


| Basic Information | |
|---|---|
| Family ID | F080413 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 115 |
| Average Sequence Length | 41 residues |
| Representative Sequence | VSDLAAEVTAALGRSILPSVIARGAAGLRVVAAEDGVVTL |
| Number of Associated Samples | 106 |
| Number of Associated Scaffolds | 115 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 91.30 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 89.57 % |
| Associated GOLD sequencing projects | 105 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.58 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (93.043 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (32.174 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.913 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (43.478 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 29.41% β-sheet: 8.82% Coil/Unstructured: 61.76% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.58 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 115 Family Scaffolds |
|---|---|---|
| PF01053 | Cys_Met_Meta_PP | 86.96 |
| PF08241 | Methyltransf_11 | 2.61 |
| PF00403 | HMA | 2.61 |
| PF02771 | Acyl-CoA_dh_N | 0.87 |
| PF07690 | MFS_1 | 0.87 |
| PF00023 | Ank | 0.87 |
| PF13489 | Methyltransf_23 | 0.87 |
| PF01545 | Cation_efflux | 0.87 |
| PF00155 | Aminotran_1_2 | 0.87 |
| PF01042 | Ribonuc_L-PSP | 0.87 |
| PF00892 | EamA | 0.87 |
| PF00069 | Pkinase | 0.87 |
| COG ID | Name | Functional Category | % Frequency in 115 Family Scaffolds |
|---|---|---|---|
| COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 86.96 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 86.96 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 86.96 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 86.96 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 86.96 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 86.96 |
| COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 86.96 |
| COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 86.96 |
| COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 86.96 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 86.96 |
| COG4100 | Cystathionine beta-lyase family protein involved in aluminum resistance | Inorganic ion transport and metabolism [P] | 86.96 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.48 |
| COG2217 | Cation-transporting P-type ATPase | Inorganic ion transport and metabolism [P] | 2.61 |
| COG2608 | Copper chaperone CopZ | Inorganic ion transport and metabolism [P] | 2.61 |
| COG0053 | Divalent metal cation (Fe/Co/Zn/Cd) efflux pump | Inorganic ion transport and metabolism [P] | 0.87 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.87 |
| COG1230 | Co/Zn/Cd efflux system component | Inorganic ion transport and metabolism [P] | 0.87 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.87 |
| COG3965 | Predicted Co/Zn/Cd cation transporter, cation efflux family | Inorganic ion transport and metabolism [P] | 0.87 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 93.91 % |
| Unclassified | root | N/A | 6.09 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005166|Ga0066674_10164826 | All Organisms → cellular organisms → Bacteria | 1049 | Open in IMG/M |
| 3300005332|Ga0066388_107309729 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300005332|Ga0066388_108334408 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300005437|Ga0070710_10630008 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300005471|Ga0070698_101961713 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300005529|Ga0070741_11136818 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300005537|Ga0070730_10202676 | All Organisms → cellular organisms → Bacteria | 1324 | Open in IMG/M |
| 3300005541|Ga0070733_10493252 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
| 3300005587|Ga0066654_10049960 | All Organisms → cellular organisms → Bacteria | 1843 | Open in IMG/M |
| 3300005764|Ga0066903_100069410 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4493 | Open in IMG/M |
| 3300005841|Ga0068863_100324883 | All Organisms → cellular organisms → Bacteria | 1495 | Open in IMG/M |
| 3300005899|Ga0075271_10079375 | Not Available | 610 | Open in IMG/M |
| 3300006028|Ga0070717_11357822 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300006173|Ga0070716_100334934 | All Organisms → cellular organisms → Bacteria | 1065 | Open in IMG/M |
| 3300006755|Ga0079222_12021370 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300006796|Ga0066665_10749062 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300006806|Ga0079220_11434649 | Not Available | 588 | Open in IMG/M |
| 3300007076|Ga0075435_100685161 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
| 3300007788|Ga0099795_10252163 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300007788|Ga0099795_10322285 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300009524|Ga0116225_1343476 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300009628|Ga0116125_1150038 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300009792|Ga0126374_10162166 | All Organisms → cellular organisms → Bacteria | 1370 | Open in IMG/M |
| 3300009824|Ga0116219_10539430 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300010359|Ga0126376_10481475 | All Organisms → cellular organisms → Bacteria | 1143 | Open in IMG/M |
| 3300010359|Ga0126376_12852609 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300010361|Ga0126378_10227179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1952 | Open in IMG/M |
| 3300010376|Ga0126381_100289955 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2236 | Open in IMG/M |
| 3300010376|Ga0126381_102061771 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300010856|Ga0126358_1223713 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300012201|Ga0137365_10175443 | All Organisms → cellular organisms → Bacteria | 1606 | Open in IMG/M |
| 3300012203|Ga0137399_10663731 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
| 3300012207|Ga0137381_11218676 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300012683|Ga0137398_10205204 | All Organisms → cellular organisms → Bacteria | 1301 | Open in IMG/M |
| 3300012683|Ga0137398_10322265 | All Organisms → cellular organisms → Bacteria | 1042 | Open in IMG/M |
| 3300012924|Ga0137413_11064049 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300013307|Ga0157372_12045842 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300014969|Ga0157376_10829012 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
| 3300016270|Ga0182036_10625972 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300016341|Ga0182035_10553010 | All Organisms → cellular organisms → Bacteria | 989 | Open in IMG/M |
| 3300016371|Ga0182034_10367164 | All Organisms → cellular organisms → Bacteria | 1172 | Open in IMG/M |
| 3300016445|Ga0182038_11432994 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300017942|Ga0187808_10114186 | All Organisms → cellular organisms → Bacteria | 1178 | Open in IMG/M |
| 3300018001|Ga0187815_10028323 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 2378 | Open in IMG/M |
| 3300018007|Ga0187805_10239134 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300021401|Ga0210393_10715227 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
| 3300021403|Ga0210397_10845147 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300021478|Ga0210402_10717554 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
| 3300021560|Ga0126371_10084231 | All Organisms → cellular organisms → Bacteria | 3127 | Open in IMG/M |
| 3300024271|Ga0224564_1095981 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300024317|Ga0247660_1023396 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
| 3300025134|Ga0207416_1066445 | All Organisms → cellular organisms → Bacteria | 1421 | Open in IMG/M |
| 3300025552|Ga0210142_1060955 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300025633|Ga0208480_1023956 | All Organisms → cellular organisms → Bacteria | 1786 | Open in IMG/M |
| 3300025634|Ga0208589_1103827 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300025910|Ga0207684_10243847 | All Organisms → cellular organisms → Bacteria | 1550 | Open in IMG/M |
| 3300025928|Ga0207700_10520065 | All Organisms → cellular organisms → Bacteria | 1054 | Open in IMG/M |
| 3300025929|Ga0207664_11100117 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300025929|Ga0207664_11300436 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300025933|Ga0207706_10176538 | All Organisms → cellular organisms → Bacteria | 1876 | Open in IMG/M |
| 3300026295|Ga0209234_1243801 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300026374|Ga0257146_1007293 | All Organisms → cellular organisms → Bacteria | 1799 | Open in IMG/M |
| 3300026551|Ga0209648_10439643 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300027110|Ga0208488_1078133 | Not Available | 539 | Open in IMG/M |
| 3300027648|Ga0209420_1122765 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300027855|Ga0209693_10184551 | All Organisms → cellular organisms → Bacteria | 1028 | Open in IMG/M |
| 3300027882|Ga0209590_11002573 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300027884|Ga0209275_10177525 | All Organisms → cellular organisms → Bacteria | 1141 | Open in IMG/M |
| 3300027889|Ga0209380_10526198 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300028721|Ga0307315_10191896 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300028768|Ga0307280_10362399 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300028773|Ga0302234_10239306 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300028807|Ga0307305_10002117 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 8093 | Open in IMG/M |
| 3300028824|Ga0307310_10095052 | All Organisms → cellular organisms → Bacteria | 1318 | Open in IMG/M |
| 3300028828|Ga0307312_10998150 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300030524|Ga0311357_11563064 | Not Available | 556 | Open in IMG/M |
| 3300031543|Ga0318516_10086005 | All Organisms → cellular organisms → Bacteria | 1760 | Open in IMG/M |
| 3300031546|Ga0318538_10139327 | All Organisms → cellular organisms → Bacteria | 1276 | Open in IMG/M |
| 3300031681|Ga0318572_10108932 | All Organisms → cellular organisms → Bacteria | 1572 | Open in IMG/M |
| 3300031719|Ga0306917_10321965 | All Organisms → cellular organisms → Bacteria | 1197 | Open in IMG/M |
| 3300031751|Ga0318494_10163987 | All Organisms → cellular organisms → Bacteria | 1256 | Open in IMG/M |
| 3300031764|Ga0318535_10123918 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1143 | Open in IMG/M |
| 3300031769|Ga0318526_10249307 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300031770|Ga0318521_10141471 | All Organisms → cellular organisms → Bacteria | 1360 | Open in IMG/M |
| 3300031771|Ga0318546_10695622 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Chlorophyceae → CS clade → Chlamydomonadales → Tetrabaenaceae → Tetrabaena → Tetrabaena socialis | 715 | Open in IMG/M |
| 3300031779|Ga0318566_10153030 | All Organisms → cellular organisms → Bacteria | 1143 | Open in IMG/M |
| 3300031781|Ga0318547_10037671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2535 | Open in IMG/M |
| 3300031782|Ga0318552_10288141 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300031794|Ga0318503_10190224 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300031798|Ga0318523_10599364 | Not Available | 542 | Open in IMG/M |
| 3300031833|Ga0310917_10303022 | All Organisms → cellular organisms → Bacteria | 1081 | Open in IMG/M |
| 3300031893|Ga0318536_10082202 | All Organisms → cellular organisms → Bacteria | 1599 | Open in IMG/M |
| 3300031893|Ga0318536_10193025 | All Organisms → cellular organisms → Bacteria | 1037 | Open in IMG/M |
| 3300031910|Ga0306923_10145502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2702 | Open in IMG/M |
| 3300031946|Ga0310910_11468103 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300031947|Ga0310909_11146836 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300031954|Ga0306926_10179219 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2629 | Open in IMG/M |
| 3300031981|Ga0318531_10160530 | All Organisms → cellular organisms → Bacteria | 1009 | Open in IMG/M |
| 3300032008|Ga0318562_10290316 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288 | 950 | Open in IMG/M |
| 3300032039|Ga0318559_10028244 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2219 | Open in IMG/M |
| 3300032054|Ga0318570_10076867 | All Organisms → cellular organisms → Bacteria | 1429 | Open in IMG/M |
| 3300032055|Ga0318575_10180638 | All Organisms → cellular organisms → Bacteria | 1056 | Open in IMG/M |
| 3300032064|Ga0318510_10288378 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300032065|Ga0318513_10187624 | All Organisms → cellular organisms → Bacteria | 994 | Open in IMG/M |
| 3300032065|Ga0318513_10414081 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300032067|Ga0318524_10018619 | All Organisms → cellular organisms → Bacteria | 3069 | Open in IMG/M |
| 3300032067|Ga0318524_10405695 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300032068|Ga0318553_10501353 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300032090|Ga0318518_10326860 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300032094|Ga0318540_10605369 | Not Available | 528 | Open in IMG/M |
| 3300032180|Ga0307471_103115777 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300032828|Ga0335080_10227051 | All Organisms → cellular organisms → Bacteria | 2046 | Open in IMG/M |
| 3300032897|Ga0335071_10044519 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4386 | Open in IMG/M |
| 3300033004|Ga0335084_11457721 | Not Available | 678 | Open in IMG/M |
| 3300033290|Ga0318519_10202834 | All Organisms → cellular organisms → Bacteria | 1132 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 32.17% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.83% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.22% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.22% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.61% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.61% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.61% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.61% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.61% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.74% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.74% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.74% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.74% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.74% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.74% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.74% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.87% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.87% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.87% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.87% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.87% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.87% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.87% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.87% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.87% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.87% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.87% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005899 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_302 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010856 | Boreal forest soil eukaryotic communities from Alaska, USA - W4-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024271 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 | Environmental | Open in IMG/M |
| 3300024317 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK01 | Environmental | Open in IMG/M |
| 3300025134 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025552 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025633 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025634 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-2 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026374 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-A | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027110 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF001 (SPAdes) | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300028721 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355 | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300028773 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0066674_101648261 | 3300005166 | Soil | VSDLAAEVSAALRQSILPSVIARGAAGLRVVAADDGVVTLAADGSPGA |
| Ga0066388_1073097291 | 3300005332 | Tropical Forest Soil | VSDLAAEVTAALGRSILPSVIARGAVGLRVVAAEDGVVTLAADG |
| Ga0066388_1083344082 | 3300005332 | Tropical Forest Soil | VSDLAARVTAALERSVLPSVIARGGALRVAAADADGVVTLEVTGS |
| Ga0070710_106300082 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | VSDLAAKVTAALRPSILPSVIARGAVGLRVVAAEDGVVTLAADGSP |
| Ga0070698_1019617131 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | VSDLAAEVTAALGRSILPLVIARGATGLRVVAAEDGVVTL |
| Ga0070741_111368182 | 3300005529 | Surface Soil | VSDLAAQVTAALERSVLPSVIARGGGIRVAGVGTDGVVTLEV |
| Ga0070730_102026762 | 3300005537 | Surface Soil | VSDLAADVTAALARSIVPSVIARGGAGIRVAAADDDGVITLEADGS |
| Ga0070733_104932521 | 3300005541 | Surface Soil | VSDLAAQVTAGLARSVLPSVIARGGAIRVAAAGADGVVTLEVTGSPG |
| Ga0066654_100499601 | 3300005587 | Soil | VSDLAAVVTAALARSILPSVIARGAAGIRVIAVGNDGVITLEADGSPGAVLPILGRIEAQIR |
| Ga0066903_1000694101 | 3300005764 | Tropical Forest Soil | LTDLVSAVQAVLERSVQPSVIARGGAIRVAAAGDGTVT |
| Ga0068863_1003248831 | 3300005841 | Switchgrass Rhizosphere | VSDLVAEVTDALAHSVLPSVIARGGAIRVAGVGTDG |
| Ga0075271_100793751 | 3300005899 | Rice Paddy Soil | VSDLAAQVTATLSRSVQPSVIARGAAAIRVVSADDDGVITLEVPGSPGAVLPVLAREAQI |
| Ga0070717_113578221 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VTDLTAEVTAALARSVLPSVIARGAAVRVAAAADGIATLEVTGSP |
| Ga0070716_1003349341 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | VSDLAAEVTVALGRSILPSVIARGATGLRVVAAEDGVVTL |
| Ga0079222_120213701 | 3300006755 | Agricultural Soil | VSNLAARVTTALERSVLPSVIARGGTIRVAGVGTDGTVALE |
| Ga0066665_107490622 | 3300006796 | Soil | VSDLADEVTAVLRHSILPSVIARGAATIRVVAAEDGVVTLQADGP |
| Ga0079220_114346491 | 3300006806 | Agricultural Soil | VSDLAAQVTAALGRSVLPSVIARGGAVRVAGADTHGVVTLEVA |
| Ga0075435_1006851611 | 3300007076 | Populus Rhizosphere | VSELAAEVTAALSRSILPSVIARGAAGLRVVAVDDGVVTLAADG |
| Ga0099795_102521632 | 3300007788 | Vadose Zone Soil | MDLADSVAAVLEGSVLSSVIARGGGLRVAAVEDGVAIL |
| Ga0099795_103222851 | 3300007788 | Vadose Zone Soil | VSDLAAEVTAALGRSILPSVIARGATGLRVVAAEDGAVTLAADGSPGAVRPILG |
| Ga0116225_13434762 | 3300009524 | Peatlands Soil | VTDLIAEVMAALERSVLPSVIARGGAARVSAVEDGIVTLEV |
| Ga0116125_11500382 | 3300009628 | Peatland | VSDLVAEVTDALARSILPLVIARGAAGIRVLAAGDDGVILLEADGSPGAV |
| Ga0126374_101621661 | 3300009792 | Tropical Forest Soil | VTDLAATVAAVLQRSILPSVIARGATLRVATVEAGVATL |
| Ga0116219_105394302 | 3300009824 | Peatlands Soil | VTDLIAEVMAALERSVLPSVIARGGAARVAAVEDG |
| Ga0126376_104814752 | 3300010359 | Tropical Forest Soil | VTDLTAQVTAALRPSVLPSVIARGAAVRVAAVADGI |
| Ga0126376_128526092 | 3300010359 | Tropical Forest Soil | VSDLAAQVTAALDRSVLPSVIARGAATLRVVGAED |
| Ga0126378_102271793 | 3300010361 | Tropical Forest Soil | MSDLASQVTAALSRSIRPSLIARGAATIRVAAADEEGVVTLEVPGSPGAVLPVLGRIE |
| Ga0126381_1002899551 | 3300010376 | Tropical Forest Soil | MSDLASQVTAVLSRSIRPSLIARGAATIRVVAADEEGVVTLEVPG |
| Ga0126381_1020617711 | 3300010376 | Tropical Forest Soil | VTDLAAKVAAALERSVLPSVIARGAVLRVVAVEDGVATM |
| Ga0126358_12237132 | 3300010856 | Boreal Forest Soil | VSDLAAEVTAALRHSILPSAIARGAATIRVIAAEDGVVTLAADGSPGAVRPILRR |
| Ga0137365_101754431 | 3300012201 | Vadose Zone Soil | MDLTERAAAALERSVLPSVIARGAQLRVVAVEDGIARL |
| Ga0137399_106637312 | 3300012203 | Vadose Zone Soil | VSDLAAEVTAALRHSILPSVIARGAATIRVVAAEDGVVTLQ |
| Ga0137381_112186762 | 3300012207 | Vadose Zone Soil | VSDLADEVTAALRHSILPSVIARGAATIRVVAAEDGVVTLQ |
| Ga0137398_102052042 | 3300012683 | Vadose Zone Soil | VSDLAAQVTAVLARIVLPSVIARGGAIRVTAAGDGVV |
| Ga0137398_103222652 | 3300012683 | Vadose Zone Soil | VSDLAAEVTAALRHSILPSVIARGAATIRVVAAEDGVV |
| Ga0137413_110640491 | 3300012924 | Vadose Zone Soil | MDLAGTVAAVLERGVLSSVIARGGGLRVAAVEDGVAILE |
| Ga0157372_120458422 | 3300013307 | Corn Rhizosphere | VSDLAAEVTAALSRSILPSVIARGAAGLRVAAAEDGVVTLAVDGSPGAVLPVLG |
| Ga0157376_108290121 | 3300014969 | Miscanthus Rhizosphere | VSDPAVRVTAALERSILPSVIARGGALRVAGVGTDG |
| Ga0182036_106259722 | 3300016270 | Soil | VTAALERGILPSVIARGGAVRVAAAGDGIVTLEVTGSVGAVFPL |
| Ga0182035_105530101 | 3300016341 | Soil | VTGPAAKVAAALKHSILPSVIARGAALRVVAIEDGIAT |
| Ga0182034_103671642 | 3300016371 | Soil | VTGLAAQVTAALERSVMPSVIARGAAIRVATAEAGA |
| Ga0182038_114329941 | 3300016445 | Soil | VTGLAAQVTAALERSVMPSVIARGAAIRVATAEAG |
| Ga0187808_101141862 | 3300017942 | Freshwater Sediment | VSDLAAQVTAALARSVLPSVIARGGAIRVTAAGAGGVVTLE |
| Ga0187815_100283236 | 3300018001 | Freshwater Sediment | VTDLAARVTAVLERSILPSVIARDAFIRVVAAADGTVTLEVTGSPG |
| Ga0187805_102391341 | 3300018007 | Freshwater Sediment | VTGLTGQVTAALERAILPSIVARGGAVRVTEAGDGIVTL |
| Ga0210393_107152272 | 3300021401 | Soil | VTDLTAAVQAALERSVLPSVIARGGAVRIAAAGGGIVTL |
| Ga0210397_108451472 | 3300021403 | Soil | VTDLTAQVTAALTRSVLPSVIARGAAVRVAAAADGVVTLEVTGS |
| Ga0210402_107175542 | 3300021478 | Soil | VTDLTAAVQAVLERSVLPSVIARGGAVRIAAAGGGI |
| Ga0126371_100842311 | 3300021560 | Tropical Forest Soil | VTDLAAKVAVALERSVIPSVIARGAALRVVAVEAGVATLEVT |
| Ga0224564_10959812 | 3300024271 | Soil | VTDLTAEVTAALTRSVLPSVIARGAAVRVAAAADGVVTLEVTGSP |
| Ga0247660_10233962 | 3300024317 | Soil | VSDLAAEVSAALRQSILPSVIARGAAGLRVVAADDGVVT |
| Ga0207416_10664451 | 3300025134 | Iron-Sulfur Acid Spring | VSDLAAAVTPVLAHSILPSVIARGATGIRVVAAGDDGVITLEAD |
| Ga0210142_10609551 | 3300025552 | Natural And Restored Wetlands | VTGLAARVTAVLERSVLPSVIARGASVRVAAVTGGI |
| Ga0208480_10239564 | 3300025633 | Arctic Peat Soil | VSDLAAQVGAVLARTVLPSVIARGGAIRVAAAGDGVV |
| Ga0208589_11038271 | 3300025634 | Arctic Peat Soil | VTDLAAKVTAALERSVLPSVIARGAAVRVVAVQDR |
| Ga0207684_102438473 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VTDLTAAVQAVLERSILPSVIARGGAVRVAGAGDGTVT |
| Ga0207700_105200652 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VSDLAAEVTAALGRSILPSVIARGATGLRVVAAEDGVVTLA |
| Ga0207664_111001172 | 3300025929 | Agricultural Soil | VSDLAAQVTAALGRSVLPSVIARGGAVRVVGADTHGVVTLEVA |
| Ga0207664_113004361 | 3300025929 | Agricultural Soil | VSDLAARVTAALERSILASVIARGGAIRVAAAGADGVVALEV |
| Ga0207706_101765381 | 3300025933 | Corn Rhizosphere | VSDLAAEVTAALARSILPSVIARGAVGLRVVAAEDGVVTLAAD |
| Ga0209234_12438011 | 3300026295 | Grasslands Soil | VSDLAAEVTAALGRSILPSVIARGAAGLRVVAAEDG |
| Ga0257146_10072931 | 3300026374 | Soil | VSDLAAEVTAALSRSILPSVIARGAVGLRVVAAEDGVVTLA |
| Ga0209648_104396431 | 3300026551 | Grasslands Soil | VTDLTAEVTAALERSVLPSVIARGAAVRVAAAADGIVTLEV |
| Ga0208488_10781332 | 3300027110 | Forest Soil | MSDLAAEVTAALERSILPSVIARGATIRVVAANDGVVILAADGS |
| Ga0209420_11227651 | 3300027648 | Forest Soil | VSDLAAEVTAVLERSILPSVIARGATIRVVAADDGVVI |
| Ga0209693_101845511 | 3300027855 | Soil | VNDLASVNDLAAEVTAVLERGILPSVIARGATIRVVSADDG |
| Ga0209590_110025732 | 3300027882 | Vadose Zone Soil | MDLADTVTAALERSVLPSVIARGGGLRVAAVEDGVAI |
| Ga0209275_101775252 | 3300027884 | Soil | VNDLASQVTAVLQRGILPSVIARGATIRVVSADDGVVIL |
| Ga0209380_105261982 | 3300027889 | Soil | VTDLTAQVTAALTRSVLPSVIARGAAVRVAAAADG |
| Ga0307315_101918962 | 3300028721 | Soil | MDLVDRAMATLRRSVLPSVIARGGTVRVVAVEEGTAI |
| Ga0307280_103623992 | 3300028768 | Soil | VSDLAAEVTAALARSILPSVIARGATGIRVIAAGDDGVITLKADG |
| Ga0302234_102393062 | 3300028773 | Palsa | VTDLTAQVTAALERSVLPSVIARGAAVRVAAAGDGIVTLE |
| Ga0307305_100021171 | 3300028807 | Soil | VSDLAAEVTAALGRSILPSVIARGAAGLRVVAAEDGVVT |
| Ga0307310_100950522 | 3300028824 | Soil | VSDLAAEVTAALGRSILPSVIARGAAGLRVVAAEDGVVTLA |
| Ga0307312_109981501 | 3300028828 | Soil | VMDLAGSVAAVLERSVLSSVIARGGGLRVAAVEDGVAILEV |
| Ga0311357_115630642 | 3300030524 | Palsa | VSDLVAEVTDALARSILPLVIARGAAGIRVLAAGDD |
| Ga0318516_100860051 | 3300031543 | Soil | VTDLTARVTAVLERSILPSVIARGALIRVAAAGGGIVTLE |
| Ga0318538_101393272 | 3300031546 | Soil | VTDLAAQVTAVLKRSVLPSVIARGGAVRVAAAGDG |
| Ga0318572_101089321 | 3300031681 | Soil | VTGLAAQVTAALERSVLPSVIARGGSVRVVAAGNGVVTLEV |
| Ga0306917_103219651 | 3300031719 | Soil | VTDLAAQVTAALERGILPSVIARGGAVRVAAVGAGV |
| Ga0318494_101639872 | 3300031751 | Soil | VTGPAAKVAAALEHSILPSVIARGAALRVVGVENG |
| Ga0318535_101239181 | 3300031764 | Soil | MTDLAAEVTAALGRSILPSVIARGAAALHVVAAEDGVVTLRADGSPGAVLPILG |
| Ga0318526_102493072 | 3300031769 | Soil | VTDLAAQVTAALQRSVLPSVIARGATLRVVAVDDGVATE |
| Ga0318521_101414712 | 3300031770 | Soil | VTDLTVRVTAVLERSILPSVIARGALIRVAAAGGGIVTLE |
| Ga0318546_106956222 | 3300031771 | Soil | VTGLAAQVTAALERSVMPSVIARGAAIRVATAEAGAVTL |
| Ga0318566_101530301 | 3300031779 | Soil | VTDLTARVTAVLERSILPSVIARGALIRVAGPRGGH |
| Ga0318547_100376713 | 3300031781 | Soil | VTDLAAQVTAALERGILPSVIARGGAVRVAAVGAGVVTLEV |
| Ga0318552_102881411 | 3300031782 | Soil | VSDLAAEVTAALGRSILPSVIARGAAGLRVVAAEDGVV |
| Ga0318503_101902241 | 3300031794 | Soil | VTDLAAQVTAALQRSVLPSVIARGATLRVVAVDDGVATVEVTG |
| Ga0318523_105993641 | 3300031798 | Soil | VTDLTARVTAVLERSILPSVIARGALIRVAAAGGGIVTLEVTGSPG |
| Ga0310917_103030222 | 3300031833 | Soil | VTDLAAQVTAVLKRSVLPSVIARGGAVRVAAAGDGVVTLEVT |
| Ga0318536_100822023 | 3300031893 | Soil | VTDLAAKVTAALQRSALPSVIARGAMLRVVAVQDGVAS |
| Ga0318536_101930251 | 3300031893 | Soil | VTGLAAQVTAALERSVMPSVIARGAAIRVATAEAGAVTLE |
| Ga0306923_101455021 | 3300031910 | Soil | VTDLAAQVTAALERGILPSVIARGGAVRVTAATDGVVTLEVTG |
| Ga0310910_114681031 | 3300031946 | Soil | VSDLAAEVTAALGRSILPSVIARGAATLRVVAAEDGVVTLQAD |
| Ga0310909_111468362 | 3300031947 | Soil | VTDLAAQVTAALERGVLPSVIARGGAVRVAAAGDGIVTLEVT |
| Ga0306926_101792194 | 3300031954 | Soil | VTDLTARVTAVLERSILPSVIARGALIRVAAAGGGIGNREVTGAPGA |
| Ga0318531_101605302 | 3300031981 | Soil | VTDLAAQVTAALERGILPSVIARGGAVRVAAVGGGVVTLEVTGSP |
| Ga0318562_102903161 | 3300032008 | Soil | VTGLAAQVTAALERSVMPSVIARGAAIRVATAEAGAV |
| Ga0318559_100282441 | 3300032039 | Soil | VTDLAAQVTAALERGILPSVIARGGAVRVAAVGAGVVTLE |
| Ga0318570_100768671 | 3300032054 | Soil | VSDLAARVTAALDRSVLPSVIARGAATLRVVGAEDGVITLQADG |
| Ga0318575_101806382 | 3300032055 | Soil | VSDLAARVTAALDRSVLPSVIARGAATLRVVGAEDGVITLQ |
| Ga0318510_102883782 | 3300032064 | Soil | VTDLAAQVTAALQRSVLPSVIARGGAVRVAAASDGMVT |
| Ga0318513_101876241 | 3300032065 | Soil | VTGLAAQVTAALERSVLPSVIARGGAVRVAAARNGV |
| Ga0318513_104140811 | 3300032065 | Soil | VSDLAAEVTAALGRSILPSVIARGAAGLRVVAAEDGVVTLAADGSP |
| Ga0318524_100186191 | 3300032067 | Soil | VTDLAAQVTAALQRSVLPSVIARGATLRVVAVDDGVATVE |
| Ga0318524_104056951 | 3300032067 | Soil | VTDLAAKVTAALQRSALPSVIARGAMLRVVAVQDGVASVE |
| Ga0318553_105013532 | 3300032068 | Soil | VSDLAAEVTAALGRSILPSVIARGAAGLRVVAAEDGVVTL |
| Ga0318518_103268602 | 3300032090 | Soil | VNDLAAEVTAVLERSILPSVIARGAAALHVVAAEDGVVT |
| Ga0318540_106053692 | 3300032094 | Soil | VNDLAAEVTAVLERSILPSVIARGAAALHVVAAEDGVVTLRADGSPGAD |
| Ga0307471_1031157771 | 3300032180 | Hardwood Forest Soil | VSDLAAEVTAALRRSILPSVIARGAAAIRVVAAEDGVVTLQADGSPGA |
| Ga0335080_102270511 | 3300032828 | Soil | VIDLATRVTAALERSVLPSVIARGGAIRVAAADAHGVV |
| Ga0335071_100445198 | 3300032897 | Soil | VSDLAAAVTAALARSILPSVIARGAAGIRVFAAGDDGVIPLEADGSPGAV |
| Ga0335084_114577212 | 3300033004 | Soil | VTDLAAKVTAALGRSILPSVIARGAATLRVVAAEDGVVTLQADGSPGAV |
| Ga0318519_102028342 | 3300033290 | Soil | VSDLAARVTAALDRSVLPSVIARGAATLRVVGAEDG |
| ⦗Top⦘ |