


| Basic Information | |
|---|---|
| Family ID | F080384 |
| Family Type | Metagenome |
| Number of Sequences | 115 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MAKNGQWQLSAEAAELYERYVARYILGPWAPLLVDAA |
| Number of Associated Samples | 105 |
| Number of Associated Scaffolds | 115 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 71.30 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 93.91 % |
| Associated GOLD sequencing projects | 104 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.34 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (91.304 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (9.565 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.565 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (43.478 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.92% β-sheet: 0.00% Coil/Unstructured: 63.08% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 115 Family Scaffolds |
|---|---|---|
| PF01614 | IclR | 34.78 |
| PF09339 | HTH_IclR | 26.09 |
| PF01717 | Meth_synt_2 | 13.04 |
| PF04392 | ABC_sub_bind | 1.74 |
| PF13302 | Acetyltransf_3 | 1.74 |
| PF03401 | TctC | 0.87 |
| PF01557 | FAA_hydrolase | 0.87 |
| PF02540 | NAD_synthase | 0.87 |
| PF00589 | Phage_integrase | 0.87 |
| PF03446 | NAD_binding_2 | 0.87 |
| PF03372 | Exo_endo_phos | 0.87 |
| PF08471 | Ribonuc_red_2_N | 0.87 |
| PF01970 | TctA | 0.87 |
| PF03989 | DNA_gyraseA_C | 0.87 |
| PF01810 | LysE | 0.87 |
| PF13340 | DUF4096 | 0.87 |
| PF02281 | Dimer_Tnp_Tn5 | 0.87 |
| PF12833 | HTH_18 | 0.87 |
| PF03061 | 4HBT | 0.87 |
| COG ID | Name | Functional Category | % Frequency in 115 Family Scaffolds |
|---|---|---|---|
| COG1414 | DNA-binding transcriptional regulator, IclR family | Transcription [K] | 34.78 |
| COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 13.04 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 1.74 |
| COG0171 | NH3-dependent NAD+ synthetase | Coenzyme transport and metabolism [H] | 0.87 |
| COG0188 | DNA gyrase/topoisomerase IV, subunit A | Replication, recombination and repair [L] | 0.87 |
| COG0209 | Ribonucleotide reductase alpha subunit | Nucleotide transport and metabolism [F] | 0.87 |
| COG1784 | TctA family transporter | General function prediction only [R] | 0.87 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.87 |
| COG3333 | TctA family transporter | General function prediction only [R] | 0.87 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 91.30 % |
| Unclassified | root | N/A | 8.70 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090014|GPIPI_17191485 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. | 1712 | Open in IMG/M |
| 2170459010|GIO7OMY01EGH1P | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 504 | Open in IMG/M |
| 3300001545|JGI12630J15595_10041888 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 927 | Open in IMG/M |
| 3300001661|JGI12053J15887_10243748 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 896 | Open in IMG/M |
| 3300002128|JGI24036J26619_10044474 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 859 | Open in IMG/M |
| 3300004062|Ga0055500_10023622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1109 | Open in IMG/M |
| 3300004268|Ga0066398_10048371 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
| 3300005093|Ga0062594_100454353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1062 | Open in IMG/M |
| 3300005093|Ga0062594_102349215 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300005334|Ga0068869_101344350 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300005451|Ga0066681_10074398 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1903 | Open in IMG/M |
| 3300005530|Ga0070679_100877245 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
| 3300005530|Ga0070679_102144168 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 508 | Open in IMG/M |
| 3300005539|Ga0068853_102276375 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 525 | Open in IMG/M |
| 3300005578|Ga0068854_101526111 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300005598|Ga0066706_10694867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 808 | Open in IMG/M |
| 3300005713|Ga0066905_100563461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 958 | Open in IMG/M |
| 3300005713|Ga0066905_100667455 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
| 3300005841|Ga0068863_101338372 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300005843|Ga0068860_101107500 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300005879|Ga0075295_1034215 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 645 | Open in IMG/M |
| 3300005937|Ga0081455_10312032 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1124 | Open in IMG/M |
| 3300006028|Ga0070717_11243952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 677 | Open in IMG/M |
| 3300006173|Ga0070716_101073756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 641 | Open in IMG/M |
| 3300006755|Ga0079222_12274969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 540 | Open in IMG/M |
| 3300006844|Ga0075428_102612535 | Not Available | 516 | Open in IMG/M |
| 3300006847|Ga0075431_100544019 | All Organisms → cellular organisms → Bacteria | 1149 | Open in IMG/M |
| 3300006854|Ga0075425_100189966 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2359 | Open in IMG/M |
| 3300006854|Ga0075425_101361050 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300006854|Ga0075425_102068261 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300007076|Ga0075435_100275923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1435 | Open in IMG/M |
| 3300007788|Ga0099795_10243881 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 773 | Open in IMG/M |
| 3300009038|Ga0099829_10352393 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1212 | Open in IMG/M |
| 3300009094|Ga0111539_11979277 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300009094|Ga0111539_12559878 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 592 | Open in IMG/M |
| 3300009098|Ga0105245_11210772 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 803 | Open in IMG/M |
| 3300009137|Ga0066709_103104067 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 607 | Open in IMG/M |
| 3300009156|Ga0111538_10491113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1556 | Open in IMG/M |
| 3300009156|Ga0111538_12227635 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300009792|Ga0126374_10094416 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1678 | Open in IMG/M |
| 3300010039|Ga0126309_10904688 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 585 | Open in IMG/M |
| 3300010043|Ga0126380_11100374 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 677 | Open in IMG/M |
| 3300010045|Ga0126311_11320849 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 600 | Open in IMG/M |
| 3300010358|Ga0126370_11464016 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300010359|Ga0126376_10117726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2066 | Open in IMG/M |
| 3300010359|Ga0126376_11515984 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 700 | Open in IMG/M |
| 3300010360|Ga0126372_12797800 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 540 | Open in IMG/M |
| 3300010362|Ga0126377_11853355 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300010403|Ga0134123_13604688 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 502 | Open in IMG/M |
| 3300012096|Ga0137389_10690939 | Not Available | 877 | Open in IMG/M |
| 3300012205|Ga0137362_10552160 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 995 | Open in IMG/M |
| 3300012207|Ga0137381_10960951 | Not Available | 737 | Open in IMG/M |
| 3300012350|Ga0137372_10762565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 696 | Open in IMG/M |
| 3300012363|Ga0137390_11942638 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300012901|Ga0157288_10025611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae | 1177 | Open in IMG/M |
| 3300012907|Ga0157283_10068805 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 867 | Open in IMG/M |
| 3300012929|Ga0137404_11714425 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 584 | Open in IMG/M |
| 3300012975|Ga0134110_10321284 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 672 | Open in IMG/M |
| 3300013096|Ga0157307_1150088 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300013100|Ga0157373_10362232 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1035 | Open in IMG/M |
| 3300013102|Ga0157371_11423992 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300013306|Ga0163162_12551015 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 588 | Open in IMG/M |
| 3300013308|Ga0157375_11757878 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 735 | Open in IMG/M |
| 3300014745|Ga0157377_11750802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 503 | Open in IMG/M |
| 3300015245|Ga0137409_10167748 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 1998 | Open in IMG/M |
| 3300015371|Ga0132258_13450307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1084 | Open in IMG/M |
| 3300015373|Ga0132257_100145712 | All Organisms → cellular organisms → Bacteria | 2770 | Open in IMG/M |
| 3300016319|Ga0182033_11169529 | Not Available | 688 | Open in IMG/M |
| 3300017657|Ga0134074_1310589 | Not Available | 576 | Open in IMG/M |
| 3300018066|Ga0184617_1108364 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 783 | Open in IMG/M |
| 3300018083|Ga0184628_10599346 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 558 | Open in IMG/M |
| 3300018468|Ga0066662_10795930 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 916 | Open in IMG/M |
| 3300019361|Ga0173482_10129900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 955 | Open in IMG/M |
| 3300021086|Ga0179596_10719040 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300021478|Ga0210402_10564301 | Not Available | 1056 | Open in IMG/M |
| 3300022737|Ga0247747_1047662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 533 | Open in IMG/M |
| 3300025904|Ga0207647_10146124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1384 | Open in IMG/M |
| 3300025905|Ga0207685_10500586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 639 | Open in IMG/M |
| 3300025907|Ga0207645_10466065 | Not Available | 853 | Open in IMG/M |
| 3300025918|Ga0207662_10324696 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1028 | Open in IMG/M |
| 3300025923|Ga0207681_11006992 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 699 | Open in IMG/M |
| 3300025933|Ga0207706_10613554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 934 | Open in IMG/M |
| 3300025936|Ga0207670_11759080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 527 | Open in IMG/M |
| 3300025937|Ga0207669_10549436 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 932 | Open in IMG/M |
| 3300026001|Ga0208000_111719 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 568 | Open in IMG/M |
| 3300026041|Ga0207639_10811021 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 872 | Open in IMG/M |
| 3300026095|Ga0207676_10036153 | All Organisms → cellular organisms → Bacteria | 3755 | Open in IMG/M |
| 3300026496|Ga0257157_1026553 | Not Available | 950 | Open in IMG/M |
| 3300026555|Ga0179593_1069494 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2258 | Open in IMG/M |
| 3300027388|Ga0208995_1069859 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 616 | Open in IMG/M |
| 3300027874|Ga0209465_10235092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 916 | Open in IMG/M |
| 3300027894|Ga0209068_10858670 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300027915|Ga0209069_10984150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 516 | Open in IMG/M |
| 3300028802|Ga0307503_10319751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 785 | Open in IMG/M |
| 3300031170|Ga0307498_10305843 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 596 | Open in IMG/M |
| 3300031198|Ga0307500_10043377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1063 | Open in IMG/M |
| 3300031199|Ga0307495_10237659 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 518 | Open in IMG/M |
| 3300031469|Ga0170819_11796378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 518 | Open in IMG/M |
| 3300031679|Ga0318561_10539340 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300031679|Ga0318561_10597743 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300031763|Ga0318537_10025996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2062 | Open in IMG/M |
| 3300031769|Ga0318526_10134499 | Not Available | 1001 | Open in IMG/M |
| 3300031781|Ga0318547_10648519 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300031793|Ga0318548_10366920 | Not Available | 706 | Open in IMG/M |
| 3300031797|Ga0318550_10058700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1746 | Open in IMG/M |
| 3300031852|Ga0307410_11227881 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 654 | Open in IMG/M |
| 3300031858|Ga0310892_10804527 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 652 | Open in IMG/M |
| 3300031908|Ga0310900_10077790 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2055 | Open in IMG/M |
| 3300031913|Ga0310891_10041249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1259 | Open in IMG/M |
| 3300031943|Ga0310885_10606195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 607 | Open in IMG/M |
| 3300032017|Ga0310899_10518647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 587 | Open in IMG/M |
| 3300032174|Ga0307470_11664599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 536 | Open in IMG/M |
| 3300032180|Ga0307471_100704024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1175 | Open in IMG/M |
| 3300032180|Ga0307471_101238014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 910 | Open in IMG/M |
| 3300032954|Ga0335083_10702443 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 821 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.57% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 8.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.96% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.35% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.48% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.61% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.61% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.61% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.61% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.61% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.74% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.74% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.74% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.74% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.74% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.74% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.74% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.74% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.74% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.74% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.74% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.74% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.87% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.87% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.87% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.87% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.87% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.87% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.87% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.87% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.87% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.87% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.87% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.87% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.87% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.87% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 2170459010 | Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!) | Environmental | Open in IMG/M |
| 3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002128 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Environmental | Open in IMG/M |
| 3300004062 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005879 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_301 | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1 | Environmental | Open in IMG/M |
| 3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300013096 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300022737 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S094-311B-5 | Environmental | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026001 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_104 (SPAdes) | Environmental | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026496 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-A | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300027388 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031198 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S | Environmental | Open in IMG/M |
| 3300031199 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031913 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4 | Environmental | Open in IMG/M |
| 3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
| 3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPIPI_01490030 | 2088090014 | Soil | LGENDLNTGEQFQLSDEAAERYERCPARYILGPWAPLLVN |
| F62_04123060 | 2170459010 | Grass Soil | MERPMNEHEQWHLTLEAAELYERYVARYILGPWAPALVDAAHVTVGER |
| JGI12630J15595_100418882 | 3300001545 | Forest Soil | MSEHEQWHLSPEAAERYERVVARYILGPWAPLLVDAAG |
| JGI12053J15887_102437481 | 3300001661 | Forest Soil | MNEHEQWHLTSEAAELYERYVARYILGPWAPSLVDA |
| JGI24036J26619_100444741 | 3300002128 | Corn, Switchgrass And Miscanthus Rhizosphere | MTTNEQWQLTMKAAELYERCPARYILGPWAPLLVETAHVAVSER |
| Ga0055500_100236221 | 3300004062 | Natural And Restored Wetlands | MEREMKANEQWHIAKEAAELYERVVARHILGPWAPSLVDAAR |
| Ga0066398_100483711 | 3300004268 | Tropical Forest Soil | LAANEQFQLSDGAAERYERCPARYILGPWAPLLVDAASPAAGERVL |
| Ga0062594_1004543532 | 3300005093 | Soil | MEWEMAKNGQWQLSVEAAERYERYVARYILGPWASLLVDASQVG |
| Ga0062594_1023492151 | 3300005093 | Soil | MNTREQWQLTLEAAELYERCPARYILGPWAPLLVEAARVASGERV |
| Ga0068869_1013443501 | 3300005334 | Miscanthus Rhizosphere | MNRPEQWHLSNDAAQRYERCVARCILGPWAPLLVETAGIV |
| Ga0066681_100743981 | 3300005451 | Soil | MECEMNKHQPWHLTAEAAELYERYVARYILGPWAPLLVDA |
| Ga0070679_1008772451 | 3300005530 | Corn Rhizosphere | MTTNEQWQLTMKAAELYERCPARYILGPWAPLLVETAHVAVS |
| Ga0070679_1021441682 | 3300005530 | Corn Rhizosphere | MEWEMAKNGQWQLSVEAAERYERYVARYILGPWASLLVDASQVGVGER |
| Ga0068853_1022763752 | 3300005539 | Corn Rhizosphere | MEWEMAKNGQWQLSAEAAQRYERYVARYILGPWVPLLVDASQVGVG |
| Ga0068854_1015261111 | 3300005578 | Corn Rhizosphere | MNRPEQWHLNADAAQRYERCVAQYILGPWAPSLVETAGI |
| Ga0066706_106948673 | 3300005598 | Soil | MECEMNKHQPWHLTAEAAELYERYVARYILGPWAPLLVDAACLA |
| Ga0066905_1005634612 | 3300005713 | Tropical Forest Soil | MNKHEQWHLTAEAAELYERYVVRYILGPWAPLLVD |
| Ga0066905_1006674551 | 3300005713 | Tropical Forest Soil | MSKPEQWHLSPDAAERYEQVVARYILGPWAPLLVDAARL |
| Ga0068863_1013383721 | 3300005841 | Switchgrass Rhizosphere | MNKHEPWHLSAEAAELYERYVARYILGPWAPLLVDAACLAAGE |
| Ga0068860_1011075001 | 3300005843 | Switchgrass Rhizosphere | MNKHEQWHLSPDAAERYEQVVARYILGPWAPLLVDAAGL |
| Ga0075295_10342151 | 3300005879 | Rice Paddy Soil | MSGQWQLEGSAAEIYERTAARYILGPWALGLVDLAAVRGGE |
| Ga0081455_103120322 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MKHEPWQVTAEAAELYERYPARYILGPWAPLLVDAVIDGRPR |
| Ga0070717_112439521 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MAKNGQWQLSVEAAERYERYVARYILGPWASLLVDASQVGVGERV |
| Ga0070716_1010737561 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MNKHEQWQVCAAAAEQYERVVARYIFGPWTPLLLD |
| Ga0079222_122749692 | 3300006755 | Agricultural Soil | MNRQGARQEAWQLSGDAAELYERHVARHILGPWAPLLV |
| Ga0075428_1026125351 | 3300006844 | Populus Rhizosphere | MAKNGQWQLSAEAAELYERYVARYILGPWAPLLVDVAH |
| Ga0075431_1005440193 | 3300006847 | Populus Rhizosphere | MSKHEQWHLSPDAAERYQQVVVRYILGPWAPLLVD |
| Ga0075425_1001899661 | 3300006854 | Populus Rhizosphere | MSRQGARQEAWQLTADAAELYERYVARHILGPWAPLLVDV |
| Ga0075425_1013610502 | 3300006854 | Populus Rhizosphere | MSKHEQWHLSPDAAERYQQVVVRYILGPWAPLLVDAAGLSA |
| Ga0075425_1020682611 | 3300006854 | Populus Rhizosphere | MMNKHEQWHIGPDAAERYEQVVARYILSPWAPLLVDAAGL |
| Ga0075435_1002759231 | 3300007076 | Populus Rhizosphere | MSRQGARQEAWQLTADAAELYERYVARHILGPWAPLLVDVAR |
| Ga0099795_102438811 | 3300007788 | Vadose Zone Soil | MNEHEQWYLTSEAAELYERYVARYILGPWAPSLVDAAHVTV |
| Ga0099829_103523933 | 3300009038 | Vadose Zone Soil | MKTNEQWHITLEAARLYERIVARHILGPWAPLLVDAAHLAGG |
| Ga0111539_119792771 | 3300009094 | Populus Rhizosphere | MATNEQWQLTMKAAELYERCPARYILGPWAPLLVETAHVTAGERV |
| Ga0111539_125598781 | 3300009094 | Populus Rhizosphere | MNRPEQWHLNKDAAQRYERCVAHYILGPWAPLLVETAGIVSGER |
| Ga0105245_112107722 | 3300009098 | Miscanthus Rhizosphere | MIAHAQWQLTAPAAELYEHVVARYILGPWAPVLVDAAH |
| Ga0066709_1031040671 | 3300009137 | Grasslands Soil | MEYEMNTHEPWHLTAEAAELYERYVARYILGPWAPLL |
| Ga0111538_104911131 | 3300009156 | Populus Rhizosphere | MKANEQWRITREAAELYERVVARHILGPWAPLLVEEAG |
| Ga0111538_122276352 | 3300009156 | Populus Rhizosphere | MATNEQWQLTTKAAELYERCPARYILGPWAPLLVETAHVTAG |
| Ga0126374_100944161 | 3300009792 | Tropical Forest Soil | LGENDLNTGEQFQLSDEAAERYERCPARYILGPWAPLLVNAARPTAGERVLDV |
| Ga0126309_109046881 | 3300010039 | Serpentine Soil | MTNHEQWHLTREAAELYERYVARYILGPWAPMLLDAARLASGERVL |
| Ga0126380_111003741 | 3300010043 | Tropical Forest Soil | MAKNAQWQLSAQAAELYERYVARYILGPWAPLLVD |
| Ga0126311_113208491 | 3300010045 | Serpentine Soil | VNKEEQWQMSKEAAEAYERYVARYILGPWAPLLVD |
| Ga0126370_114640161 | 3300010358 | Tropical Forest Soil | MERTMNAPDQWQVTPQAAELYERYPVRYILGPWAPLLVDA |
| Ga0126376_101177264 | 3300010359 | Tropical Forest Soil | MERPMKHEPWQVTAEAAELYERYPARYMLGPWAPLLVYAARLKVG |
| Ga0126376_115159842 | 3300010359 | Tropical Forest Soil | METEMNKHESWQLTAEAAELYERYVARYILGPWAPLLVDAARLTAG |
| Ga0126372_127978002 | 3300010360 | Tropical Forest Soil | MSTHEQWHLSAEAAELYERYVVRYILGPWAPLLVDAAHVAVGQ |
| Ga0126377_118533551 | 3300010362 | Tropical Forest Soil | MNKHEQWHLSPGAAERYEQVVARYILGPWAPLLVDAAGLSARERVLDL |
| Ga0134123_136046881 | 3300010403 | Terrestrial Soil | MNRPEQWHLSNDAAQRYERCVARCILRPWAPLLVETAGIVAGERI |
| Ga0137389_106909391 | 3300012096 | Vadose Zone Soil | VNTGEQFQLSDEAAERYERCPARYILGPWAPLLVNAARPTAGERVL |
| Ga0137362_105521602 | 3300012205 | Vadose Zone Soil | MAKNGQWQLSAEAAERYERYVARYILGPWAPLLVDASQVGVGERVLD |
| Ga0137381_109609511 | 3300012207 | Vadose Zone Soil | LGENDLNTGEQFQLSDEAAERYERCPARYILGPWAPLLVNAARPTAGERV |
| Ga0137372_107625652 | 3300012350 | Vadose Zone Soil | MERPMRHEPWQVTLEAAELYERYPARYILGPWTPLLVDA |
| Ga0137390_119426382 | 3300012363 | Vadose Zone Soil | MNKDEQWHLTAEAAERYERCVARYILGPWAPLLADAARLAAGERV |
| Ga0157288_100256111 | 3300012901 | Soil | MAKDEQWHMSAEAAELYERIPARYILGPWAPLLVSA |
| Ga0157283_100688052 | 3300012907 | Soil | MAKNAQWQLSAEAAELYERYVARYILGPWAPLLVDAAHVGVGERV |
| Ga0137404_117144251 | 3300012929 | Vadose Zone Soil | MAKNGQWQLSAEAAELYERYVARHILGPWAPLLVDVADVGVG |
| Ga0134110_103212842 | 3300012975 | Grasslands Soil | MECEMNKHQPWHLTAEAAELYERYVARYILGPWAPLLVDAACLAAG |
| Ga0157307_11500881 | 3300013096 | Soil | MATNEQWQLTLKSAELYELCPARYILGPWAPLLVETARLSSGERVLDVA |
| Ga0157373_103622323 | 3300013100 | Corn Rhizosphere | MAKDEQWHMSVQAAALYERCPARYILGPWAPLLVETARVAAGERV |
| Ga0157371_114239921 | 3300013102 | Corn Rhizosphere | MATNEQWQLTMKAAELYERCPARYILGPWAPLLVETAHVT |
| Ga0163162_125510152 | 3300013306 | Switchgrass Rhizosphere | MERQMTRHEQWHLTAEAAELYERTVARHILGPWAPLLVEAIHVATG |
| Ga0157375_117578782 | 3300013308 | Miscanthus Rhizosphere | MNKHEQWHLSPDAAERYEQVVARYILGPWAPLLVDAAGLSTGERVL |
| Ga0157377_117508022 | 3300014745 | Miscanthus Rhizosphere | MATNGQWQLSAEAAELYERYVARYILGPWATLLVDVAQVGVG |
| Ga0137409_101677481 | 3300015245 | Vadose Zone Soil | MKPHEQWHITREAAELYERVVARHILGPWAPSLVDAGRVAAG |
| Ga0132258_134503071 | 3300015371 | Arabidopsis Rhizosphere | MALRWGVAMNTHEQWQLTMKAAELYERYPARYILGPWAPLLVDVTRLTAGERVL |
| Ga0132257_1001457121 | 3300015373 | Arabidopsis Rhizosphere | MEWKMTKHEQWQLSDEAAEQYERCPARYILGPWAPFLVDAARLVAGERV |
| Ga0182033_111695292 | 3300016319 | Soil | LNTGQQFQLSDEAAERYERCAARYILGPWAPLLVNAAR |
| Ga0134074_13105892 | 3300017657 | Grasslands Soil | MACEMNKHEAWQLTREAAEPYERYVARYILAPWAPLLVDGARL |
| Ga0184617_11083642 | 3300018066 | Groundwater Sediment | MAKNGQWQLSAEAAELYECYVARYILGPWAPLLVDIAHVGVGERLRERFDVLPI |
| Ga0184628_105993461 | 3300018083 | Groundwater Sediment | MDREMTKHQPWHLSAEAAELYERYVARYILGPWAPLLVDTACLA |
| Ga0066662_107959301 | 3300018468 | Grasslands Soil | MSQIEQWQLTAEAAELYERYPARYILRPWAPLLIDAACLIGGE |
| Ga0173482_101299001 | 3300019361 | Soil | MAKKRHKNGQWQLSAEAAKLYERYVARYILGPWAPL |
| Ga0179596_107190402 | 3300021086 | Vadose Zone Soil | VNTGEQFQLSDEAAERYERCAARYILGPWAPLLVNAACPAAGERV |
| Ga0210402_105643012 | 3300021478 | Soil | LNTGEQFQLSDEAAERYERCPARYILGPWAPLLVNAARPAAGERVLDV |
| Ga0247747_10476621 | 3300022737 | Soil | MAKNGQWQLSVEAAERYERYVARYILGPWASLLVDASQV |
| Ga0207647_101461241 | 3300025904 | Corn Rhizosphere | MEWEMAKNGQWQLSVEAAERYERYVARYILGPWASLLVDASQVGVGERV |
| Ga0207685_105005861 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MSTNEQWQLTDDAAARYERCVARYILAPWAPMLVDAAHVVGVSM |
| Ga0207645_104660652 | 3300025907 | Miscanthus Rhizosphere | MSANEQWQLSAKAAELYQRIPARYILGPWAPLLVERAAVAQGERVLD |
| Ga0207662_103246962 | 3300025918 | Switchgrass Rhizosphere | MSANEQWQLSAKAAELYQRIPARYILGPWAPLLVERAAVAQGERVL |
| Ga0207681_110069921 | 3300025923 | Switchgrass Rhizosphere | MAKNGQWQLSAEAAELYERYVARYILGPWAPLLVDAAHV |
| Ga0207706_106135541 | 3300025933 | Corn Rhizosphere | MAKNAQWQLSAEAAELYERYVARYILGPWASLLVDASQ |
| Ga0207670_117590802 | 3300025936 | Switchgrass Rhizosphere | MAKHEQWHLSAEAAELYERYVARYILGPWAPLLLEAI |
| Ga0207669_105494362 | 3300025937 | Miscanthus Rhizosphere | MAKNGQWQLSAEAAELYERYVARYILGPWAPLLVDVAHVDIG |
| Ga0208000_1117191 | 3300026001 | Rice Paddy Soil | MSGQWQLEGNAAELYERYPGRYILGPWASGLVELAGVKA |
| Ga0207639_108110211 | 3300026041 | Corn Rhizosphere | MAKNGQWQLSAEAAELYERYVARYILGPWAPLLVDAA |
| Ga0207676_100361531 | 3300026095 | Switchgrass Rhizosphere | MNRPEQWHLNADAAQRYERCVAHYILGPWAPLLVEAAGI |
| Ga0257157_10265532 | 3300026496 | Soil | MEGEMSEHEQWQVTAEAAKLYERYPARYILGPWAPL |
| Ga0179593_10694941 | 3300026555 | Vadose Zone Soil | MAKNGQWQLSAEAAELYECYVARYILGPWAPLLVDSAHVGVGERV |
| Ga0208995_10698592 | 3300027388 | Forest Soil | MKTNEQWHMAAEAAALYERIVARHILGPWAPSLVDAAHVAE |
| Ga0209465_102350922 | 3300027874 | Tropical Forest Soil | MSKPEQWHLSPDAAERYEQVVARYILGPWAPLLVD |
| Ga0209068_108586702 | 3300027894 | Watersheds | VNTGEQFQLSDEAAERYERCPARYILGPWAPLLVNA |
| Ga0209069_109841501 | 3300027915 | Watersheds | MAHHSQWQLSAAAAERYERYVARFLLGPWAPSLLDAAQLGPG |
| Ga0307503_103197511 | 3300028802 | Soil | MNAHEQWHLSSEAAEQYERYVARYILGPWAPSLVDAA |
| Ga0307498_103058432 | 3300031170 | Soil | MAKNGQWQLSAEAAQRYERYVARYILGPWAPLLVDASQ |
| Ga0307500_100433771 | 3300031198 | Soil | MEWEMAKNGQWQLSAEAAQRYERYVARYILGPWAPLLVDASQVGVGE |
| Ga0307495_102376591 | 3300031199 | Soil | MNKHEQWHIGPDAAERYERIVARYILGPWAPLLVDAA |
| Ga0170819_117963781 | 3300031469 | Forest Soil | MNEHEQWHLSSEAAELYERYVARYILGPWAPSLVD |
| Ga0318561_105393401 | 3300031679 | Soil | LNTGQQFQLSDEAAERYERCAARYILGPWAPLLVNAARPAAGERVLD |
| Ga0318561_105977431 | 3300031679 | Soil | LDTGEQFQLSDEAAERYECCPARYILGPWAPSLVNAARPTAGERVLDVA |
| Ga0318537_100259963 | 3300031763 | Soil | LSTGEQFQLSDEAAERYERCPARYILGPWAPLLVNAARPTAGERVLD |
| Ga0318526_101344992 | 3300031769 | Soil | LSTGEQFQLSDEAAERYERCPARYILGPWAPLLVNAARPTAGE |
| Ga0318547_106485192 | 3300031781 | Soil | LNTGQQFQLSDEAAERYERCAARYILGPWAPLLVNAARPAAGERVLDI |
| Ga0318548_103669201 | 3300031793 | Soil | LNTGQQFQLSDEAAERYERCPARYILGPWAPLLVN |
| Ga0318550_100587003 | 3300031797 | Soil | LDTGEQFQLSDEAAERYECCPARYILGPWAPSLVN |
| Ga0307410_112278811 | 3300031852 | Rhizosphere | MNTEEQWQVSKEAAEAYERHVARYILGPWAPLLVDAARLAPGE |
| Ga0310892_108045272 | 3300031858 | Soil | MAKNGQWQLSVEAAERYERYVARYILGPWASLLVDA |
| Ga0310900_100777901 | 3300031908 | Soil | MSANEQWQLSAKAAELYQRIPARYILGPWAPLLVERAAVA |
| Ga0310891_100412491 | 3300031913 | Soil | MNKHEQWHLAAEAAELYERYVARYILGPWAPLLADAARLAP |
| Ga0310885_106061951 | 3300031943 | Soil | MSANEQWQLSAKAAELYQRIPARYILGPWAPLLVERAAVAQGER |
| Ga0310899_105186472 | 3300032017 | Soil | MNKHEQWHLAAEAAELYERYVARYILGPWAPLLADAARL |
| Ga0307470_116645991 | 3300032174 | Hardwood Forest Soil | MAKNGQWQLSAEAAELYECYVARYILGPWAHLLVDIAH |
| Ga0307471_1007040241 | 3300032180 | Hardwood Forest Soil | MSKNGQWQLDGSAAELYERYVARHILGPWVPGLLDRAGV |
| Ga0307471_1012380142 | 3300032180 | Hardwood Forest Soil | MNKHEPWHLSAEAAELYERYVARYILGPWAPLLVDAAC |
| Ga0335083_107024431 | 3300032954 | Soil | VSANGQWRLDGNAAELYERYVARYILGPWVPRLLDIANVRP |
| ⦗Top⦘ |