


| Basic Information | |
|---|---|
| Family ID | F080411 |
| Family Type | Metagenome |
| Number of Sequences | 115 |
| Average Sequence Length | 47 residues |
| Representative Sequence | RLNFYSKVRWRVPIDPTKHYFDSRFEIKTTVHKQAEWREKLAAAR |
| Number of Associated Samples | 100 |
| Number of Associated Scaffolds | 115 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 5.22 % |
| % of genes near scaffold ends (potentially truncated) | 73.04 % |
| % of genes from short scaffolds (< 2000 bps) | 90.43 % |
| Associated GOLD sequencing projects | 93 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.522 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (13.043 % of family members) |
| Environment Ontology (ENVO) | Unclassified (43.478 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (49.565 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.22% β-sheet: 0.00% Coil/Unstructured: 57.78% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 115 Family Scaffolds |
|---|---|---|
| PF01522 | Polysacc_deac_1 | 24.35 |
| PF08241 | Methyltransf_11 | 13.04 |
| PF04828 | GFA | 13.04 |
| PF07690 | MFS_1 | 6.96 |
| PF09084 | NMT1 | 2.61 |
| PF13489 | Methyltransf_23 | 2.61 |
| PF04255 | DUF433 | 0.87 |
| PF13416 | SBP_bac_8 | 0.87 |
| PF04014 | MazE_antitoxin | 0.87 |
| PF04909 | Amidohydro_2 | 0.87 |
| PF05016 | ParE_toxin | 0.87 |
| PF01797 | Y1_Tnp | 0.87 |
| PF13343 | SBP_bac_6 | 0.87 |
| PF00037 | Fer4 | 0.87 |
| PF01613 | Flavin_Reduct | 0.87 |
| PF03783 | CsgG | 0.87 |
| PF01850 | PIN | 0.87 |
| COG ID | Name | Functional Category | % Frequency in 115 Family Scaffolds |
|---|---|---|---|
| COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 24.35 |
| COG3791 | Uncharacterized conserved protein | Function unknown [S] | 13.04 |
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 2.61 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 2.61 |
| COG1462 | Curli biogenesis system outer membrane secretion channel CsgG | Cell wall/membrane/envelope biogenesis [M] | 0.87 |
| COG1853 | FMN reductase RutF, DIM6/NTAB family | Energy production and conversion [C] | 0.87 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.87 |
| COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 0.87 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.52 % |
| Unclassified | root | N/A | 3.48 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000550|F24TB_11290408 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300000789|JGI1027J11758_13032976 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 779 | Open in IMG/M |
| 3300000955|JGI1027J12803_101985951 | Not Available | 583 | Open in IMG/M |
| 3300004114|Ga0062593_100801083 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
| 3300004463|Ga0063356_102040432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 869 | Open in IMG/M |
| 3300005177|Ga0066690_10366687 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 977 | Open in IMG/M |
| 3300005178|Ga0066688_10349522 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 957 | Open in IMG/M |
| 3300005289|Ga0065704_10824864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 517 | Open in IMG/M |
| 3300005439|Ga0070711_101160740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 667 | Open in IMG/M |
| 3300005439|Ga0070711_101901730 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300005536|Ga0070697_100892232 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 789 | Open in IMG/M |
| 3300005536|Ga0070697_101077161 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 715 | Open in IMG/M |
| 3300005545|Ga0070695_100902171 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 714 | Open in IMG/M |
| 3300005553|Ga0066695_10774130 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300005617|Ga0068859_102745895 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300005836|Ga0074470_11771254 | All Organisms → cellular organisms → Bacteria | 3465 | Open in IMG/M |
| 3300005843|Ga0068860_100762457 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
| 3300006173|Ga0070716_100394047 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 994 | Open in IMG/M |
| 3300006804|Ga0079221_10095761 | All Organisms → cellular organisms → Bacteria | 1446 | Open in IMG/M |
| 3300006852|Ga0075433_10429633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1165 | Open in IMG/M |
| 3300006852|Ga0075433_11014491 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 723 | Open in IMG/M |
| 3300006854|Ga0075425_100205973 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2261 | Open in IMG/M |
| 3300006871|Ga0075434_101175389 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300006880|Ga0075429_101143902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 680 | Open in IMG/M |
| 3300006903|Ga0075426_10135186 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1776 | Open in IMG/M |
| 3300006903|Ga0075426_10176287 | All Organisms → cellular organisms → Bacteria | 1547 | Open in IMG/M |
| 3300006914|Ga0075436_100947550 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300007076|Ga0075435_100332234 | All Organisms → cellular organisms → Bacteria | 1302 | Open in IMG/M |
| 3300009094|Ga0111539_10664308 | All Organisms → cellular organisms → Bacteria | 1214 | Open in IMG/M |
| 3300009137|Ga0066709_101809580 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
| 3300009147|Ga0114129_11675704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 776 | Open in IMG/M |
| 3300009148|Ga0105243_11028777 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
| 3300009162|Ga0075423_10391822 | All Organisms → cellular organisms → Bacteria | 1458 | Open in IMG/M |
| 3300009162|Ga0075423_10622969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1137 | Open in IMG/M |
| 3300009162|Ga0075423_10854917 | All Organisms → cellular organisms → Bacteria | 963 | Open in IMG/M |
| 3300009162|Ga0075423_11415936 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300009167|Ga0113563_11029538 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
| 3300009176|Ga0105242_10238243 | All Organisms → cellular organisms → Bacteria | 1634 | Open in IMG/M |
| 3300009176|Ga0105242_13208295 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300009609|Ga0105347_1129179 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
| 3300009609|Ga0105347_1162752 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300009817|Ga0105062_1028008 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 975 | Open in IMG/M |
| 3300009821|Ga0105064_1018768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1267 | Open in IMG/M |
| 3300010326|Ga0134065_10471034 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300010360|Ga0126372_13170194 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300010362|Ga0126377_13307720 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 521 | Open in IMG/M |
| 3300010397|Ga0134124_11359378 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300010397|Ga0134124_12477985 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 561 | Open in IMG/M |
| 3300010398|Ga0126383_10227754 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1811 | Open in IMG/M |
| 3300010401|Ga0134121_11541240 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 681 | Open in IMG/M |
| 3300010401|Ga0134121_12491299 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300011435|Ga0137426_1052592 | All Organisms → cellular organisms → Bacteria | 1071 | Open in IMG/M |
| 3300011437|Ga0137429_1044538 | All Organisms → cellular organisms → Bacteria | 1292 | Open in IMG/M |
| 3300011439|Ga0137432_1266891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 549 | Open in IMG/M |
| 3300012200|Ga0137382_10343174 | All Organisms → cellular organisms → Bacteria | 1047 | Open in IMG/M |
| 3300012201|Ga0137365_11340308 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 506 | Open in IMG/M |
| 3300012208|Ga0137376_10067127 | All Organisms → cellular organisms → Bacteria | 2974 | Open in IMG/M |
| 3300012359|Ga0137385_10407592 | All Organisms → cellular organisms → Bacteria | 1158 | Open in IMG/M |
| 3300012685|Ga0137397_10097637 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_61_28 | 2151 | Open in IMG/M |
| 3300012922|Ga0137394_10122258 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_61_28 | 2204 | Open in IMG/M |
| 3300012923|Ga0137359_10017417 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6065 | Open in IMG/M |
| 3300012924|Ga0137413_10709916 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 764 | Open in IMG/M |
| 3300012925|Ga0137419_11216590 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300012944|Ga0137410_10047483 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3049 | Open in IMG/M |
| 3300012986|Ga0164304_10246759 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_61_28 | 1195 | Open in IMG/M |
| 3300014880|Ga0180082_1046163 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_61_28 | 923 | Open in IMG/M |
| 3300015241|Ga0137418_10097549 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_61_28 | 2647 | Open in IMG/M |
| 3300015242|Ga0137412_10163838 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_61_28 | 1789 | Open in IMG/M |
| 3300015245|Ga0137409_10038277 | All Organisms → cellular organisms → Bacteria | 4617 | Open in IMG/M |
| 3300015371|Ga0132258_12330067 | All Organisms → cellular organisms → Bacteria | 1342 | Open in IMG/M |
| 3300015371|Ga0132258_13430764 | All Organisms → cellular organisms → Bacteria | 1087 | Open in IMG/M |
| 3300015374|Ga0132255_101020513 | All Organisms → cellular organisms → Bacteria | 1241 | Open in IMG/M |
| 3300015374|Ga0132255_105829309 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300017656|Ga0134112_10099646 | All Organisms → cellular organisms → Bacteria | 1091 | Open in IMG/M |
| 3300017792|Ga0163161_11453924 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 600 | Open in IMG/M |
| 3300018061|Ga0184619_10493565 | Not Available | 541 | Open in IMG/M |
| 3300018074|Ga0184640_10149984 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1039 | Open in IMG/M |
| 3300018084|Ga0184629_10534104 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300018466|Ga0190268_11841807 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300019879|Ga0193723_1028732 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1681 | Open in IMG/M |
| 3300019881|Ga0193707_1090663 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
| 3300020003|Ga0193739_1060961 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
| 3300020006|Ga0193735_1010013 | All Organisms → cellular organisms → Bacteria | 2985 | Open in IMG/M |
| 3300020018|Ga0193721_1024217 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_61_28 | 1605 | Open in IMG/M |
| 3300021081|Ga0210379_10211510 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300021344|Ga0193719_10162458 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_61_28 | 961 | Open in IMG/M |
| 3300022534|Ga0224452_1106661 | Not Available | 858 | Open in IMG/M |
| 3300022534|Ga0224452_1138994 | Not Available | 748 | Open in IMG/M |
| 3300022883|Ga0247786_1141975 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300025315|Ga0207697_10108529 | All Organisms → cellular organisms → Bacteria | 1188 | Open in IMG/M |
| 3300025934|Ga0207686_11485610 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 558 | Open in IMG/M |
| 3300025935|Ga0207709_11757062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 516 | Open in IMG/M |
| 3300025937|Ga0207669_10997278 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 704 | Open in IMG/M |
| 3300026023|Ga0207677_11084863 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300026089|Ga0207648_10421756 | All Organisms → cellular organisms → Bacteria | 1212 | Open in IMG/M |
| 3300026118|Ga0207675_100950581 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 877 | Open in IMG/M |
| 3300026118|Ga0207675_102402629 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300027722|Ga0209819_10056485 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1350 | Open in IMG/M |
| 3300027821|Ga0209811_10008083 | All Organisms → cellular organisms → Bacteria | 3371 | Open in IMG/M |
| 3300027956|Ga0209820_1018557 | All Organisms → cellular organisms → Bacteria | 1765 | Open in IMG/M |
| 3300028380|Ga0268265_12152435 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300028536|Ga0137415_10690340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 833 | Open in IMG/M |
| 3300028807|Ga0307305_10239182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 831 | Open in IMG/M |
| 3300031170|Ga0307498_10024130 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_61_28 | 1426 | Open in IMG/M |
| 3300031199|Ga0307495_10116388 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300031716|Ga0310813_10640087 | All Organisms → cellular organisms → Bacteria | 944 | Open in IMG/M |
| 3300031740|Ga0307468_100164422 | All Organisms → cellular organisms → Bacteria | 1448 | Open in IMG/M |
| 3300031912|Ga0306921_10513180 | All Organisms → cellular organisms → Bacteria | 1393 | Open in IMG/M |
| 3300032122|Ga0310895_10151775 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
| 3300032174|Ga0307470_10187539 | All Organisms → cellular organisms → Bacteria | 1308 | Open in IMG/M |
| 3300032421|Ga0310812_10437044 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300033412|Ga0310810_10543854 | All Organisms → cellular organisms → Bacteria | 1137 | Open in IMG/M |
| 3300033419|Ga0316601_100559816 | All Organisms → cellular organisms → Bacteria | 1106 | Open in IMG/M |
| 3300033482|Ga0316627_100999516 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300034894|Ga0373916_0017849 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 864 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 13.04% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 12.17% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 12.17% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 5.22% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.22% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.35% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.35% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 4.35% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.48% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.48% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.61% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.61% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.74% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.74% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.74% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.74% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.74% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.74% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.74% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.87% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.87% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.87% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.87% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.87% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.87% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.87% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.87% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.87% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.87% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.87% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.87% |
| Sediment Slurry | Engineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry | 0.87% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009609 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 | Environmental | Open in IMG/M |
| 3300009817 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 | Environmental | Open in IMG/M |
| 3300009821 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011435 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT660_2 | Environmental | Open in IMG/M |
| 3300011437 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT736_2 | Environmental | Open in IMG/M |
| 3300011439 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT820_2 | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300014880 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_16_10D | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
| 3300020003 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2 | Environmental | Open in IMG/M |
| 3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
| 3300020018 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2 | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
| 3300022883 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S066-202C-4 | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027722 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027956 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031199 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033419 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT | Environmental | Open in IMG/M |
| 3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
| 3300034894 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A1A0.2 | Engineered | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F24TB_112904082 | 3300000550 | Soil | ENFLRLNFYSKVRWRLPIDPTKHYFDSKFEIKTTVHKQAEWRDKLAAAR* |
| JGI1027J11758_130329762 | 3300000789 | Soil | ENFLRLNFYSKLRWRVPIDLTAHVINSKFEVTTTVHKQAEWRKKLAAAS* |
| JGI1027J12803_1019859512 | 3300000955 | Soil | VRWHVPIDPTKHYFDSKFEIKTTVHKQAEWREKLAAAR* |
| Ga0062593_1008010832 | 3300004114 | Soil | RLNFYSKVRWRVPIDPTKHYFESRFEIKTTVHKPAEWREKLAAAR* |
| Ga0063356_1020404321 | 3300004463 | Arabidopsis Thaliana Rhizosphere | PPEDENFLRLNFYSKVRWRVPIDPTKHYFDSRFEIKSTVHKQAEWREKLAAAR* |
| Ga0066690_103666872 | 3300005177 | Soil | MSGPDHVPFYSKVRRPVPIDPTRHYFDSRFDIKTTVYKQAEWKEKLTAAR* |
| Ga0066688_103495221 | 3300005178 | Soil | MSDPDHVPFYSKVRRRVPIDPTRHYFDSRFDIKTTVHKQAEWKEKLTAAR* |
| Ga0065704_108248642 | 3300005289 | Switchgrass Rhizosphere | EDENFLRLNFYSKVRWHVPIDPTRHYFDSRFEIKTTVHKQAEWREKLAAAR* |
| Ga0070711_1011607401 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MSGPDHVPFYSKVRRRVPIDPTRHYFDSRFDIKTTVYKQAEWKEKLTVAR* |
| Ga0070711_1019017301 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | NFYSKVRWRVPIDPTKHYFDSRFEIKTTVHKPAEWREKLAAAR* |
| Ga0070697_1008922321 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | ENFLRLNFYSKVRWRVPIDPTKHYFDSEFEIKTTVHKQAEWREKLAAAR* |
| Ga0070697_1010771612 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | SKVRRRVPIDPTRHYFDSRFDIKTTVYKQAEWKEKLTAAR* |
| Ga0070695_1009021711 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | ENFLRLNFYSKVRWRVAIDPTKHYFDSKFEIKTAVHKQAEWREKLAAAR* |
| Ga0066695_107741301 | 3300005553 | Soil | YSKVRWRVPIDPTKHYFDSKFEIKTTVHKQAEWRKNLAAAR* |
| Ga0068859_1027458951 | 3300005617 | Switchgrass Rhizosphere | PEDENFLRLNFYSKVRWRVPIDPTKHYFESRFEIKTTVHKPAEWRKKLAVAR* |
| Ga0074470_117712548 | 3300005836 | Sediment (Intertidal) | FLRLNFYSKLRWRVPMDPTKHYFNSKFEIATTVHKQAQWREQLAAAR* |
| Ga0068860_1007624572 | 3300005843 | Switchgrass Rhizosphere | MSDPDHVPFYSKVRRRVPIDPTKHYFDSKFEVKTTVHKQAEWKEK |
| Ga0070716_1003940471 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | DENFLRLNFYSKVRWRVPIDPTKHYFDSKFEIKTTVHKQAEWREKLAAAR* |
| Ga0079221_100957611 | 3300006804 | Agricultural Soil | SKVRWRVPIDPSQHCFESRFEIKTTVHKRAEWRQKLAAAR* |
| Ga0075433_104296331 | 3300006852 | Populus Rhizosphere | RWRVPIDPTRHYFDSKFEIKTTVHKQAEWREKLAAAR* |
| Ga0075433_110144912 | 3300006852 | Populus Rhizosphere | MSGPDHVPFYSKVRRRVPIDPTRHYFDSRFDIKTTVYKQAEWKEKLTAAR* |
| Ga0075425_1002059732 | 3300006854 | Populus Rhizosphere | MSGPDHVPFYSKVRLRVPIDPTRHYFDSRFDIKTTVYKQAEWKEKLTAAR* |
| Ga0075434_1011753891 | 3300006871 | Populus Rhizosphere | RWHVPLDPTRHYFDSKFEIKTTVHKQAEWRKNLAAAR* |
| Ga0075429_1011439021 | 3300006880 | Populus Rhizosphere | EDENFLRLNFYSKVRWHVPIDPTKHYFDSKFEIKTTVHKQAEWREKLAAAR* |
| Ga0075426_101351862 | 3300006903 | Populus Rhizosphere | MSDPDHVPFYSKVRRRVPIDPTRHYFDSRFDIKTTVYKQAEWKEKLTAAR* |
| Ga0075426_101762873 | 3300006903 | Populus Rhizosphere | NFYSKVRWRVPIDPTKHYFDSRFEIKTTVHKPAEWREHLAAPR* |
| Ga0075436_1009475501 | 3300006914 | Populus Rhizosphere | PEDENFLRLNFYSKVRWHVPIDPTRHYFDSRFEIKTTVHKQAEWRKNLAAAR* |
| Ga0075435_1003322342 | 3300007076 | Populus Rhizosphere | MSDPDHVPFYSKVRRRVPIDPTKHYFDSKFEIKTTVHKQA |
| Ga0111539_106643081 | 3300009094 | Populus Rhizosphere | MSGPDHVPFYSKVRRRVPIDPTRHYFDSRFDIKTTVHKQAEWKEKLTATR* |
| Ga0066709_1018095802 | 3300009137 | Grasslands Soil | MSGPDHVPFYSKVRRRVPIDPTRHYFDSRFDIKTTVHKQAEWKEKLTAAR* |
| Ga0114129_116757042 | 3300009147 | Populus Rhizosphere | MSGPDHVPFYSKVRRRVPIDPTRHYFDSRFDIKTTVCKQAEWKEKLTAAR* |
| Ga0105243_110287771 | 3300009148 | Miscanthus Rhizosphere | MSDPDHVPFYSKVRRRVPIDPTKHYFDSKFEIKTTVHKQAEWKEKLTATR* |
| Ga0075423_103918221 | 3300009162 | Populus Rhizosphere | FLRLNFYSKVRWQVPLDPTRHYFDSKFEIKTTVHKQAEWRKNLAAAR* |
| Ga0075423_106229692 | 3300009162 | Populus Rhizosphere | MSDPDHVPFYSKVRRRVPIDPTRHYFDSRFDIKTIVYKQAEWKEKLTAAR* |
| Ga0075423_108549172 | 3300009162 | Populus Rhizosphere | ENFLRLNFYSKVRWRLPIDPTKHYFDSKFEIKTTVHKQAEWREKLAAAR* |
| Ga0075423_114159361 | 3300009162 | Populus Rhizosphere | NFLRLNFYSKVRWHVPIDPTRHYFDSRFEIKTTVHKQAEWRKNLAAAR* |
| Ga0113563_110295381 | 3300009167 | Freshwater Wetlands | EDENFLRLNFYSKVRWRVPIDPTKHYFDSKFEIKTTVHKQAEWREKLAAAR* |
| Ga0105242_102382431 | 3300009176 | Miscanthus Rhizosphere | MSDPDHVPFYSKVRRRVSIDPTRHYFDSRFDIKTT |
| Ga0105242_132082951 | 3300009176 | Miscanthus Rhizosphere | MSDPDHVPFYSKVRRRVPIDPTKHYFDSKFEVKTTVHKQAEWREKLAAAR* |
| Ga0105347_11291792 | 3300009609 | Soil | LRLNFYSKVRWRVPIDPTRHYFDSKFEIKSMVHKQAEWREKLAAAR* |
| Ga0105347_11627522 | 3300009609 | Soil | VPIDPTRHYFDSRFEIKTTVHKQAEWREQLAAAR* |
| Ga0105062_10280081 | 3300009817 | Groundwater Sand | DENFLRLNFYSKLRWRVPINPTEHAFDSKFEVTTTVHKQAEWRKKMAAAG* |
| Ga0105064_10187684 | 3300009821 | Groundwater Sand | YSKLRWRVPIDPTEHAFDSKFEVTTTVHKQAEWRKKMAAAGGPGRWV* |
| Ga0134065_104710342 | 3300010326 | Grasslands Soil | MSDPDHVPFYSKVRRRVPIDPTRHYFDSRFDIKTTM |
| Ga0126372_131701941 | 3300010360 | Tropical Forest Soil | SKVRWRVPIDPTRHYFDSKFEIKTTVHKQAEWRKNLAAAR* |
| Ga0126377_133077201 | 3300010362 | Tropical Forest Soil | DENFLRLNFYSKLRWRVPINPTEHAFDSKFEVTTTVHKQAEWRKKMAATG* |
| Ga0134124_113593782 | 3300010397 | Terrestrial Soil | FLRLNFYSKVRWRVPIDPTKHYFDSRFEIKTTVHKPAEWREHLAHRGDNANE* |
| Ga0134124_124779852 | 3300010397 | Terrestrial Soil | EDESFLRLNFYSKVRWNVPMDPTRHYFDSKFEIKTTLHKQAEWREKLAAAR* |
| Ga0126383_102277543 | 3300010398 | Tropical Forest Soil | ENFLRLNFYSKLRWRVPINPTEHAFDSKFEVTTTLHKQAEWRKKMAATR* |
| Ga0134121_115412402 | 3300010401 | Terrestrial Soil | YSKVRWRVAIDPTKHYFDSKFEIKTAVHKQAEWREKLAAAR* |
| Ga0134121_124912991 | 3300010401 | Terrestrial Soil | KVRWRVPIDPTKHYFDSRFEIKTTVHKPAEWREKLAVAR* |
| Ga0137426_10525922 | 3300011435 | Soil | NFYSKGRWRVPIDPTKHYFDSKFEIKTTVHKHAEWREKLAAAR* |
| Ga0137429_10445381 | 3300011437 | Soil | VRWRVPIDPTKHYFDSRFEIKTTVHKQAEWREKLAAAR* |
| Ga0137432_12668911 | 3300011439 | Soil | VRWRVPIDPTKHYFDSRFEIKTTVHKQAAWREKLAAAR* |
| Ga0137382_103431742 | 3300012200 | Vadose Zone Soil | MSGPDHVPFYSKVRRRVPIDPTRHYFDSRFDIKTTVHKQAEWKEKLPAAR* |
| Ga0137365_113403082 | 3300012201 | Vadose Zone Soil | LRLNFYSKVRWRVPIDPTKRYFDSKFGIKTTVHKQAEWREKLAPAR* |
| Ga0137376_100671274 | 3300012208 | Vadose Zone Soil | MSDPDHVPFYSKVRRRVPIDPTRHYFDSRFEIKTTVHKQAEWKEKLPAAR* |
| Ga0137385_104075921 | 3300012359 | Vadose Zone Soil | VRWRVPIDPTKHYFDSKFEIKTTVHKQAEWREKLAAAR* |
| Ga0137397_100976373 | 3300012685 | Vadose Zone Soil | MSGPDHVPFYSKVRRRVPIDPTRHYFDSSFDIKTTVHKQAEWKEKLTAAR* |
| Ga0137394_101222582 | 3300012922 | Vadose Zone Soil | MSDSDHVPFYSKVRRRVPIDPTRHYFDSRFDIKTTVHKQAEWKEKLTAAR* |
| Ga0137359_100174172 | 3300012923 | Vadose Zone Soil | MSGPDHVPFYSKVRRRVPIDPTRHYFDSRFEIKTTVHKQAEWKEKLTAAR* |
| Ga0137413_107099162 | 3300012924 | Vadose Zone Soil | LANGKIVVSVMSRPDHVPFYSKVRRRVPIDPTKHYFDSKFEIKTTVHKQAEWKEKLTAPR |
| Ga0137419_112165902 | 3300012925 | Vadose Zone Soil | MSDPDHVPFYSKVRRRVPIDPTKHYFDSKFEIKTTVHKQAEWKEKL |
| Ga0137410_100474835 | 3300012944 | Vadose Zone Soil | MSDPDHVPFYSKVRRRVPIDPTRHYFDSRFEIKTTVHKQAEWKEKLTAAR* |
| Ga0164304_102467592 | 3300012986 | Soil | SDMCPVMSDLDHVPFYSKVCRRVPIDPTRHYFDSRFDIKTTMHKQAEWKEKLTAAR* |
| Ga0180082_10461632 | 3300014880 | Soil | GSKVRWRVPIDPTKHYFDSKFEIKTTVHKQAEWREKLVATR* |
| Ga0137418_100975492 | 3300015241 | Vadose Zone Soil | MSDPDHFPFYSKVRRRVPIDPTRHYFDSRFDIKTTVHKQAEWKEKLTAAR* |
| Ga0137412_101638382 | 3300015242 | Vadose Zone Soil | MCDSDHVPFYSKVRRRVPIDPTKHYFDSKFEIKTTVHKQAEWKEKLTAPR* |
| Ga0137409_100382775 | 3300015245 | Vadose Zone Soil | MSDSDHVPFYSKVRRRVPIDPTRHYFDSRFEIKTTVHKQAEWKEKLTAAR* |
| Ga0132258_123300671 | 3300015371 | Arabidopsis Rhizosphere | DENFLRLNFYSKVRWRVPIDPTKHYFDSRFEIKTTVHKPAQWREKLTAAR* |
| Ga0132258_134307641 | 3300015371 | Arabidopsis Rhizosphere | PPEDENFLRLNFYSKVRWRVPIDPTKHYFDSRFEIKTTVHKPAEWRENLAVAR* |
| Ga0132255_1010205133 | 3300015374 | Arabidopsis Rhizosphere | SKVRWRVPIDPTKHYFDSRFEIKTTVHKPAEWREKLAVAR* |
| Ga0132255_1058293092 | 3300015374 | Arabidopsis Rhizosphere | RLNFYSKVRWRVPIDPTKHYFDSRFEIKTTVHKPAEWRENLAVAR* |
| Ga0134112_100996461 | 3300017656 | Grasslands Soil | LNFYSKVRWRVPIDPTKHYFDSKFEIKTTVHKQAEWRKNLAAAR |
| Ga0163161_114539242 | 3300017792 | Switchgrass Rhizosphere | MSDPDHVPFYSKVRRRVPIDPTRHYFDSRFDIKTTVHKQAEWKEKLTATR |
| Ga0184619_104935651 | 3300018061 | Groundwater Sediment | FLRLNFYSKVRWRVPIDPTKHYFDSKFEIKTTVHKQAEWREKLAAAR |
| Ga0184640_101499842 | 3300018074 | Groundwater Sediment | MSDTDHVPFYSKVRRRVPIDPTKHYFDRKFEIKTTVQKQAEWKEKLTVAR |
| Ga0184629_105341042 | 3300018084 | Groundwater Sediment | RLNFYSKVRWRVPIDPTKHYFDSRFEIKTTVHKQAEWREKLAAAR |
| Ga0190268_118418072 | 3300018466 | Soil | WRVPIDPTRHYFDSRFEIKTTVHKQAEWREKLAAAR |
| Ga0193723_10287321 | 3300019879 | Soil | RRRVPIDPTRHYFDSRFDIKTTVYKQAEWKEKLTAAR |
| Ga0193707_10906632 | 3300019881 | Soil | MSGPDHVPFYSKVRRRVPIDPTRHYFDSRFDIKTTVYKQA |
| Ga0193739_10609612 | 3300020003 | Soil | RLNFYSKIRWRVPIDPTKHYFDSRFEIKTTLHKQAEWREKLAAAR |
| Ga0193735_10100132 | 3300020006 | Soil | MSGPDHVPFYSKVRRRVPIDPTRHYFDSRFEIKTTCTKQAEWKEKLTAAR |
| Ga0193721_10242172 | 3300020018 | Soil | MSGPDHVPFYSKVRRRVPIDPTRHYFDSRFDIKTTVHKQAEWKEKLTAAR |
| Ga0210379_102115102 | 3300021081 | Groundwater Sediment | NFYSKVRWRVPIDPTRHYFDSKFEIKTTVHKQAEWREKLAAAR |
| Ga0193719_101624582 | 3300021344 | Soil | RVPIDPTRHYFDSRFDIKTTVYKQAEWKEKLTAAR |
| Ga0224452_11066613 | 3300022534 | Groundwater Sediment | EDFLRLNFYSKVRWRVPIDPTKHYFDSKFEIKTTVHKQAEWREKLAAAR |
| Ga0224452_11389941 | 3300022534 | Groundwater Sediment | AANFYSKVRWRVPIDPTKHYFDSKFEIKTTVHKQAEWRKNLTATR |
| Ga0247786_11419752 | 3300022883 | Soil | NFLRLNFYSKVRWRVPIDPSKHCFESRFEIKTTVHKRAEWREKLAAAR |
| Ga0207697_101085292 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDPDHVPFYSKVRRRVPIDPTRHYFDSRFDIKTTVHKQAEWKEKLTAAR |
| Ga0207686_114856101 | 3300025934 | Miscanthus Rhizosphere | MSDPDHVPFYSKVRRRVPIDPTRHYFDSKFEIKTTVHKQAEWREKLAAAR |
| Ga0207709_117570621 | 3300025935 | Miscanthus Rhizosphere | HVPFYSKVRRRVPIDPTKHYFDSKFEIKTTVHKQAEWKEKLTATR |
| Ga0207669_109972782 | 3300025937 | Miscanthus Rhizosphere | SSLANAKIVVSVMSDPDHVPVYSKVRRRVPIDPTRHYFDSRFDIKTTVHKQAEWKEKLTAAR |
| Ga0207677_110848631 | 3300026023 | Miscanthus Rhizosphere | FYSKVRWRVPIDPSKHCFESRFEIKTTVHKRAEWREKLAAAQ |
| Ga0207648_104217561 | 3300026089 | Miscanthus Rhizosphere | NFYSKVRWRVPIDPSKHCFESRFEIKTTVHKRAEWREKLAAAR |
| Ga0207675_1009505812 | 3300026118 | Switchgrass Rhizosphere | MSDPDHVPFYSKVRRRVSIDPTRHYFDSRFDIKTTVHKQAEWKEKLTATR |
| Ga0207675_1024026292 | 3300026118 | Switchgrass Rhizosphere | EDENFLRLNFYSKVRWRLPIDPTKHYFDSKFEIKTTVHKQAEWREKLAAAR |
| Ga0209819_100564853 | 3300027722 | Freshwater Sediment | NFYSKLRWRVPINPTEHAFDSKFEVTTTVHKQAEWRKQMAAAG |
| Ga0209811_100080835 | 3300027821 | Surface Soil | MSDPDHVPFYSKVRRRVPIDPTKHYFDSKFEIKTTVHKQAEWREKLAAAR |
| Ga0209820_10185575 | 3300027956 | Freshwater Sediment | NFLRLNFYSKLRWRVPINPTEHAFDSKFEVTTTVHKQAEWRKKMAAAG |
| Ga0268265_121524352 | 3300028380 | Switchgrass Rhizosphere | NFYSKVRWRLPIDPTKHYFDSKFEIKTTVHKQAEWREKLAAAR |
| Ga0137415_106903402 | 3300028536 | Vadose Zone Soil | SLANEKIVVSVMSDPDHVPFYSKVRRRVPIDPTRHYFDSRFEIKTTVHKQAEWKEKLTAA |
| Ga0307305_102391822 | 3300028807 | Soil | LASVSSLANGKIVVSVMSGPDHVPFYSKVRRRVPIDPTRHYFDSRFDIKTTVYKQAEWKEKLTAAR |
| Ga0307498_100241302 | 3300031170 | Soil | MSDTDHVPFYSKVRRRVPIDPTKHYFDSKFEIKTTVHKQAEWKEKLTAAR |
| Ga0307495_101163881 | 3300031199 | Soil | MSDTDHVPFYSKVRRRVPIDPTRHYFDSRFEIKTTMHKQVEWKEK |
| Ga0310813_106400872 | 3300031716 | Soil | FYSKVRWRVPIDPTKHYFDSRFEIKTTVHKPAEWREHLAAPR |
| Ga0307468_1001644222 | 3300031740 | Hardwood Forest Soil | MSDPAHVPFYSKVRRRVPIDPTRHYFDSRFDIKTTVHKQAEWKEKLTAAR |
| Ga0306921_105131801 | 3300031912 | Soil | NFLRLNFYSKVRWRVPIDPTKHYFDSKFEIKTTVHKQAEWREKLAAVR |
| Ga0310895_101517752 | 3300032122 | Soil | ENFLRLNFYSKVRWRVPIDPTKHYFESRFEIKTTVHKPAEWREKLAAAR |
| Ga0307470_101875392 | 3300032174 | Hardwood Forest Soil | MSDPDHVPFYSKVRRRVPIDPTKHYFDSKFEIKTTVHKQAEWKEKLTATR |
| Ga0310812_104370441 | 3300032421 | Soil | SKVRWRVPIDPSKHCFESRFEIKTTVHKRAEWREKLAAAR |
| Ga0310810_105438541 | 3300033412 | Soil | KVRWRVPIDPSKHCFESRFEIKTTVHKRAEWREKLAAAR |
| Ga0316601_1005598162 | 3300033419 | Soil | YSKVRWRVPIDPTKHYFDSKFEIKTTVHKQAEWREKLAAAR |
| Ga0316627_1009995161 | 3300033482 | Soil | LNFYSKVRWRVPIDPTKHYFDSKFEITTTVHKRAEWREKLAAAR |
| Ga0373916_0017849_716_862 | 3300034894 | Sediment Slurry | NFLRLNFYSKIRWRVPIDPTRHYFDSRFEIKTTVHKQAEWREKLAAAR |
| ⦗Top⦘ |