


| Basic Information | |
|---|---|
| Family ID | F080379 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 115 |
| Average Sequence Length | 45 residues |
| Representative Sequence | LSLVVETGDSVRDGAGESVCIGEGAVGELMLLEVAPASFDVVQ |
| Number of Associated Samples | 76 |
| Number of Associated Scaffolds | 115 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 46.96 % |
| % of genes near scaffold ends (potentially truncated) | 68.70 % |
| % of genes from short scaffolds (< 2000 bps) | 96.52 % |
| Associated GOLD sequencing projects | 70 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.14 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (79.130 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil (12.174 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.957 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (62.609 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.14 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 115 Family Scaffolds |
|---|---|---|
| PF02371 | Transposase_20 | 13.91 |
| PF13358 | DDE_3 | 7.83 |
| PF12762 | DDE_Tnp_IS1595 | 2.61 |
| PF05598 | DUF772 | 1.74 |
| PF01609 | DDE_Tnp_1 | 1.74 |
| PF13546 | DDE_5 | 1.74 |
| PF07589 | PEP-CTERM | 1.74 |
| PF11154 | DUF2934 | 0.87 |
| PF14559 | TPR_19 | 0.87 |
| PF00296 | Bac_luciferase | 0.87 |
| PF13384 | HTH_23 | 0.87 |
| PF01526 | DDE_Tnp_Tn3 | 0.87 |
| PF02518 | HATPase_c | 0.87 |
| PF13340 | DUF4096 | 0.87 |
| PF02308 | MgtC | 0.87 |
| PF16694 | Cytochrome_P460 | 0.87 |
| PF01507 | PAPS_reduct | 0.87 |
| PF01527 | HTH_Tnp_1 | 0.87 |
| PF13419 | HAD_2 | 0.87 |
| PF01964 | ThiC_Rad_SAM | 0.87 |
| PF00106 | adh_short | 0.87 |
| PF00023 | Ank | 0.87 |
| PF07542 | ATP12 | 0.87 |
| PF07859 | Abhydrolase_3 | 0.87 |
| PF00903 | Glyoxalase | 0.87 |
| PF13545 | HTH_Crp_2 | 0.87 |
| PF13586 | DDE_Tnp_1_2 | 0.87 |
| PF00027 | cNMP_binding | 0.87 |
| PF13565 | HTH_32 | 0.87 |
| PF00665 | rve | 0.87 |
| COG ID | Name | Functional Category | % Frequency in 115 Family Scaffolds |
|---|---|---|---|
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 13.91 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 1.74 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 1.74 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 1.74 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 1.74 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 1.74 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 1.74 |
| COG0422 | 4-amino-2-methyl-5-hydroxymethylpyrimidine (HMP) synthase ThiC | Coenzyme transport and metabolism [H] | 0.87 |
| COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 0.87 |
| COG1285 | Magnesium uptake protein YhiD/SapB, involved in acid resistance | Inorganic ion transport and metabolism [P] | 0.87 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.87 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.87 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.87 |
| COG3174 | Membrane component of predicted Mg2+ transport system, contains DUF4010 domain | Inorganic ion transport and metabolism [P] | 0.87 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.87 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.87 |
| COG4644 | Transposase and inactivated derivatives, TnpA family | Mobilome: prophages, transposons [X] | 0.87 |
| COG5387 | Mitochondrial FoF1-type ATP synthase assembly chaperone ATP12 | Posttranslational modification, protein turnover, chaperones [O] | 0.87 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 79.13 % |
| Unclassified | root | N/A | 20.87 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459019|G14TP7Y01CXJWS | All Organisms → cellular organisms → Bacteria → Proteobacteria | 639 | Open in IMG/M |
| 3300001686|C688J18823_10357991 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
| 3300002568|C688J35102_117977592 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 520 | Open in IMG/M |
| 3300002568|C688J35102_118958962 | Not Available | 618 | Open in IMG/M |
| 3300002568|C688J35102_120066245 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 866 | Open in IMG/M |
| 3300004081|Ga0063454_100727767 | Not Available | 753 | Open in IMG/M |
| 3300004081|Ga0063454_101383586 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300004463|Ga0063356_106291689 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidisphaera → unclassified Acidisphaera → Acidisphaera sp. S103 | 509 | Open in IMG/M |
| 3300005178|Ga0066688_10923105 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300005328|Ga0070676_10357951 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1005 | Open in IMG/M |
| 3300005334|Ga0068869_100194526 | All Organisms → cellular organisms → Bacteria | 1596 | Open in IMG/M |
| 3300005354|Ga0070675_101946952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 542 | Open in IMG/M |
| 3300005439|Ga0070711_101205492 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 655 | Open in IMG/M |
| 3300005441|Ga0070700_100945742 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300005456|Ga0070678_100061138 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2775 | Open in IMG/M |
| 3300005466|Ga0070685_10648714 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 765 | Open in IMG/M |
| 3300005535|Ga0070684_101934957 | Not Available | 556 | Open in IMG/M |
| 3300005578|Ga0068854_101426368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 627 | Open in IMG/M |
| 3300005718|Ga0068866_10763546 | Not Available | 669 | Open in IMG/M |
| 3300005843|Ga0068860_101997765 | Not Available | 601 | Open in IMG/M |
| 3300006173|Ga0070716_101168985 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300006237|Ga0097621_100075316 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2797 | Open in IMG/M |
| 3300006854|Ga0075425_102058768 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 638 | Open in IMG/M |
| 3300006954|Ga0079219_11529712 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 606 | Open in IMG/M |
| 3300006954|Ga0079219_11707608 | Not Available | 584 | Open in IMG/M |
| 3300006969|Ga0075419_10403980 | All Organisms → cellular organisms → Bacteria | 936 | Open in IMG/M |
| 3300007004|Ga0079218_10626051 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 989 | Open in IMG/M |
| 3300009100|Ga0075418_11562999 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300009101|Ga0105247_10161624 | Not Available | 1483 | Open in IMG/M |
| 3300009156|Ga0111538_14078877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 504 | Open in IMG/M |
| 3300009177|Ga0105248_11064079 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 914 | Open in IMG/M |
| 3300009545|Ga0105237_11720124 | Not Available | 634 | Open in IMG/M |
| 3300009789|Ga0126307_11178032 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 620 | Open in IMG/M |
| 3300010036|Ga0126305_10654128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 709 | Open in IMG/M |
| 3300010039|Ga0126309_10497286 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 750 | Open in IMG/M |
| 3300010039|Ga0126309_10603632 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → unclassified Oxalobacteraceae → Oxalobacteraceae bacterium | 691 | Open in IMG/M |
| 3300010040|Ga0126308_10219175 | All Organisms → cellular organisms → Bacteria | 1228 | Open in IMG/M |
| 3300010040|Ga0126308_10344924 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
| 3300010041|Ga0126312_10561598 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
| 3300010044|Ga0126310_10513740 | Not Available | 878 | Open in IMG/M |
| 3300010044|Ga0126310_11714753 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 522 | Open in IMG/M |
| 3300010045|Ga0126311_10701426 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300010045|Ga0126311_10757218 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 780 | Open in IMG/M |
| 3300010045|Ga0126311_11011597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 680 | Open in IMG/M |
| 3300010045|Ga0126311_11537326 | Not Available | 558 | Open in IMG/M |
| 3300010045|Ga0126311_11816106 | Not Available | 517 | Open in IMG/M |
| 3300010373|Ga0134128_11052406 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidisphaera → unclassified Acidisphaera → Acidisphaera sp. S103 | 899 | Open in IMG/M |
| 3300010375|Ga0105239_10653769 | All Organisms → cellular organisms → Bacteria | 1201 | Open in IMG/M |
| 3300010375|Ga0105239_11000473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidisphaera → unclassified Acidisphaera → Acidisphaera sp. S103 | 961 | Open in IMG/M |
| 3300010400|Ga0134122_11911270 | Not Available | 629 | Open in IMG/M |
| 3300011119|Ga0105246_11368722 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 659 | Open in IMG/M |
| 3300012212|Ga0150985_100746944 | Not Available | 505 | Open in IMG/M |
| 3300012212|Ga0150985_101792781 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 869 | Open in IMG/M |
| 3300012212|Ga0150985_102125996 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 513 | Open in IMG/M |
| 3300012212|Ga0150985_102419501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloligella → Methyloligella halotolerans | 1239 | Open in IMG/M |
| 3300012212|Ga0150985_107745455 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1001 | Open in IMG/M |
| 3300012212|Ga0150985_112443224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 1651 | Open in IMG/M |
| 3300012212|Ga0150985_113346224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 514 | Open in IMG/M |
| 3300012212|Ga0150985_114222439 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 619 | Open in IMG/M |
| 3300012212|Ga0150985_115145786 | Not Available | 584 | Open in IMG/M |
| 3300012212|Ga0150985_115747336 | Not Available | 697 | Open in IMG/M |
| 3300012212|Ga0150985_118800358 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300012212|Ga0150985_121963292 | Not Available | 501 | Open in IMG/M |
| 3300012469|Ga0150984_100573090 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 859 | Open in IMG/M |
| 3300012469|Ga0150984_105643318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 971 | Open in IMG/M |
| 3300012469|Ga0150984_108408406 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 893 | Open in IMG/M |
| 3300012469|Ga0150984_113238072 | Not Available | 603 | Open in IMG/M |
| 3300012469|Ga0150984_113684355 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 632 | Open in IMG/M |
| 3300012469|Ga0150984_113786094 | All Organisms → cellular organisms → Bacteria | 1292 | Open in IMG/M |
| 3300012469|Ga0150984_117120528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1380 | Open in IMG/M |
| 3300012469|Ga0150984_117558483 | Not Available | 1048 | Open in IMG/M |
| 3300012469|Ga0150984_118966691 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 606 | Open in IMG/M |
| 3300012469|Ga0150984_119338997 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 693 | Open in IMG/M |
| 3300012469|Ga0150984_120380997 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1163 | Open in IMG/M |
| 3300012469|Ga0150984_122008896 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 543 | Open in IMG/M |
| 3300012469|Ga0150984_123356995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 613 | Open in IMG/M |
| 3300012955|Ga0164298_10538887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 789 | Open in IMG/M |
| 3300012957|Ga0164303_10943591 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium | 608 | Open in IMG/M |
| 3300012957|Ga0164303_11062666 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 581 | Open in IMG/M |
| 3300013297|Ga0157378_11955389 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 636 | Open in IMG/M |
| 3300013297|Ga0157378_13139588 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 513 | Open in IMG/M |
| 3300013306|Ga0163162_11425478 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300013306|Ga0163162_12650150 | Not Available | 577 | Open in IMG/M |
| 3300014325|Ga0163163_11071929 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 869 | Open in IMG/M |
| 3300014326|Ga0157380_10872993 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
| 3300014487|Ga0182000_10493067 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 568 | Open in IMG/M |
| 3300014745|Ga0157377_11563449 | Not Available | 527 | Open in IMG/M |
| 3300015371|Ga0132258_13967434 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1005 | Open in IMG/M |
| 3300015374|Ga0132255_105326863 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 544 | Open in IMG/M |
| 3300017792|Ga0163161_10074889 | All Organisms → cellular organisms → Bacteria | 2483 | Open in IMG/M |
| 3300018422|Ga0190265_11609443 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300018433|Ga0066667_11943748 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 538 | Open in IMG/M |
| 3300018466|Ga0190268_11346785 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 606 | Open in IMG/M |
| 3300019362|Ga0173479_10416861 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 653 | Open in IMG/M |
| 3300025903|Ga0207680_10480211 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
| 3300025907|Ga0207645_11088684 | Not Available | 539 | Open in IMG/M |
| 3300025921|Ga0207652_11448234 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 590 | Open in IMG/M |
| 3300025927|Ga0207687_10084017 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2307 | Open in IMG/M |
| 3300025945|Ga0207679_12020208 | Not Available | 525 | Open in IMG/M |
| 3300025986|Ga0207658_11170000 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300026075|Ga0207708_10519247 | Not Available | 1001 | Open in IMG/M |
| 3300026075|Ga0207708_11388225 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 616 | Open in IMG/M |
| 3300026095|Ga0207676_10329550 | All Organisms → cellular organisms → Bacteria | 1404 | Open in IMG/M |
| 3300026121|Ga0207683_11091715 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300027775|Ga0209177_10022393 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum | 1576 | Open in IMG/M |
| 3300027903|Ga0209488_11147074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 527 | Open in IMG/M |
| 3300028104|Ga0247713_1090376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 654 | Open in IMG/M |
| 3300030514|Ga0268253_10012766 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1921 | Open in IMG/M |
| 3300030988|Ga0308183_1087291 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 691 | Open in IMG/M |
| 3300031058|Ga0308189_10056034 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1114 | Open in IMG/M |
| 3300031562|Ga0310886_10577350 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 688 | Open in IMG/M |
| 3300031939|Ga0308174_11776600 | Not Available | 530 | Open in IMG/M |
| 3300032074|Ga0308173_12209014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 519 | Open in IMG/M |
| 3300034132|Ga0334915_049018 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
| 3300034137|Ga0334943_053241 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 12.17% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 11.30% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 10.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.83% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 5.22% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.35% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.48% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.61% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.61% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.61% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.61% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.61% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.74% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.74% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.74% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.74% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.74% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 1.74% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.74% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.74% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.87% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.87% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.87% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.87% |
| Biocrust | Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Biocrust | 0.87% |
| Hypolithic Biocrust | Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Hypolithic Biocrust | 0.87% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.87% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.87% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.87% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.87% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.87% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.87% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 0.87% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.87% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459019 | Litter degradation MG4 | Engineered | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028104 | Soil microbial communities from hillslope of Landscape Evolution Observatory, University of Arizona, Oracle, AZ, United States - 2-1-E_N | Environmental | Open in IMG/M |
| 3300030514 | Agave microbial communities from Guanajuato, Mexico - Mg.Ma.rz (v2) | Host-Associated | Open in IMG/M |
| 3300030988 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_157 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300034132 | Biocrust microbial communities from Mojave Desert, California, United States - 11HMC | Environmental | Open in IMG/M |
| 3300034137 | Biocrust microbial communities from Mojave Desert, California, United States - 39SMC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 4MG_02795450 | 2170459019 | Switchgrass, Maize And Mischanthus Litter | MGLSFVVETGDGIRDGAGKSVGIGEGAISELMLLEVAPASFDSLPRT |
| C688J18823_103579912 | 3300001686 | Soil | MRLPLVVETGDGVRDGAFESVGLGEGTISEIMLLEVTPASLDVI |
| C688J35102_1179775921 | 3300002568 | Soil | NGRWMSLSFLVEASDGVRDGAFESVEIGEGTIGQIMLLEVAPASLDSLPRT* |
| C688J35102_1189589622 | 3300002568 | Soil | LSLVVEPGDSVRDSSGESVGIGEGAVGELILLEVAPASLDSLPRT* |
| C688J35102_1200662452 | 3300002568 | Soil | MGDSVRDGAFESVGIGEGTIGQLMLLEVAPASLDSLPWT* |
| Ga0063454_1007277671 | 3300004081 | Soil | MSLSFLVEASDGVRDGAFESVEIGEGTIGQIMLLEVAPASLD |
| Ga0063454_1013835861 | 3300004081 | Soil | MRLPLVVEAGDRVRDGTGESVGIGKGTVGELMLLEVAPASLDVIQL |
| Ga0063356_1062916891 | 3300004463 | Arabidopsis Thaliana Rhizosphere | VVETGDSVRDGAGESVCIGEGAVGELMLLEVAPASFDVVQ |
| Ga0066688_109231051 | 3300005178 | Soil | VVETGDSVRDGVGESVGVSEGAVGELMLLEVAPASLEVVQLGGVFRQS* |
| Ga0070676_103579512 | 3300005328 | Miscanthus Rhizosphere | VLALVVEAGDGVRDGAGKSIGIGEGAVGELMLLEIAPASFDVVQFGG |
| Ga0068869_1001945261 | 3300005334 | Miscanthus Rhizosphere | MSLSLVVETGDSVRDGAFESVDIGESAIGKLMLLKIAPASFDVVQFGGVF |
| Ga0070675_1019469521 | 3300005354 | Miscanthus Rhizosphere | MNEVAARVETGESVRDRAGESVGIGEGTISEMMLFEVAPAPFDVVQFGGIF |
| Ga0070711_1012054921 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MRLSLVVETGDGVRDGAFESIGIGDGSIGQIMLLEVAPASFDSLPRT* |
| Ga0070700_1009457421 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MGLSLVVEAGDSIRDGAGKSVGIGEGAISELMLLEVAPASFDVVQFGGVFR |
| Ga0070678_1000611382 | 3300005456 | Miscanthus Rhizosphere | MRLPLVVETGDSVRDGASESVGIGEGTISEIMLLEVAPASLDSLPRT* |
| Ga0070685_106487142 | 3300005466 | Switchgrass Rhizosphere | VVETGDSVRDGAGESVCIGEGAVGELMLLEVAPASFDVVQFG |
| Ga0070684_1019349571 | 3300005535 | Corn Rhizosphere | MSLSLVVETGDSVRDGAFESVGIGEGAIGELMLLEVAPTS |
| Ga0068854_1014263681 | 3300005578 | Corn Rhizosphere | LSLVVETGDSVRDGAFESVGIGEGAIGELMLLEVAPTSLDVIQFGGVFG* |
| Ga0068866_107635462 | 3300005718 | Miscanthus Rhizosphere | MSLSLVVETGDSVRDGAFESVGIGEGTIGQIMLLEVAPASLDVVQFGGVFR |
| Ga0068860_1019977651 | 3300005843 | Switchgrass Rhizosphere | VIEAINGVPDGAVESAGISEGAISERMLFEVAPASFHVVQLGAGGSHL |
| Ga0070716_1011689851 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MGLSLVVEAGDSIRDGAGKSVGIGEGAISELMLLEVAPASFDVVQ |
| Ga0097621_1000753164 | 3300006237 | Miscanthus Rhizosphere | MGLSLVVAPGDGVMDGMVEKVGIGEGAVAEVMLG* |
| Ga0075425_1020587682 | 3300006854 | Populus Rhizosphere | MSLSLVVETGDSVRDGAFESVGIGEGAIGELMLLEVAPTSLDVIQFGGVF |
| Ga0079219_115297121 | 3300006954 | Agricultural Soil | LSLVVEAGDGVRDGAGESVGIDEGTIGQIVLLEVAPASFDIV* |
| Ga0079219_117076081 | 3300006954 | Agricultural Soil | LSFVVEVGDSVRDGAFESVGIGEGTIGQIMLLEVAPAS |
| Ga0075419_104039802 | 3300006969 | Populus Rhizosphere | MGLPIVVETGNSVRDGASESVGIGEGSVGQIMLLEVTPASLDVIQLGGVFR* |
| Ga0079218_106260511 | 3300007004 | Agricultural Soil | MGLPLVVETGDSIRDGVGESVGIGEGAIGQIMLLEVAPASLDVVQLG |
| Ga0075418_115629991 | 3300009100 | Populus Rhizosphere | LSLVVETGNGVRDGAGESVGIGEGTVGELMLLEVAPASFDV |
| Ga0105247_101616241 | 3300009101 | Switchgrass Rhizosphere | LSLVVETGDGVRDSAGESIGIGEGAIGELMLLQVAPASFDIVQ |
| Ga0111538_140788771 | 3300009156 | Populus Rhizosphere | LSLVVETGDSVRDGAGESIGIGEGAVGELMLLEVAPASFDVVQLGDVFRQS* |
| Ga0105248_110640792 | 3300009177 | Switchgrass Rhizosphere | MGLSLVVEAGDSIRDGAGKSVGIGEGAISELMLLEVAPASFDSLPRT* |
| Ga0105237_117201241 | 3300009545 | Corn Rhizosphere | MSLSLVVETGDSVRDGAFESVRIGEGAIGELMLLEVAPASF |
| Ga0126307_111780322 | 3300009789 | Serpentine Soil | MGLPLVVETGDSVRDSASASVGINEGTVSELMLLEVAPASFDIVQLGGVFW* |
| Ga0126305_106541282 | 3300010036 | Serpentine Soil | MRLALVVEAINGVMDCTLESVGIGEGTIGELMLLEVAPASLDSLPRT* |
| Ga0126309_104972862 | 3300010039 | Serpentine Soil | DGVRDGAGESVGIGEGSVGELMLLEVAPASFDSLPRT* |
| Ga0126309_106036323 | 3300010039 | Serpentine Soil | MRFPLVVETGDSVRDGAGESVGIGEGTISEIMLLEVTPASLDVI |
| Ga0126308_102191751 | 3300010040 | Serpentine Soil | LSLVVETIDGVRDGAGESVGIGEGMIGELMLFEVAPASLDVVQF |
| Ga0126308_103449241 | 3300010040 | Serpentine Soil | MRLAFVVEAVNGIVDRTIESGGIGEGAVGELMQLEIAPTSFDCLPRT* |
| Ga0126312_105615981 | 3300010041 | Serpentine Soil | MRLLLVVETGDSVRDDMTESVGIGESMGGELMLLQVSPASFDIVQ |
| Ga0126310_105137403 | 3300010044 | Serpentine Soil | MRLPLVVETGDSVRNGSGENVGIGEGAIGELMLLEVAPA |
| Ga0126310_117147531 | 3300010044 | Serpentine Soil | MKLPLVVEPGDSARDGAGESVDIGESAIGKLMLLEVAPASFDVVQLRGVF |
| Ga0126311_107014261 | 3300010045 | Serpentine Soil | LSLVIEAGDSVMDDMGESIGIGEGTIGEIMLLQVAPAP |
| Ga0126311_107572183 | 3300010045 | Serpentine Soil | MRLSLVVEAGDSIMNGAVESVEIGGGMVGEIMLLEVTPASLDSLPRT* |
| Ga0126311_110115972 | 3300010045 | Serpentine Soil | MRLSLVVETGDSVRDGTGESVGIGEGTISEIMLLEVTPASLDVV |
| Ga0126311_115373261 | 3300010045 | Serpentine Soil | MRLSLVVEASDSIMNGAVESVEIGEGMVGEIMLLEVTPASLDSLPRT |
| Ga0126311_118161061 | 3300010045 | Serpentine Soil | MVAAGDGVMDGAVESIGIDEGAVGEIMLLEVAPASL |
| Ga0134128_110524062 | 3300010373 | Terrestrial Soil | MRLSLVVEAGDSVRDGAFESVGISEGTIGEIMLFEIAPASLDV |
| Ga0105239_106537691 | 3300010375 | Corn Rhizosphere | MGLSFVVETGDGIRDGAGKSVGIGEGAVGELMLLEVAPASFD |
| Ga0105239_110004731 | 3300010375 | Corn Rhizosphere | LSLVVETGDSVRDGAGESVCIGEGAVGELMLLEVAPASFDVVQ |
| Ga0134122_119112701 | 3300010400 | Terrestrial Soil | LSLVVERGNRVRDGAGESVGVSEGAVSELMLLEVAPAPFDVVQFG |
| Ga0105246_113687222 | 3300011119 | Miscanthus Rhizosphere | MGVSLVVETGDGVVDCAFESIGIGDGAIGQIMLLEVAPASLDIVQ |
| Ga0150985_1007469442 | 3300012212 | Avena Fatua Rhizosphere | LSFVVETGDGVRDGAGESVGIGEGSVGELMLLEVAPASFDIVQ |
| Ga0150985_1017927813 | 3300012212 | Avena Fatua Rhizosphere | MRLPLVIETGDSVRDGAGESVGIGEGAIGELMLLEVAPASFDVVQLR |
| Ga0150985_1021259961 | 3300012212 | Avena Fatua Rhizosphere | MGLSLVVETGDSIRDGAGESVGIGEGAIGELMLLEVAPASFDSLPRT* |
| Ga0150985_1024195011 | 3300012212 | Avena Fatua Rhizosphere | VVESGDSIRDGAGESVGIGEGAIGELMLLEVAPASFDVVQF |
| Ga0150985_1077454551 | 3300012212 | Avena Fatua Rhizosphere | LSFVVEVGDSVRDGAFESVGIGEGTIGQIMLLEVAPASFDIVQFGGVF |
| Ga0150985_1124432241 | 3300012212 | Avena Fatua Rhizosphere | LALVVEAGDSVRDGVGESIGIGEGSVGELMLLEVAPASFD |
| Ga0150985_1133462241 | 3300012212 | Avena Fatua Rhizosphere | MGLSLMVKAGDSVRDSAGESIGIGEGAVGELMLLEVAPASFDIVQFGGVFR |
| Ga0150985_1142224392 | 3300012212 | Avena Fatua Rhizosphere | LSLVVEAGDSVRDGAGESVGIGEGAVDEIMLLEVA |
| Ga0150985_1151457861 | 3300012212 | Avena Fatua Rhizosphere | MELSLVVETGDCIRDGAGEIVGIGEGAVGELMLLEV |
| Ga0150985_1157473362 | 3300012212 | Avena Fatua Rhizosphere | MGLSFVVETGDGIRDGAGKSVGIGEGAISELMLLEVAPASFDSLPRT* |
| Ga0150985_1188003581 | 3300012212 | Avena Fatua Rhizosphere | LSLVVETGDGVRDGAGESVGIGEGSIGELMLLEVAPASFDIVQFGGILRQPFEG |
| Ga0150985_1219632922 | 3300012212 | Avena Fatua Rhizosphere | MELSFVVEAGDSVRDSARESVGIGEGSVGELMLLEVAPASFDSLPRT* |
| Ga0150984_1005730901 | 3300012469 | Avena Fatua Rhizosphere | MGLPLVVETGDGVRDDTGESLDINERAVRELMLLEVAPASFDVVQFGGVFRQPFEG |
| Ga0150984_1056433183 | 3300012469 | Avena Fatua Rhizosphere | MRLPLVVETGDSVRDGAGESVGIGEGAIGELMLLE |
| Ga0150984_1084084061 | 3300012469 | Avena Fatua Rhizosphere | LSLVVETGDSVRDGVGESIGIGEGAVGELMLHEVAPASFDVVQLRGVFRQS* |
| Ga0150984_1132380722 | 3300012469 | Avena Fatua Rhizosphere | LALVVKTGDSVRDGAFESVDIGEGAIGELMLLEDAPASFDSLPRT* |
| Ga0150984_1136843551 | 3300012469 | Avena Fatua Rhizosphere | MGLSLMVKAGDSVRDSAGESIGIGEGAVGELMLLEVAPASFDIVQFGGVFR* |
| Ga0150984_1137860941 | 3300012469 | Avena Fatua Rhizosphere | VVETGDSVRDGAGESVGIGEGTISEIMLLEVTPASLD |
| Ga0150984_1171205282 | 3300012469 | Avena Fatua Rhizosphere | MGLSFMVKAGDSVRDGAGENVGIGEGTVGELMLLEVAPASFDSLPRT* |
| Ga0150984_1175584831 | 3300012469 | Avena Fatua Rhizosphere | MGLPLVVETGDSVMDGAVESADIGEGVVGEIMLLEVAPASLDVSFPPV* |
| Ga0150984_1189666911 | 3300012469 | Avena Fatua Rhizosphere | MRLSLVVKTGDSVRDGAFESVGISEGTIGEIMLFEIAPASLDSLPRT* |
| Ga0150984_1193389971 | 3300012469 | Avena Fatua Rhizosphere | MGLSLVIETGDSIGDGAFESVGIGEGMIGELMLLEVAPASLDIVQLGSV |
| Ga0150984_1203809971 | 3300012469 | Avena Fatua Rhizosphere | LSLVVEAGDSVRDGAGESVGVSEGAVGELMLLEIAPAPFDVVQFG |
| Ga0150984_1220088961 | 3300012469 | Avena Fatua Rhizosphere | MRLSLVVETGDSVRDGAGERVGIGEGAVGELMLLEVAPASFDIVQFWGVFGQPFE |
| Ga0150984_1233569951 | 3300012469 | Avena Fatua Rhizosphere | MRIPLVVETGDSVRDSASENVGIGESTISEIMLLEVAPASLDVIQFGGVFR* |
| Ga0164298_105388871 | 3300012955 | Soil | MRLSLVVETGDGVRDGAFESIGIGDGSIGQIMLLEVAPAS |
| Ga0164303_109435911 | 3300012957 | Soil | LVVETTDSVRDGAGESIGIGESSVGELMLLEVAPASFNVVQFGGVL* |
| Ga0164303_110626661 | 3300012957 | Soil | VETGDSVRDGVGESIGVAEGSVGELMLLEVAPASLEVVQLGGVFRQS* |
| Ga0157378_119553891 | 3300013297 | Miscanthus Rhizosphere | LSLVVETGDSAKDGAVESVGIGEGTVGELMLLEVTPASLDIVQFGGVFRRS* |
| Ga0157378_131395881 | 3300013297 | Miscanthus Rhizosphere | MRLPLVVETGDSVRDGASESVGIGEGTISEIMLLEVAPASLDVVQFGGVFR* |
| Ga0163162_114254782 | 3300013306 | Switchgrass Rhizosphere | LSLVVETGDSVRDGAGESVGIGEGAVGELMLLEVAPA |
| Ga0163162_126501501 | 3300013306 | Switchgrass Rhizosphere | VLALVVEAGDSVRDGAFESVGIDEGTIGELMLLEVAP |
| Ga0163163_110719291 | 3300014325 | Switchgrass Rhizosphere | MRLSLVIETGDGVVDRAFESIGIGDGSIGQIMLLEVA |
| Ga0157380_108729932 | 3300014326 | Switchgrass Rhizosphere | MRLPLVVQTGDSVRDGAGESVGIGEGTISEIMLLEVTPASLDGIQLGGIFRQPFEGE |
| Ga0182000_104930672 | 3300014487 | Soil | LPLVVETGDSVRDDAVESVGIGEDAAGELMLLEVAPAAFDIVQLRGVFWQSLEGEPRALG |
| Ga0157377_115634491 | 3300014745 | Miscanthus Rhizosphere | MRLPLVVETGDSVMNGVGESIGIGEGAIGELMLLQVAPASFGSEAYFGSLRG* |
| Ga0132258_139674342 | 3300015371 | Arabidopsis Rhizosphere | LELSFVVETSDGIRDGAGESIGIGEGAISELMLLEVAPASFDVVQFGGVFR* |
| Ga0132255_1053268632 | 3300015374 | Arabidopsis Rhizosphere | MRLSLVVEAGDSVGEGAGKSIGVGEVAIGELMLFEVAPA |
| Ga0163161_100748895 | 3300017792 | Switchgrass Rhizosphere | MRLSLVVETGDSVRDGASESVGIGEGTISEIMLLE |
| Ga0190265_116094431 | 3300018422 | Soil | VVQTGDSVRDGAGESVGIGEGAIGQIMLLEVTPASLDVI |
| Ga0066667_119437482 | 3300018433 | Grasslands Soil | MVKAGDSVRDSAGESIGIGEGAVGELMLLEVAPASFDSLPRT |
| Ga0190268_113467852 | 3300018466 | Soil | LSLAVETGDSVRDGAFESVGIGEGMIGQKMLLEVTPASLDVIQLGGVFRQ |
| Ga0173479_104168611 | 3300019362 | Soil | LSLVVETGDSVRDGAGESVCIGEGAVGELMLLEVAPASFDVVQLGDVFRQS |
| Ga0207680_104802111 | 3300025903 | Switchgrass Rhizosphere | MSLSLVVETGDSVRDGAFESVGIGEGAIGELMLLEVAPTSLDVIQ |
| Ga0207645_110886841 | 3300025907 | Miscanthus Rhizosphere | MGLSLVVETGDSIRDGAGESVGIGEGAISELMLLEVAPASFDVVQLGSVFR |
| Ga0207652_114482342 | 3300025921 | Corn Rhizosphere | MGLSFVVETGDGIRDGAGKSVGIGEGAVGELMLLEVAPASFDVVQ |
| Ga0207687_100840173 | 3300025927 | Miscanthus Rhizosphere | MRLPLVVETGDSVRDGASESVGIGEGTISEIMLLEVAPASLDSLPRT |
| Ga0207679_120202082 | 3300025945 | Corn Rhizosphere | MRLPLVVETGDSVRDGASESIGIGEGAVGELMLLEV |
| Ga0207658_111700001 | 3300025986 | Switchgrass Rhizosphere | MSLSLVVETGDSVRDGAFESVGIGEGAISELMLLEVAPASFDVVQFGSVFR |
| Ga0207708_105192471 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MRLSLVVETGDDVVDRAFESIGIGDGSIGQIMLLEVAPASFDVVQFGGV |
| Ga0207708_113882251 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MGLSLVVEAGDSIRDGAGKSVGIGEGAISELMLLEVAPASFDVVQLRGVFR |
| Ga0207676_103295501 | 3300026095 | Switchgrass Rhizosphere | MSLSLVVETGDSVRDGGFESVGIGEGAIGELMLLEVAPTSLDVIQFGGVF |
| Ga0207683_110917152 | 3300026121 | Miscanthus Rhizosphere | LALVVEAGDSVGESIGIGDGAITEIMLLEVAPASFDI |
| Ga0209177_100223933 | 3300027775 | Agricultural Soil | MGLSFVVETGDGIRDGAGKSVGIGEGAISELMLLEVAPASFDVVQFGGVFR |
| Ga0209488_111470742 | 3300027903 | Vadose Zone Soil | VVEAGDSVRDGVGESVGIGECAVGELMLLEVAPASLDIVQLG |
| Ga0247713_10903762 | 3300028104 | Soil | MRLPLVVETGDSVRNGAGESVGIGERAVGELMLLEVAPASFDSLPRT |
| Ga0268253_100127664 | 3300030514 | Agave | MGLSFVVETGEGSRDGAGKSVGIGEGAVSELMLLEVAPASFDVVQFGG |
| Ga0308183_10872912 | 3300030988 | Soil | VVEAGDSVGDGAGESIGIGESAVGELMLLEVAPASFDVVQFGGVFRQ |
| Ga0308189_100560343 | 3300031058 | Soil | VVETGDSVRDGAFESVGIGEGAIGELMLLEVAPTSLDVIQFGGVFRQPFD |
| Ga0310886_105773502 | 3300031562 | Soil | VVETGDSVRDGAGESVGIGEGSIGQIMLLEVAPASLDVI |
| Ga0308174_117766002 | 3300031939 | Soil | MGLSLVVETGDSVRNGMGESIGIGEGSVGELMLLEVA |
| Ga0308173_122090141 | 3300032074 | Soil | VVETGDNVRDSAGESVGIGKGAVGELMLFEVAPAPFD |
| Ga0334915_049018_729_851 | 3300034132 | Hypolithic Biocrust | MGLPLVVEAGDSVRDGAGESVGIGEGAIGELMLLEVAPASL |
| Ga0334943_053241_1_153 | 3300034137 | Biocrust | MRLPLVVETGDSIRDGAGESVGIGEGAIGELMLLEVAPASLDIVQLGGVFR |
| ⦗Top⦘ |