


| Basic Information | |
|---|---|
| Family ID | F080518 |
| Family Type | Metagenome |
| Number of Sequences | 115 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MTDNKRVTNKQILDKINDLKVGEEGLNLLAIKIVSRMVKLK |
| Number of Associated Samples | 90 |
| Number of Associated Scaffolds | 115 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 1.74 % |
| % of genes near scaffold ends (potentially truncated) | 98.26 % |
| % of genes from short scaffolds (< 2000 bps) | 97.39 % |
| Associated GOLD sequencing projects | 79 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | unclassified viruses (73.913 % of family members) |
| NCBI Taxonomy ID | 12429 |
| Taxonomy | All Organisms → Viruses → unclassified viruses |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (46.956 % of family members) |
| Environment Ontology (ENVO) | Unclassified (91.304 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (93.913 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 70.73% β-sheet: 0.00% Coil/Unstructured: 29.27% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 115 Family Scaffolds |
|---|---|---|
| PF00462 | Glutaredoxin | 10.43 |
| PF01068 | DNA_ligase_A_M | 0.87 |
| PF03013 | Pyr_excise | 0.87 |
| COG ID | Name | Functional Category | % Frequency in 115 Family Scaffolds |
|---|---|---|---|
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.87 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.87 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 89.57 % |
| Unclassified | root | N/A | 10.43 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000117|DelMOWin2010_c10262342 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 500 | Open in IMG/M |
| 3300001450|JGI24006J15134_10111204 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 965 | Open in IMG/M |
| 3300001450|JGI24006J15134_10214389 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 577 | Open in IMG/M |
| 3300004097|Ga0055584_101965876 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 600 | Open in IMG/M |
| 3300004448|Ga0065861_1085086 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 600 | Open in IMG/M |
| 3300006164|Ga0075441_10091905 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 1168 | Open in IMG/M |
| 3300006164|Ga0075441_10339461 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 546 | Open in IMG/M |
| 3300006165|Ga0075443_10172850 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 768 | Open in IMG/M |
| 3300006736|Ga0098033_1121691 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 737 | Open in IMG/M |
| 3300006737|Ga0098037_1155110 | Not Available | 767 | Open in IMG/M |
| 3300006749|Ga0098042_1054811 | All Organisms → Viruses → Predicted Viral | 1073 | Open in IMG/M |
| 3300006749|Ga0098042_1062362 | Not Available | 990 | Open in IMG/M |
| 3300006752|Ga0098048_1202598 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 585 | Open in IMG/M |
| 3300006753|Ga0098039_1073924 | All Organisms → Viruses → Predicted Viral | 1181 | Open in IMG/M |
| 3300006754|Ga0098044_1310249 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 602 | Open in IMG/M |
| 3300006789|Ga0098054_1331946 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 541 | Open in IMG/M |
| 3300006789|Ga0098054_1339100 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 534 | Open in IMG/M |
| 3300006793|Ga0098055_1313027 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 586 | Open in IMG/M |
| 3300006810|Ga0070754_10497476 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 525 | Open in IMG/M |
| 3300006920|Ga0070748_1085572 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 1213 | Open in IMG/M |
| 3300006921|Ga0098060_1085317 | Not Available | 903 | Open in IMG/M |
| 3300006922|Ga0098045_1160963 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 513 | Open in IMG/M |
| 3300006924|Ga0098051_1106587 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 750 | Open in IMG/M |
| 3300006924|Ga0098051_1138704 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 645 | Open in IMG/M |
| 3300006928|Ga0098041_1271301 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 540 | Open in IMG/M |
| 3300006990|Ga0098046_1134967 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 534 | Open in IMG/M |
| 3300007276|Ga0070747_1127261 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 925 | Open in IMG/M |
| 3300007276|Ga0070747_1288433 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 565 | Open in IMG/M |
| 3300007963|Ga0110931_1237539 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 542 | Open in IMG/M |
| 3300008050|Ga0098052_1239687 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 695 | Open in IMG/M |
| 3300008050|Ga0098052_1342062 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 561 | Open in IMG/M |
| 3300008217|Ga0114899_1279163 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 507 | Open in IMG/M |
| 3300009412|Ga0114903_1144392 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 520 | Open in IMG/M |
| 3300009413|Ga0114902_1093405 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 808 | Open in IMG/M |
| 3300009413|Ga0114902_1170804 | Not Available | 540 | Open in IMG/M |
| 3300009414|Ga0114909_1191212 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 524 | Open in IMG/M |
| 3300009418|Ga0114908_1167683 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 696 | Open in IMG/M |
| 3300009425|Ga0114997_10753898 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 507 | Open in IMG/M |
| 3300009433|Ga0115545_1157814 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 789 | Open in IMG/M |
| 3300009441|Ga0115007_11102077 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 549 | Open in IMG/M |
| 3300009512|Ga0115003_10184246 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 1258 | Open in IMG/M |
| 3300009604|Ga0114901_1229833 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 525 | Open in IMG/M |
| 3300009605|Ga0114906_1248492 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 580 | Open in IMG/M |
| 3300009605|Ga0114906_1284017 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 529 | Open in IMG/M |
| 3300009705|Ga0115000_10363488 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 927 | Open in IMG/M |
| 3300010148|Ga0098043_1064252 | All Organisms → Viruses → Predicted Viral | 1105 | Open in IMG/M |
| 3300010148|Ga0098043_1146485 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 670 | Open in IMG/M |
| 3300010148|Ga0098043_1147045 | Not Available | 668 | Open in IMG/M |
| 3300010149|Ga0098049_1146752 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 730 | Open in IMG/M |
| 3300010149|Ga0098049_1210341 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 595 | Open in IMG/M |
| 3300010150|Ga0098056_1062005 | All Organisms → Viruses → Predicted Viral | 1288 | Open in IMG/M |
| 3300010151|Ga0098061_1286522 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 568 | Open in IMG/M |
| 3300010151|Ga0098061_1329910 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 521 | Open in IMG/M |
| 3300010153|Ga0098059_1077000 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 1331 | Open in IMG/M |
| 3300010153|Ga0098059_1117318 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 1054 | Open in IMG/M |
| 3300010153|Ga0098059_1168269 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 860 | Open in IMG/M |
| 3300010153|Ga0098059_1262819 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 664 | Open in IMG/M |
| 3300011254|Ga0151675_1010449 | All Organisms → Viruses → Predicted Viral | 2469 | Open in IMG/M |
| 3300012928|Ga0163110_11752923 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 506 | Open in IMG/M |
| 3300017720|Ga0181383_1187805 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 550 | Open in IMG/M |
| 3300017724|Ga0181388_1017021 | All Organisms → Viruses → Predicted Viral | 1832 | Open in IMG/M |
| 3300017735|Ga0181431_1103669 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 637 | Open in IMG/M |
| 3300017738|Ga0181428_1151816 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 541 | Open in IMG/M |
| 3300017740|Ga0181418_1116991 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 645 | Open in IMG/M |
| 3300017741|Ga0181421_1018761 | Not Available | 1893 | Open in IMG/M |
| 3300017741|Ga0181421_1143704 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300017746|Ga0181389_1197503 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 520 | Open in IMG/M |
| 3300017749|Ga0181392_1219461 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 542 | Open in IMG/M |
| 3300017755|Ga0181411_1051234 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 1272 | Open in IMG/M |
| 3300017758|Ga0181409_1041881 | All Organisms → Viruses → Predicted Viral | 1424 | Open in IMG/M |
| 3300017760|Ga0181408_1182196 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 536 | Open in IMG/M |
| 3300017764|Ga0181385_1037947 | All Organisms → Viruses → Predicted Viral | 1515 | Open in IMG/M |
| 3300017764|Ga0181385_1046886 | Not Available | 1349 | Open in IMG/M |
| 3300017772|Ga0181430_1169529 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 630 | Open in IMG/M |
| 3300017775|Ga0181432_1215295 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 603 | Open in IMG/M |
| 3300017781|Ga0181423_1386223 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 506 | Open in IMG/M |
| 3300020595|Ga0206126_10389111 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 616 | Open in IMG/M |
| 3300021959|Ga0222716_10123845 | All Organisms → Viruses → Predicted Viral | 1718 | Open in IMG/M |
| 3300021960|Ga0222715_10125278 | All Organisms → Viruses → Predicted Viral | 1626 | Open in IMG/M |
| 3300022164|Ga0212022_1056455 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 606 | Open in IMG/M |
| (restricted) 3300022920|Ga0233426_10080781 | All Organisms → Viruses → Predicted Viral | 1472 | Open in IMG/M |
| 3300024344|Ga0209992_10033604 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 2588 | Open in IMG/M |
| 3300025071|Ga0207896_1021722 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 1112 | Open in IMG/M |
| 3300025086|Ga0208157_1011837 | All Organisms → Viruses → Predicted Viral | 2859 | Open in IMG/M |
| 3300025099|Ga0208669_1045486 | All Organisms → Viruses | 1018 | Open in IMG/M |
| 3300025099|Ga0208669_1065249 | Not Available | 805 | Open in IMG/M |
| 3300025099|Ga0208669_1095373 | Not Available | 625 | Open in IMG/M |
| 3300025101|Ga0208159_1058178 | Not Available | 778 | Open in IMG/M |
| 3300025101|Ga0208159_1078502 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 627 | Open in IMG/M |
| 3300025103|Ga0208013_1055955 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 1060 | Open in IMG/M |
| 3300025118|Ga0208790_1197248 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 532 | Open in IMG/M |
| 3300025127|Ga0209348_1064475 | Not Available | 1200 | Open in IMG/M |
| 3300025128|Ga0208919_1052775 | All Organisms → Viruses → Predicted Viral | 1390 | Open in IMG/M |
| 3300025128|Ga0208919_1244526 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 523 | Open in IMG/M |
| 3300025138|Ga0209634_1152607 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 940 | Open in IMG/M |
| 3300025151|Ga0209645_1030355 | All Organisms → Viruses → Predicted Viral | 1992 | Open in IMG/M |
| 3300025168|Ga0209337_1096337 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 1391 | Open in IMG/M |
| 3300025168|Ga0209337_1335681 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 526 | Open in IMG/M |
| 3300025301|Ga0208450_1121277 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 554 | Open in IMG/M |
| 3300025645|Ga0208643_1163937 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 552 | Open in IMG/M |
| 3300025680|Ga0209306_1171261 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 606 | Open in IMG/M |
| 3300027686|Ga0209071_1159921 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 639 | Open in IMG/M |
| 3300027704|Ga0209816_1052030 | All Organisms → Viruses → Predicted Viral | 1838 | Open in IMG/M |
| 3300027704|Ga0209816_1199421 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 667 | Open in IMG/M |
| 3300027704|Ga0209816_1259342 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 544 | Open in IMG/M |
| 3300027714|Ga0209815_1137010 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 790 | Open in IMG/M |
| 3300027771|Ga0209279_10196010 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 601 | Open in IMG/M |
| 3300027791|Ga0209830_10494947 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 502 | Open in IMG/M |
| 3300029319|Ga0183748_1087645 | Not Available | 748 | Open in IMG/M |
| 3300029448|Ga0183755_1038156 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 1328 | Open in IMG/M |
| 3300031143|Ga0308025_1094132 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 1106 | Open in IMG/M |
| 3300031519|Ga0307488_10826578 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 510 | Open in IMG/M |
| 3300031660|Ga0307994_1247107 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 544 | Open in IMG/M |
| 3300032277|Ga0316202_10621574 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 509 | Open in IMG/M |
| 3300033742|Ga0314858_155262 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 588 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 46.96% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 14.78% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 9.57% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 8.70% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 5.22% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 1.74% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.74% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 1.74% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 0.87% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.87% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 0.87% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.87% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.87% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.87% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 0.87% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.87% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.87% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.87% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 0.87% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300004097 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaG | Environmental | Open in IMG/M |
| 3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300006164 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA | Environmental | Open in IMG/M |
| 3300006165 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNA | Environmental | Open in IMG/M |
| 3300006736 | Marine viral communities from the Subarctic Pacific Ocean - 1_ETSP_OMZ_AT15124 metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006753 | Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaG | Environmental | Open in IMG/M |
| 3300006754 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300006922 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG | Environmental | Open in IMG/M |
| 3300006924 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300006990 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007963 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2) | Environmental | Open in IMG/M |
| 3300008050 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG | Environmental | Open in IMG/M |
| 3300008217 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_215 | Environmental | Open in IMG/M |
| 3300009412 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s2 | Environmental | Open in IMG/M |
| 3300009413 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s12 | Environmental | Open in IMG/M |
| 3300009414 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_906 | Environmental | Open in IMG/M |
| 3300009418 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s17 | Environmental | Open in IMG/M |
| 3300009425 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 | Environmental | Open in IMG/M |
| 3300009433 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 | Environmental | Open in IMG/M |
| 3300009441 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome | Environmental | Open in IMG/M |
| 3300009512 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 | Environmental | Open in IMG/M |
| 3300009604 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s16 | Environmental | Open in IMG/M |
| 3300009605 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9 | Environmental | Open in IMG/M |
| 3300009705 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 | Environmental | Open in IMG/M |
| 3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010151 | Marine viral communities from the Subarctic Pacific Ocean - 22_ETSP_OMZ_AT15343 metaG | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300011254 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, 0.02 | Environmental | Open in IMG/M |
| 3300012928 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG | Environmental | Open in IMG/M |
| 3300017720 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 | Environmental | Open in IMG/M |
| 3300017724 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17 | Environmental | Open in IMG/M |
| 3300017735 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 54 SPOT_SRF_2014-05-21 | Environmental | Open in IMG/M |
| 3300017738 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12 | Environmental | Open in IMG/M |
| 3300017740 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13 | Environmental | Open in IMG/M |
| 3300017741 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19 | Environmental | Open in IMG/M |
| 3300017746 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29 | Environmental | Open in IMG/M |
| 3300017749 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 | Environmental | Open in IMG/M |
| 3300017755 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09 | Environmental | Open in IMG/M |
| 3300017758 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30 | Environmental | Open in IMG/M |
| 3300017760 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16 | Environmental | Open in IMG/M |
| 3300017764 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11 | Environmental | Open in IMG/M |
| 3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
| 3300017775 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 55 SPOT_SRF_2014-07-17 | Environmental | Open in IMG/M |
| 3300017781 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14 | Environmental | Open in IMG/M |
| 3300020595 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160412_1 | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300022164 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v2) | Environmental | Open in IMG/M |
| 3300022920 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_10_MG | Environmental | Open in IMG/M |
| 3300024344 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025071 | Marine viral communities from the Pacific Ocean - LP-36 (SPAdes) | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025099 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025101 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025103 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025118 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025127 | Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025128 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025301 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_908 (SPAdes) | Environmental | Open in IMG/M |
| 3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025680 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 (SPAdes) | Environmental | Open in IMG/M |
| 3300027686 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG108-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027704 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027714 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027771 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027791 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300029319 | Marine viral communities collected during Tara Oceans survey from station TARA_032 - TARA_A100001516 | Environmental | Open in IMG/M |
| 3300029448 | Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082 | Environmental | Open in IMG/M |
| 3300031143 | Marine microbial communities from water near the shore, Antarctic Ocean - #422 | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031660 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #261 | Environmental | Open in IMG/M |
| 3300032277 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotite | Environmental | Open in IMG/M |
| 3300033742 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawater | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOWin2010_102623422 | 3300000117 | Marine | MTDNKRVTNKQILDKINDLKVGDEGLNALAIKIVSRM |
| JGI24006J15134_101112044 | 3300001450 | Marine | MTDNKRVTNKQILQKIDDLKVGEEGLNALAVKIVSRMMKIQTMSEWY |
| JGI24006J15134_102143892 | 3300001450 | Marine | MTDNKRVTNKQILQKIDDLKVGEEGLNTLAIKIVSRM |
| Ga0055584_1019658762 | 3300004097 | Pelagic Marine | MTESKRVTNKQILDKIDALKVGDEGLNALAIKIVSRMVKLKS |
| Ga0065861_10850861 | 3300004448 | Marine | MTDNKRVTNKQILQKIDDLKVGDEGLNALAIKIVSRMVKLKSMEDWF |
| Ga0075441_100919054 | 3300006164 | Marine | MDNKRVTNKQILQKIDDLKVGEEGLNTLAIKIVSRMVKLK |
| Ga0075441_103394611 | 3300006164 | Marine | MTDNKRVTNRQILQKIDDLKVGEEGLNTLALKIVSRMVKLKSMEDWFEHV |
| Ga0075443_101728501 | 3300006165 | Marine | MKMDNKRVSNKQILDKIDALKVGEEGLNTLALKIVSRMVKLK |
| Ga0098033_11216913 | 3300006736 | Marine | MTDNKRVTNKQILDKINDLKVGDEGLNRLAIKIVSRMVKLRSME |
| Ga0098037_11551102 | 3300006737 | Marine | MTDNKRVSNKQILDKINDLKVGEEGLNLLAIKIVSRMVKLKSMEDWFA |
| Ga0098042_10548111 | 3300006749 | Marine | MTENKRVTNKQILDKIDSLKVGDEGLNALAIKIVSR |
| Ga0098042_10623624 | 3300006749 | Marine | MTDNKRVTNKQILDKIDSLKVGDEGLAILANKIVSRMV |
| Ga0098048_12025981 | 3300006752 | Marine | MTDNKRVTNKQILDKINDLKVGEEGLNLLAIKIVSRMVKLKSMETWFE |
| Ga0098039_10739241 | 3300006753 | Marine | MTENKRTTNKQIFEKLDKLKMSDTELNALAIKIVSRMVKL |
| Ga0098044_13102491 | 3300006754 | Marine | MTDNKRVTNKQILDKINDLKVGEEGLNLLAIKIVSR |
| Ga0098054_13319462 | 3300006789 | Marine | MTDNKRVTNKQILQKIDDLKVGEEGLNLLAIKIVSRMVKLKSM |
| Ga0098054_13391002 | 3300006789 | Marine | MTDNKRTTNKQIFDKLDKLKMSDTELNALAIKIVSRMVKLK |
| Ga0098055_13130273 | 3300006793 | Marine | MTENKRVTNKQILDKIDSLKVGEEGLNLLAIKIVSRMV |
| Ga0070754_104974761 | 3300006810 | Aqueous | MTDNKRVTNKQILQKIDDLKVGEEGLNILALKIVSRMVKLKSMED |
| Ga0070748_10855725 | 3300006920 | Aqueous | MDNKRVSNKQILDKINDLKVGEEGLNALAIKIVSRMVKLKS |
| Ga0098060_10853173 | 3300006921 | Marine | MTDNKRVTNKQILDKINDLKVGEEGLNLLAIKIVSRMVKLKSMEDWFS |
| Ga0098045_11609631 | 3300006922 | Marine | MTDNKRVTNKQILQKIDDLKVGDEGLNALAIKIVSRM |
| Ga0098051_11065873 | 3300006924 | Marine | MTDNKRVTNKQILDKIDALKVGDEGLNALAIKIVSRMVKLK |
| Ga0098051_11387041 | 3300006924 | Marine | MDNKRVTNKQILDKIDDLKVGEEGLNALAVKIVSRMVKLKSMEDWFDH |
| Ga0098041_12713011 | 3300006928 | Marine | MTDNKRVTNKQILQKIDDLKVGEEGLNALAVKVVSRMVKLKSMEDWFT |
| Ga0098046_11349672 | 3300006990 | Marine | MTDNKRVTNKQILDKIDALKVGDEGLNLLAIKIVSRMVKLKSM |
| Ga0070747_11272613 | 3300007276 | Aqueous | MDNKRVSNKQILDKINDLKVGEEGLNALAIKIVSRMV |
| Ga0070747_12884332 | 3300007276 | Aqueous | MDNKRVTNKQILQKIDDLKVGEEGLNTLALKIVSRMVKL |
| Ga0110931_12375391 | 3300007963 | Marine | MTDNKRVTNKQILDKINDLKVGEEGLNLLAIKIVS |
| Ga0098052_12396871 | 3300008050 | Marine | MTKDNKRVTNKQILDKINDLKVGEEGLNLLAIKIVSRMVKL |
| Ga0098052_13420623 | 3300008050 | Marine | MTDNKRVSNKQILDKINDLKVGEEGLNALAIKIVSRMVKL |
| Ga0114899_12791631 | 3300008217 | Deep Ocean | MTDNKRTTNKQIFDKLDKLKMSDTELNALAIKIVSRMVK |
| Ga0114903_11443921 | 3300009412 | Deep Ocean | MTDNKRVTNKQILDKIDALKVGDEGLNALAIKIVSRM |
| Ga0114902_10934053 | 3300009413 | Deep Ocean | MTDNKRVTNKQILDKIDALKVGEEGLNLLAIKIVSRMVKLKSMEDWF |
| Ga0114902_11708042 | 3300009413 | Deep Ocean | MTDNKRVTNKQILDKINSLKVGDEGLKILAVKIVSRMVKL* |
| Ga0114909_11912121 | 3300009414 | Deep Ocean | MMTDNKRVTNKQILDKIDDLKVGEEGLNLLAIKIVSRMVKLKSM |
| Ga0114908_11676831 | 3300009418 | Deep Ocean | MTDNKRVTNKQILDKIDALKVGDEGLNALAVKIVSRM |
| Ga0114997_107538982 | 3300009425 | Marine | MTDNKRVSNKQILDKINDLKVGEEGLNALAIKIVSRMVKLK |
| Ga0115545_11578141 | 3300009433 | Pelagic Marine | MTDNKRVSNKQILEKIDQLKVGDEGLNALAIKIVSR |
| Ga0115007_111020772 | 3300009441 | Marine | MTDNKRVTNKQILDKIDKLKVGEEGLNLLAVKIVSRMMNIQT |
| Ga0115003_101842461 | 3300009512 | Marine | MTDNKRVTNKQILQKIDDLKVGDEGLNTLALKIVSRMVKLKSMED |
| Ga0114901_12298332 | 3300009604 | Deep Ocean | MTDNKRVTNKQILDKIDNLKVGEEGLNLLAVKIVS |
| Ga0114906_12484922 | 3300009605 | Deep Ocean | MTENKRTTNKQIFEKLDKLKMSDTELNALAIKIVSRMVKLKSMEDWF |
| Ga0114906_12840172 | 3300009605 | Deep Ocean | MTENKRTTNKQIFDKLENLKMTDTELNALAIKIVSRM |
| Ga0115000_103634881 | 3300009705 | Marine | MTDNKRVTNKQILQKIDDLKVGEEGLNTLAIKIVSRMVKLKSMEDW |
| Ga0098043_10642524 | 3300010148 | Marine | MTDNKRVTNKQILDKIDSLKVGDEGLNALAIKVVSRMVKLKS |
| Ga0098043_11464851 | 3300010148 | Marine | MTENKRVTNKQILDKIDSLKVGDEGLNILAIKIVSRMVKLKSM |
| Ga0098043_11470452 | 3300010148 | Marine | MTDNKRVTNKQILDKIDALKVGDEGLDILAIKIVSRMVKLKS |
| Ga0098049_11467521 | 3300010149 | Marine | MTDNKRVSNKQILDKIDALKVGDEGLNALAIKIVSRMVKLKSMEDWF |
| Ga0098049_12103412 | 3300010149 | Marine | MTDNKRVTNKQILDKINSLKVGDEGLNALAIKIVSRMVKLKSME |
| Ga0098056_10620054 | 3300010150 | Marine | MTDNKRVTNKQILQKIDDLKVGEEGLNALAVKVVSRM |
| Ga0098061_12865222 | 3300010151 | Marine | MTDNKRVTNKQILDKINDLKVGEEGLNLLAIKIVSRMV |
| Ga0098061_13299102 | 3300010151 | Marine | MTDNKRVTNKQILDKINDLKVGEEGLNLLAIKIVSRMVKLKSMEE |
| Ga0098059_10770005 | 3300010153 | Marine | MTDNKRVTNKQILDKIDALKVGDEGLNALAIKIVSRMVKLKSME |
| Ga0098059_11173184 | 3300010153 | Marine | MTDNKRVTNKQILDKINDLKVGEEGLNLLAIKIVSRMVKLKSMEDWF |
| Ga0098059_11682691 | 3300010153 | Marine | MTDNKRVTNKQILQKIDDLKVGDEGLNALAIKIVSRMVKLKSME |
| Ga0098059_12628193 | 3300010153 | Marine | MTDNKRVTNKQILDKINDLKVGDEGLNLLAIKIVSRMVKLKS |
| Ga0151675_10104498 | 3300011254 | Marine | MDNKRVTNKQILDKIDDLKVGEEGLNALAVKIVSRMVKLKSMEDWF |
| Ga0163110_117529231 | 3300012928 | Surface Seawater | MTDNKRVTNKQILDKIDALKVGEEGLNLLAIKIVSRMVK |
| Ga0181383_11878052 | 3300017720 | Seawater | MTDNKRVTNKQILQKIDDLKVGEEGLSALAIKIVS |
| Ga0181388_10170215 | 3300017724 | Seawater | MTDNKRISNKQILDKINDLKVGDEGLNALAIKIVSRMVKLKSMEDWF |
| Ga0181431_11036691 | 3300017735 | Seawater | MTDNKRISNKQILDKINDLKVGDEGLNALAIKIVSRMVKLKSMEDW |
| Ga0181428_11518161 | 3300017738 | Seawater | MTDNKRVTNKQILDKINDLKVGEESLNLLAIKIVSR |
| Ga0181418_11169913 | 3300017740 | Seawater | MDNKRVSNKQILDKIDDLKVGDEGLNALAIKIVSR |
| Ga0181421_10187616 | 3300017741 | Seawater | MTDNKRVTNKQILDKIDSLKVGEEGLNLLAIKIVSRMTKLRA |
| Ga0181421_11437043 | 3300017741 | Seawater | MTESKRVTNKQILDKIDALKVGDEGLNALAIKIVSRMV |
| Ga0181389_11975031 | 3300017746 | Seawater | MTDNKRVSNKQILDKINDLKVGDEGLNALAIKIVSRM |
| Ga0181392_12194613 | 3300017749 | Seawater | MTDNKRVTNKQILDKIDALKVGDEGLNLLAIKIVSRMVKLK |
| Ga0181411_10512341 | 3300017755 | Seawater | MDNKRVTNKQILDKIDDLKVGEEGLNALAIKIVSRMVKLK |
| Ga0181409_10418815 | 3300017758 | Seawater | MTDNKRVSNKQILDKINDLKVGEEGLNLLAIKIVSRMV |
| Ga0181408_11821962 | 3300017760 | Seawater | MTDNKRVTNKQILQKIDDLKVGDEGLNLLAIKIVSRM |
| Ga0181385_10379475 | 3300017764 | Seawater | MMTDNKRVTNKQILDKINDLKVGEEGLNLLAIKIVSRMVKLKSME |
| Ga0181385_10468865 | 3300017764 | Seawater | MTDNKRVTNKQILDKINDLKVGEEGLNLLAIKIVSRMVKLKS |
| Ga0181430_11695293 | 3300017772 | Seawater | MAENKRTTNKQIMDKLEKLGMSDTELNALAIKIVSRMVKLK |
| Ga0181432_12152952 | 3300017775 | Seawater | MMTDNKRVTNKQILDKINDLKVGDEGLNLLAIKIVSR |
| Ga0181423_13862232 | 3300017781 | Seawater | MTDNKRVTNKQILQKIDDLKVGEEGLNALAVKIVSRMV |
| Ga0206126_103891112 | 3300020595 | Seawater | MDNKRVSNKQILDKINDLKVGEEGLNTLAIKIVSRMVKLKSM |
| Ga0222716_101238451 | 3300021959 | Estuarine Water | MTDNKRVSNKQILDKINDLKVGEEGLNALAIKIVSRMVKLKSMEDWF |
| Ga0222715_101252781 | 3300021960 | Estuarine Water | MTDNKRVSNKQILDKINDLKVGEEGLNALAIKIVSRMV |
| Ga0212022_10564551 | 3300022164 | Aqueous | MTDNKRVTNKQILQKIDDLKVGDEGLNALAIKIVSRMVKLKS |
| (restricted) Ga0233426_100807811 | 3300022920 | Seawater | MDNKRVSNKQILDKINDLKVGDEGLNALAIKIVSRMVK |
| Ga0209992_100336041 | 3300024344 | Deep Subsurface | MTDNKRVTNKQILDKIDALKVGDEGLNALAIKIVSRMVKLKS |
| Ga0207896_10217221 | 3300025071 | Marine | MTDNKRVTNKQILQKIDDLKVGEEGLNTLAIKIVSRMVKLKSMEDWFE |
| Ga0208157_10118371 | 3300025086 | Marine | MTDNKRVTNKQILDKIDALKVGEEGLNLLAIKIVSR |
| Ga0208669_10454864 | 3300025099 | Marine | MTDNKRVSNKQILDKIDALKVGDEGLNLLAIKIVSRMV |
| Ga0208669_10652491 | 3300025099 | Marine | MTESKRVTNKQILDKIDSLKVGDEGLNILAVKIVS |
| Ga0208669_10953733 | 3300025099 | Marine | MTDNKRVTNKQILDKIDALKVGDEGLNLLAIKIVSRMV |
| Ga0208159_10581781 | 3300025101 | Marine | MTDNKRVTNKQILDKIDSLKVGDEGLAILANKIVSRMVK |
| Ga0208159_10785024 | 3300025101 | Marine | MTENKRVTNKQILDKIDSLKVGDEGLNILAIKIVSRM |
| Ga0208013_10559554 | 3300025103 | Marine | MTDNKRVSNKQILDKIDDLKVGEEGLNLLAIKIVSRMVKLKSMET |
| Ga0208790_11972482 | 3300025118 | Marine | MTDNKRVTNKQILDKIDALKVGEEGLNLLAIKIVSRMV |
| Ga0209348_10644751 | 3300025127 | Marine | MTDNKRVTNKQILDKINDLKVGEEGLNLLAIKIVSRMVKLKSM |
| Ga0208919_10527756 | 3300025128 | Marine | MTENKRVTNKQILDKIDALKVGEEGLNALAIKIVSRMVKLK |
| Ga0208919_12445261 | 3300025128 | Marine | MTDNKRVTNKQILDKINDLKVGEEGLNLLAIKIVSRMVKLK |
| Ga0209634_11526071 | 3300025138 | Marine | MTDNKRVTNKQILDKIDALKVGEEGLNTLAIKIVSRMVKLKSMEDW |
| Ga0209645_10303555 | 3300025151 | Marine | MTDNKRVTNKQILDKIDDLKVGEEGLNLLAIKIVSRMVKLKSMEDW |
| Ga0209337_10963375 | 3300025168 | Marine | MTDNKRVTNKQILQKIDDLKVGEEGLNTLAIKIVSRMVKLKS |
| Ga0209337_13356811 | 3300025168 | Marine | MTDNKRVTNKQILDKINDLKVGEEGLNTLAIKIVSRMVKLKS |
| Ga0208450_11212771 | 3300025301 | Deep Ocean | MTDNKRVTNKQILQKIDDLKVGDEGLNALAIKIVSRMVKLK |
| Ga0208643_11639372 | 3300025645 | Aqueous | MTDNKRVSNKQILDKINDLKVGDEGLNALAIKIVSRMVKLKSMEDW |
| Ga0209306_11712611 | 3300025680 | Pelagic Marine | MTDNKRVTNKQILDKINDLKVGEEGLNALAIKIVSRMVK |
| Ga0209071_11599213 | 3300027686 | Marine | MDNKRVTNKQILQKIDDLKVGEEGLDTLAIKIVSRMVKLK |
| Ga0209816_10520305 | 3300027704 | Marine | MTDNKRVTNKQILQKIDDLKVGEEGLNTLALKIVSRMVKLK |
| Ga0209816_11994211 | 3300027704 | Marine | MDNKRVTNKQILQKIDDLKVGEEGLNTLAIKIVSRMVKLKSMEDWFE |
| Ga0209816_12593422 | 3300027704 | Marine | MDNKRVTNKQILQKIDDLKVGEEGLNTLALKIVSRMVKLKSMED |
| Ga0209815_11370103 | 3300027714 | Marine | MTDNKRVTNKQILQKIDDLKVGEEGLNTLALKIVSRMVK |
| Ga0209279_101960103 | 3300027771 | Marine | MTDNKRVTNKQILQKIDDLKVGEEGLNTLAIKIVS |
| Ga0209830_104949472 | 3300027791 | Marine | MTDNKRVTNKQILQKIDDLKVGEEGLNTLALKIVS |
| Ga0183748_10876451 | 3300029319 | Marine | MTDNKRVTNRQILDKIDSLKVGDEGLTILANKIVSRMVKL |
| Ga0183755_10381565 | 3300029448 | Marine | MTDNKRVTNKQILDKINDLKVGEEGLNLLAIKIVSRM |
| Ga0308025_10941324 | 3300031143 | Marine | MDNKRVTNKQILQKIDDLKVGEEGLNTLAIKIVSRMVKLKSM |
| Ga0307488_108265782 | 3300031519 | Sackhole Brine | MTDNKRVTNKQILQKIDDLKVGDEGLNTLALKIVSRM |
| Ga0307994_12471072 | 3300031660 | Marine | MDNKRVTNKQILEKIDALKVGEEGLNTLALKIVSRM |
| Ga0316202_106215741 | 3300032277 | Microbial Mat | MTESKRVTNKQILDKIDALKVGDEGLNALAIKIVSRM |
| Ga0314858_155262_2_130 | 3300033742 | Sea-Ice Brine | MTDNKRVTNKQILQKIDDLKVGDEGLNALALKIVSRMVKLKSM |
| ⦗Top⦘ |