11250077 | Not Available | 818 | Open in IMG/M |
| 3300018469|Ga0190270_12142556 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300018469|Ga0190270_12208462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Pseudaminobacter → Pseudaminobacter soli | 611 | Open in IMG/M |
| 3300020063|Ga0180118_1068526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 648 | Open in IMG/M |
| 3300027326|Ga0209731_1052256 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300027362|Ga0208320_1005303 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1451 | Open in IMG/M |
| 3300027513|Ga0208685_1000800 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 10779 | Open in IMG/M |
| 3300027513|Ga0208685_1051038 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 895 | Open in IMG/M |
| 3300027533|Ga0208185_1000278 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 28449 | Open in IMG/M |
| 3300027533|Ga0208185_1003473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4067 | Open in IMG/M |
| 3300027533|Ga0208185_1045838 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1058 | Open in IMG/M |
| 3300027533|Ga0208185_1048448 | All Organisms → cellular organisms → Bacteria | 1026 | Open in IMG/M |
| 3300027573|Ga0208454_1142114 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 561 | Open in IMG/M |
| 3300027909|Ga0209382_10996888 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 874 | Open in IMG/M |
| 3300028047|Ga0209526_10424759 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300028809|Ga0247824_10513817 | Not Available | 708 | Open in IMG/M |
| 3300030620|Ga0302046_10397104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1132 | Open in IMG/M |
| 3300031547|Ga0310887_10049802 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1874 | Open in IMG/M |
| 3300031720|Ga0307469_11598897 | Not Available | 626 | Open in IMG/M |
| 3300031740|Ga0307468_100013002 | All Organisms → cellular organisms → Bacteria | 3361 | Open in IMG/M |
| 3300031740|Ga0307468_100136660 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1544 | Open in IMG/M |
| 3300031740|Ga0307468_100312448 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1148 | Open in IMG/M |
| 3300031740|Ga0307468_101724728 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 590 | Open in IMG/M |
| 3300031820|Ga0307473_10144665 | All Organisms → cellular organisms → Bacteria | 1343 | Open in IMG/M |
| 3300032017|Ga0310899_10463847 | Not Available | 617 | Open in IMG/M |
| 3300032174|Ga0307470_10202695 | All Organisms → cellular organisms → Bacteria | 1269 | Open in IMG/M |
| 3300032174|Ga0307470_11361006 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 584 | Open in IMG/M |
| 3300032180|Ga0307471_101828058 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 758 | Open in IMG/M |
| 3300034115|Ga0364945_0148286 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 703 | Open in IMG/M |
| 3300034149|Ga0364929_0121131 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 836 | Open in IMG/M |
| 3300034178|Ga0364934_0112923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1024 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 41.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.70% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 7.83% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.22% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.22% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.22% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.61% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 2.61% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.61% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 1.74% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.74% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.74% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.74% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.87% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.87% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.87% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.87% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.87% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.87% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.87% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.87% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.87% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 2162886006 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009597 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT299 | Environmental | Open in IMG/M |
| 3300009609 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 | Environmental | Open in IMG/M |
| 3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
| 3300009678 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300011403 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT166_2 | Environmental | Open in IMG/M |
| 3300011415 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT469_2 | Environmental | Open in IMG/M |
| 3300011417 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT500_2 | Environmental | Open in IMG/M |
| 3300011425 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT244_2 | Environmental | Open in IMG/M |
| 3300011432 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT718_2 | Environmental | Open in IMG/M |
| 3300011438 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT500_2 | Environmental | Open in IMG/M |
| 3300011439 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT820_2 | Environmental | Open in IMG/M |
| 3300011440 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT840_2 | Environmental | Open in IMG/M |
| 3300011443 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT630_2 | Environmental | Open in IMG/M |
| 3300011445 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2 | Environmental | Open in IMG/M |
| 3300012021 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T1 | Environmental | Open in IMG/M |
| 3300012038 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT800_2 | Environmental | Open in IMG/M |
| 3300012164 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT730_2 | Environmental | Open in IMG/M |
| 3300012172 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT366_2 | Environmental | Open in IMG/M |
| 3300012175 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT399_2 | Environmental | Open in IMG/M |
| 3300012179 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT262_2 | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012231 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT828_2 | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300014861 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT27_16_10D | Environmental | Open in IMG/M |
| 3300014867 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT433_16_10D | Environmental | Open in IMG/M |
| 3300014868 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT830_16_10D | Environmental | Open in IMG/M |
| 3300014872 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT790_16_10D | Environmental | Open in IMG/M |
| 3300014876 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200_16_10D | Environmental | Open in IMG/M |
| 3300014879 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT45_16_10D | Environmental | Open in IMG/M |
| 3300014881 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_1Da | Environmental | Open in IMG/M |
| 3300014965 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T2 | Environmental | Open in IMG/M |
| 3300015257 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231_16_10D | Environmental | Open in IMG/M |
| 3300015259 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_10D | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300020063 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT730_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027326 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027362 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT299 (SPAdes) | Environmental | Open in IMG/M |
| 3300027513 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 (SPAdes) | Environmental | Open in IMG/M |
| 3300027533 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 (SPAdes) | Environmental | Open in IMG/M |
| 3300027573 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028809 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48 | Environmental | Open in IMG/M |
| 3300030620 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300034115 | Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17 | Environmental | Open in IMG/M |
| 3300034149 | Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17 | Environmental | Open in IMG/M |
| 3300034178 | Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPIPI_01105580 | 2088090014 | Soil | MEKLAYFRLGRIVLHTVAMLGDRAYRFHAAGILRELALS |
| GPIPI_00425330 | 2088090014 | Soil | MLTLARFSGGRIILHLGALLGDGAVRFHAAGIARELRAWVGA |
| SwRhRL3b_0561.00002140 | 2162886006 | Switchgrass Rhizosphere | MLTLARFGLGRVFLHLVAMLGDGAFRFHAAGILRELVSR |
| INPhiseqgaiiFebDRAFT_1015990292 | 3300000364 | Soil | MLTLARFSLGRVVLHLLAMIGDGAFRFHAAGILRELVSR* |
| INPhiseqgaiiFebDRAFT_1055073132 | 3300000364 | Soil | MEKLAYFRLGRIVLHTVAMLGDRAYRFHAAGILRELALS* |
| INPhiseqgaiiFebDRAFT_1056801382 | 3300000364 | Soil | MLTLARFSGGRIILHLGALLGDGAVRFHAAGIARELRAWVGA* |
| F14TC_1044397892 | 3300000559 | Soil | MLTLARFSGGRILLHVAALLGDGEVRFHAAGIARELRAWVGF* |
| JGI10216J12902_1067489613 | 3300000956 | Soil | MLTLARFSLGRVVLHLIAMVGDRAFRFHAAGIRREFNL* |
| Ga0063356_1000140957 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MLTLARFSAGRVVLHIFAMLGDREFHFHAAGIVRELVSR* |
| Ga0065707_100867744 | 3300005295 | Switchgrass Rhizosphere | MLTLARFGLGRVFLHLVAMLGDGAFRFHAAGILRELVSR* |
| Ga0066905_1000092794 | 3300005713 | Tropical Forest Soil | MEKLAHYRLGRIFLHTLAMLGDGAFRFHTAGILRELA* |
| Ga0081538_103220531 | 3300005981 | Tabebuia Heterophylla Rhizosphere | RFSLGRVLLHLVAMMGDGAFRFHVAGIVREFVSR* |
| Ga0075421_1010031163 | 3300006845 | Populus Rhizosphere | MLTLARFSLGRVVLHLIAMAGDREFRFHAAGIRREFSL* |
| Ga0075421_1021643502 | 3300006845 | Populus Rhizosphere | VLILARFSLGRVLLHLLAMMGDGAFRFHAAGILRELIR* |
| Ga0075431_1021418381 | 3300006847 | Populus Rhizosphere | RMEKLAYSRPGRILLHVLAMCADGAVRFHTAGILRELALS* |
| Ga0079215_105253722 | 3300006894 | Agricultural Soil | MLTLARFSAGRVVLHFLAMLGDREFRFHAAGIMRELVIR* |
| Ga0079218_110647261 | 3300007004 | Agricultural Soil | MLILARFGLGRVFLHLVAMLGDRAFRFHAAGIRRELVSR* |
| Ga0111538_108128821 | 3300009156 | Populus Rhizosphere | RTSGTDMLTLARFGLGRVFLHLVAMLGDGAFRFHAAGILRELVSR* |
| Ga0105092_100214502 | 3300009157 | Freshwater Sediment | MLTLARFSLGRVLLHLFAMMGDGALRFHAAGILREFVSR* |
| Ga0075423_130316811 | 3300009162 | Populus Rhizosphere | MESLRIGDCMLTLARFSLGRVVLHLLAMIGDGAFRFHAAGILRE |
| Ga0105259_10228462 | 3300009597 | Soil | MLMLARFSLGRVLLHLLAMMGDGALRFHAAGILREFVSR* |
| Ga0105347_10084335 | 3300009609 | Soil | MLTLARFSLGRVLLHLVAMSRDGAYRFHGAGILREFASR* |
| Ga0105347_11117822 | 3300009609 | Soil | MLTLARFSLGRVLLHLFAMMGDGAVRFHAAGILREFVSR* |
| Ga0105347_11389123 | 3300009609 | Soil | MLMLARFSLGRVLLHLLAMMGDGALRFHAAGILRELMSR* |
| Ga0105340_100022033 | 3300009610 | Soil | MGSLSMLMLARFSLGRVLLHLLAMMGDGALRFHAAGILRELMSR* |
| Ga0105340_100046319 | 3300009610 | Soil | MAALARFSHGRVLLHLVAMLGDRAFRFHAAGILREFASR* |
| Ga0105340_10326333 | 3300009610 | Soil | LIRMLVLARFSLGRVLLHLIAMLGDRAVRFHAAGILREFSS* |
| Ga0105340_11114323 | 3300009610 | Soil | MRSLSIMLTLARFSLGRVLLHLFAMMGDGAFRFHAAGILRELVSR* |
| Ga0105340_13381831 | 3300009610 | Soil | MTKLARFSLGRVLLHLIAMVGDRAGRFHCAGIMRELS |
| Ga0105252_105018482 | 3300009678 | Soil | MLTLARFSLGRALLHLFAMMGDGAVRFHAAGILREFVSR* |
| Ga0105252_105537931 | 3300009678 | Soil | MTHLDAMLMLARFSLGRVLLHLLAVMGDGALRFHAAGILRELMSR |
| Ga0126304_112838692 | 3300010037 | Serpentine Soil | MLTLARFSLGRVVLHLIAMAGDRAFRFHAAGIRREFSS* |
| Ga0126384_107650782 | 3300010046 | Tropical Forest Soil | MLTLARFSGGRILLHVAALLGDGEVRFHAAGIARELRG* |
| Ga0126382_103175512 | 3300010047 | Tropical Forest Soil | MEKLAHFRLGRIVPHTLAMFGDGAFRFHAAGILRELA* |
| Ga0126382_106662112 | 3300010047 | Tropical Forest Soil | MLTLARFSGGRIVLHLAALLGDGAVRFHAAGIARELRAWVGC* |
| Ga0126382_119489791 | 3300010047 | Tropical Forest Soil | MENLARSRFGRVLLHLIAMAGDGAFRFHAAGIMRELPWTQ* |
| Ga0137313_11093121 | 3300011403 | Soil | KAARRRSLDPMLTLARFSLGRVLLHLIAMAGDRAFRFHAAGIVREFASR* |
| Ga0137325_10044924 | 3300011415 | Soil | MLMLARFSLGRVLLHLLAMRGDGALRFHAAGILRELMSR* |
| Ga0137325_10117472 | 3300011415 | Soil | MLMLARFSLGRVLLHLLAVMGDGALRFHAAGILRELMSR* |
| Ga0137326_10453942 | 3300011417 | Soil | MLMLARFSLGRALLHLFAMMGDGAVRFHAAGILREFVSR* |
| Ga0137441_11315713 | 3300011425 | Soil | MGSLARFSLGRVLLHLLAMMGDGALRFHAAGILRELMSR* |
| Ga0137428_11250322 | 3300011432 | Soil | MLTLARFSLGRVLLHLLAMIGDRAFRFHTAGILREFASR* |
| Ga0137451_10431702 | 3300011438 | Soil | MLMLARFSPGRVLLHLLAMMGDGALRFHAAGILRELMSR* |
| Ga0137432_10537933 | 3300011439 | Soil | MLTLARFSLGRVLLHLLAMIGDRAVRFHTAGILREFVSR* |
| Ga0137432_11322812 | 3300011439 | Soil | MLTLARFSGGRILLHLAALVGDGAVRFHAAGIAREM |
| Ga0137432_11644392 | 3300011439 | Soil | MLMLARFSLGRVLLHLLAVMGDGALRFHAAGMLRELMSR* |
| Ga0137433_10543413 | 3300011440 | Soil | MLTLARFSFGRVLLHLFAMVGDRAFRFHAAGILREFVSR* |
| Ga0137433_10796411 | 3300011440 | Soil | HCMLTLARFSLGRVVLHLLAMIGDGAFRFHAAGILRELVSR* |
| Ga0137457_10985573 | 3300011443 | Soil | TSGTEMLTLARFSLGRVLLHLVAMSRDGAYRFHGAGILREFASR* |
| Ga0137427_102535373 | 3300011445 | Soil | MLMLARFSLGRVLLHLLAMRGDGEIRFHAAGILRELMGR* |
| Ga0120192_100323752 | 3300012021 | Terrestrial | MLTLARFSLGRVLLHLFAMLGDGAFRFHAAGILREFMSRRSIWTEKA* |
| Ga0137431_10517482 | 3300012038 | Soil | MLTLARFSLGRVLLHLLAMMGDGALRFHAAGILRELMSR* |
| Ga0137352_10355905 | 3300012164 | Soil | MLTLARFSLGRVLLHLLAMTGDRAFRFHAAGILREFVGR* |
| Ga0137320_11164601 | 3300012172 | Soil | QMLTLARFSGGRIFLHLAALLGDGAIRFHAAGIARELRAWARQ* |
| Ga0137321_11386981 | 3300012175 | Soil | LACSARWSTRHMTHLDAMLMLARFSLGRVLLHLLAVMGDGALRFHAAGILRELISR* |
| Ga0137334_10546652 | 3300012179 | Soil | MTHLDAMLMLARFSLGRVLLHLLAVMGDGALRFHAAGILRELISR* |
| Ga0137399_110813882 | 3300012203 | Vadose Zone Soil | VVILARSSFGRVLLHLLAMLGDRAFRFHGAGILRELVSQ* |
| Ga0137465_10624953 | 3300012231 | Soil | MLMLARFSPGRVLLHLLAMMGDGALRFHAAGILREFVSR* |
| Ga0137397_107510252 | 3300012685 | Vadose Zone Soil | MLTLARFGGGRIVLHLAALLGDGALRFHAAGIAR* |
| Ga0137394_100036797 | 3300012922 | Vadose Zone Soil | MLTLARFGGGRIVLHLAALLGDGALRFHAAGIARELRTWAGC* |
| Ga0137416_108925082 | 3300012927 | Vadose Zone Soil | VILARSSFGRVLLHLLAMLGDRAFRFHGAGILRELVSQ* |
| Ga0126375_110614321 | 3300012948 | Tropical Forest Soil | MLILARFSGGRILLHVAALLGDGAVRFHAAGIARELRGWVGS |
| Ga0126375_119187772 | 3300012948 | Tropical Forest Soil | MLILARFSGGRIVLHLAALVGDGAVRFHAAGIARELRAWVGY* |
| Ga0180061_10601582 | 3300014861 | Soil | MTHLDAMLMLARFSLGRVLLHLLAMMGDGALRFHAAGILREFVSR* |
| Ga0180076_11096792 | 3300014867 | Soil | RFSLGRVLLHLLAMMGDGALRFHAAGILRELMSR* |
| Ga0180088_10746352 | 3300014868 | Soil | MTHLDAMLMLARFSLGRVLLHLLAMMGDGALRFHAAGILRE |
| Ga0180087_10656332 | 3300014872 | Soil | MLMLARFSLGRVLLHLLAMMGDGALRFHAAGILREFLSR* |
| Ga0180064_10603582 | 3300014876 | Soil | MLTLARFSLGRVLLHLLAMMGDGALRFHAAGILREFVSR* |
| Ga0180062_10888142 | 3300014879 | Soil | MLMLARFSLGRVLLHLLAVMGDGALRFHAAGILRELISR* |
| Ga0180094_10029283 | 3300014881 | Soil | MLARFSLGRVLLHLLAMMGDGALRFHAAGILRELMSR* |
| Ga0120193_100772951 | 3300014965 | Terrestrial | MESFGIGHCMLTLARFSLGRVVLHLLAMIGDGALRFHTAGILRELVSR* |
| Ga0180067_10429882 | 3300015257 | Soil | MIHLDAMLMLARFSLGRVLLHLLAVMGDGALRFHAAGMLRELMSR* |
| Ga0180085_10395344 | 3300015259 | Soil | MLTLARFSLGRVLLHLLAMTGDRAFRFHAAGILREFVSR* |
| Ga0132258_101435173 | 3300015371 | Arabidopsis Rhizosphere | MLTLARFSLGRVFLHLVAMLGDGAFRFHAAGILRELVSR* |
| Ga0132258_133186163 | 3300015371 | Arabidopsis Rhizosphere | MESLRIGHCMLTLARFSLGRVVLHLLAMIGDGAFRFHAAGILREVASR* |
| Ga0132256_1029515671 | 3300015372 | Arabidopsis Rhizosphere | MESLRIGHCMLTLARFSLGRVVLHLLAMIGDGAFRFHAAGILR |
| Ga0132255_1011943484 | 3300015374 | Arabidopsis Rhizosphere | MGHCMLTLARFSLGRVVLHLLAMIGDGAFRFHAAGILREVASR* |
| Ga0184628_100219735 | 3300018083 | Groundwater Sediment | MESLRMGHCMLTLARFSLGRVVLHLLAMFGDGAFRFHAAGILRELVSR |
| Ga0190265_100124024 | 3300018422 | Soil | MLTLARFSLGRVVLHLIAMAGDRAFRFHAAGIRREFSS |
| Ga0190265_100160216 | 3300018422 | Soil | MLTLARFSLGRVVLHLVALLGDRAFRFHAAGILRELVGQ |
| Ga0190265_104393613 | 3300018422 | Soil | MLTFARFSFGRVLLHLVAMAGDRAFRFHGAGILREFVSR |
| Ga0190265_116485021 | 3300018422 | Soil | MLTLARFSLGRVVLHLIAMAGDRAFRFHAAGIRREFSF |
| Ga0190265_116963202 | 3300018422 | Soil | MLTLARFSLGRVFLHLVAMLGDGAFRFHAAGILREFVSR |
| Ga0190275_112419183 | 3300018432 | Soil | MLTLARFSLGRVVLHLIAMAGDRAFRFHAAGIRREFSL |
| Ga0190275_112500771 | 3300018432 | Soil | SAFLELSMLTLARFRLGRVVLHLIAMAGDRAFRFHAAGIRREFSF |
| Ga0190270_121425563 | 3300018469 | Soil | MLTLARFGTGRVLLHLLAMLGDRAFRFHAAGILREFVSR |
| Ga0190270_122084622 | 3300018469 | Soil | MLTLARFSLGRVVLHLIAMAGDRAFRFHAAGIRREFNL |
| Ga0180118_10685261 | 3300020063 | Groundwater Sediment | MLMLARFSLGRVLLHLLAMMGDGALRFHAAGILRELMSR |
| Ga0209731_10522563 | 3300027326 | Forest Soil | MLTLARFSLGRVLLHLIAMLRDRAFRFHGAGILREFVSR |
| Ga0208320_10053034 | 3300027362 | Soil | MLMLARFSLGRVLLHLLAMMGDGALRFHAAGILREFVSR |
| Ga0208685_10008005 | 3300027513 | Soil | MLTLARFSLGRVLLHLVAMSRDGAYRFHGAGILREFASR |
| Ga0208685_10510382 | 3300027513 | Soil | MLTLARFSLGRVLLHLFAMMGDGAVRFHAAGILREFVSR |
| Ga0208185_10002789 | 3300027533 | Soil | MGSLSMLMLARFSLGRVLLHLLAMMGDGALRFHAAGILRELMSR |
| Ga0208185_10034738 | 3300027533 | Soil | MAALARFSHGRVLLHLVAMLGDRAFRFHAAGILREFASR |
| Ga0208185_10458382 | 3300027533 | Soil | MRSLSIMLTLARFSLGRVLLHLFAMMGDGAFRFHAAGILRELVSR |
| Ga0208185_10484483 | 3300027533 | Soil | MLTLARFSLGRVLLHLIAMLGDRAVRFHAAGILREFSS |
| Ga0208454_11421142 | 3300027573 | Soil | MLTLARFSLGRALLHLFAMMGDGAVRFHAAGILREFVSR |
| Ga0209382_109968882 | 3300027909 | Populus Rhizosphere | VLILARFSLGRVLLHLLAMMGDGAFRFHAAGILRELIR |
| Ga0209526_104247592 | 3300028047 | Forest Soil | MRSLARFRLGRILLHALAMLGDREVRFHAAGIMRELP |
| Ga0247824_105138172 | 3300028809 | Soil | MLTLARFSLGRVLLHLLAMTGDGAFRFHAAGILRELVSR |
| Ga0302046_103971041 | 3300030620 | Soil | MLTLARFSLGRVVLHLIAMLRDGAFRFHGAGILRELAGR |
| Ga0310887_100498021 | 3300031547 | Soil | VVAVSFGRVFLHLVAMLGDGAFRFHAAGILRELVSR |
| Ga0307469_115988971 | 3300031720 | Hardwood Forest Soil | MLTLARFSLGRIFLHLVAMLGDGAFRFHGAGILRELVSR |
| Ga0307468_1000130024 | 3300031740 | Hardwood Forest Soil | MATTLVRYRLGRILLHLAAMTGDGALRFHAAGIRRELRLPG |
| Ga0307468_1001366602 | 3300031740 | Hardwood Forest Soil | MEKLAHYRLGRSVLHTLAMIGDGAFRFHTAGILRELAVS |
| Ga0307468_1003124482 | 3300031740 | Hardwood Forest Soil | MLTLARFSLGRVFLHLVAMLGDGAFRFHGAGILRELVSR |
| Ga0307468_1017247283 | 3300031740 | Hardwood Forest Soil | MLTLARFSLGRVFLHLVAMLGDGALRFHAAGILRELVSR |
| Ga0307473_101446652 | 3300031820 | Hardwood Forest Soil | MATLVRYRLGRILLHLAAMIGDGALRFHAAGIRRELRLQG |
| Ga0310899_104638472 | 3300032017 | Soil | MGKLAHFRLGRILLHTVAMLGDRAFRFHAAGILRELA |
| Ga0307470_102026952 | 3300032174 | Hardwood Forest Soil | MATTLVRYRLGRILLHLAAMIGDGALRFHAAGIRRELRLQG |
| Ga0307470_113610061 | 3300032174 | Hardwood Forest Soil | YSGGRILLHLGALLGDRAVRFHAAGIAREVRAWVGC |
| Ga0307471_1018280581 | 3300032180 | Hardwood Forest Soil | MLTLARFSGGRIVLHLAALLGDGAVRFHAAGIARELRAWVRY |
| Ga0364945_0148286_275_394 | 3300034115 | Sediment | MLTLARFSLGRVVLHLLAMIGDGAFRFHAAGILRELVSR |
| Ga0364929_0121131_550_696 | 3300034149 | Sediment | MESLRMGHCMLTLARFSLGRVVLHLLAMIGDGAFRFHAAGILRELVSR |
| Ga0364934_0112923_3_128 | 3300034178 | Sediment | MLTLARSGLGRVLLHLLAMVGDRAVRFHAAGIVRELPWIVGA |
| ⦗Top⦘ |