


| Basic Information | |
|---|---|
| Family ID | F080238 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 115 |
| Average Sequence Length | 37 residues |
| Representative Sequence | MEEKLTEFEKMLKELEKKPVPERTCNIDDENCESCSG |
| Number of Associated Samples | 90 |
| Number of Associated Scaffolds | 115 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 53.04 % |
| % of genes near scaffold ends (potentially truncated) | 10.43 % |
| % of genes from short scaffolds (< 2000 bps) | 52.17 % |
| Associated GOLD sequencing projects | 79 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (54.783 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (23.478 % of family members) |
| Environment Ontology (ENVO) | Unclassified (70.435 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (79.130 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 16.92% β-sheet: 0.00% Coil/Unstructured: 83.08% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 115 Family Scaffolds |
|---|---|---|
| PF08291 | Peptidase_M15_3 | 29.57 |
| PF13385 | Laminin_G_3 | 6.09 |
| PF01510 | Amidase_2 | 4.35 |
| PF04466 | Terminase_3 | 3.48 |
| PF04860 | Phage_portal | 1.74 |
| PF00118 | Cpn60_TCP1 | 0.87 |
| PF00145 | DNA_methylase | 0.87 |
| PF14550 | Peptidase_S78_2 | 0.87 |
| PF00534 | Glycos_transf_1 | 0.87 |
| PF03592 | Terminase_2 | 0.87 |
| PF00166 | Cpn10 | 0.87 |
| COG ID | Name | Functional Category | % Frequency in 115 Family Scaffolds |
|---|---|---|---|
| COG1783 | Phage terminase large subunit | Mobilome: prophages, transposons [X] | 3.48 |
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 0.87 |
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 0.87 |
| COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 0.87 |
| COG3728 | Phage terminase, small subunit | Mobilome: prophages, transposons [X] | 0.87 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 54.78 % |
| All Organisms | root | All Organisms | 45.22 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2140918005|contig00927 | Not Available | 836 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10001092 | Not Available | 22280 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10001176 | Not Available | 16167 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10079205 | All Organisms → Viruses → Predicted Viral | 1307 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10119840 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 952 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10006883 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 6771 | Open in IMG/M |
| 3300000223|LPjun09P410mDRAFT_1004091 | Not Available | 1402 | Open in IMG/M |
| 3300000928|OpTDRAFT_10375548 | Not Available | 630 | Open in IMG/M |
| 3300001349|JGI20160J14292_10000216 | Not Available | 54737 | Open in IMG/M |
| 3300001450|JGI24006J15134_10001398 | Not Available | 13740 | Open in IMG/M |
| 3300001450|JGI24006J15134_10006255 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 6131 | Open in IMG/M |
| 3300001450|JGI24006J15134_10047619 | All Organisms → cellular organisms → Bacteria | 1774 | Open in IMG/M |
| 3300001460|JGI24003J15210_10000940 | Not Available | 12617 | Open in IMG/M |
| 3300001589|JGI24005J15628_10002958 | All Organisms → cellular organisms → Bacteria | 8680 | Open in IMG/M |
| 3300001833|ACM24_1001283 | All Organisms → cellular organisms → Bacteria | 6162 | Open in IMG/M |
| 3300005735|Ga0076923_146292 | Not Available | 1025 | Open in IMG/M |
| 3300005821|Ga0078746_1008868 | All Organisms → cellular organisms → Bacteria | 2010 | Open in IMG/M |
| 3300005837|Ga0078893_10448420 | Not Available | 32012 | Open in IMG/M |
| 3300006191|Ga0075447_10065224 | Not Available | 1311 | Open in IMG/M |
| 3300006467|Ga0099972_10166331 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 898 | Open in IMG/M |
| 3300006467|Ga0099972_12886833 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 562 | Open in IMG/M |
| 3300006735|Ga0098038_1000790 | Not Available | 13798 | Open in IMG/M |
| 3300006737|Ga0098037_1001126 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 12435 | Open in IMG/M |
| 3300006737|Ga0098037_1082986 | Not Available | 1123 | Open in IMG/M |
| 3300006737|Ga0098037_1112702 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
| 3300006737|Ga0098037_1251401 | Not Available | 567 | Open in IMG/M |
| 3300006752|Ga0098048_1000504 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 18501 | Open in IMG/M |
| 3300006752|Ga0098048_1002578 | Not Available | 7586 | Open in IMG/M |
| 3300006752|Ga0098048_1044604 | All Organisms → Viruses → Predicted Viral | 1406 | Open in IMG/M |
| 3300006789|Ga0098054_1001850 | Not Available | 10316 | Open in IMG/M |
| 3300006916|Ga0070750_10001619 | Not Available | 12546 | Open in IMG/M |
| 3300006916|Ga0070750_10016237 | Not Available | 3824 | Open in IMG/M |
| 3300006916|Ga0070750_10038361 | All Organisms → cellular organisms → Bacteria | 2361 | Open in IMG/M |
| 3300006920|Ga0070748_1010075 | All Organisms → Viruses → Predicted Viral | 4114 | Open in IMG/M |
| 3300006920|Ga0070748_1070549 | All Organisms → cellular organisms → Bacteria | 1360 | Open in IMG/M |
| 3300009086|Ga0102812_10002057 | Not Available | 13681 | Open in IMG/M |
| 3300009086|Ga0102812_10276827 | Not Available | 913 | Open in IMG/M |
| 3300009136|Ga0118735_10006075 | Not Available | 4037 | Open in IMG/M |
| 3300009428|Ga0114915_1098774 | Not Available | 871 | Open in IMG/M |
| 3300009467|Ga0115565_10513991 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 537 | Open in IMG/M |
| 3300009507|Ga0115572_10459995 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 708 | Open in IMG/M |
| 3300009550|Ga0115013_10025435 | All Organisms → Viruses → Predicted Viral | 3171 | Open in IMG/M |
| 3300010153|Ga0098059_1312362 | Not Available | 600 | Open in IMG/M |
| 3300010430|Ga0118733_107792775 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 555 | Open in IMG/M |
| 3300011118|Ga0114922_10137030 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 2082 | Open in IMG/M |
| 3300011118|Ga0114922_10252540 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium TMED209 | 1478 | Open in IMG/M |
| 3300011126|Ga0151654_1025146 | Not Available | 1639 | Open in IMG/M |
| 3300012952|Ga0163180_10666409 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 799 | Open in IMG/M |
| 3300017697|Ga0180120_10068540 | All Organisms → Viruses → Predicted Viral | 1576 | Open in IMG/M |
| 3300017708|Ga0181369_1000585 | Not Available | 10250 | Open in IMG/M |
| 3300017714|Ga0181412_1004309 | All Organisms → Viruses → Predicted Viral | 4814 | Open in IMG/M |
| 3300017720|Ga0181383_1116587 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 717 | Open in IMG/M |
| 3300017726|Ga0181381_1064920 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 788 | Open in IMG/M |
| 3300017732|Ga0181415_1010289 | Not Available | 2230 | Open in IMG/M |
| 3300017738|Ga0181428_1023288 | All Organisms → Viruses → Predicted Viral | 1434 | Open in IMG/M |
| 3300017756|Ga0181382_1006299 | All Organisms → Viruses → Predicted Viral | 4352 | Open in IMG/M |
| 3300017768|Ga0187220_1237859 | Not Available | 546 | Open in IMG/M |
| 3300017769|Ga0187221_1117375 | Not Available | 804 | Open in IMG/M |
| 3300017782|Ga0181380_1003680 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 6336 | Open in IMG/M |
| 3300019077|Ga0188868_1000108 | All Organisms → Viruses → Predicted Viral | 2354 | Open in IMG/M |
| 3300019751|Ga0194029_1054450 | Not Available | 663 | Open in IMG/M |
| 3300019756|Ga0194023_1062066 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 751 | Open in IMG/M |
| 3300020385|Ga0211677_10007963 | Not Available | 6099 | Open in IMG/M |
| 3300020420|Ga0211580_10390098 | Not Available | 568 | Open in IMG/M |
| 3300020450|Ga0211641_10151815 | Not Available | 1169 | Open in IMG/M |
| 3300021085|Ga0206677_10027873 | Not Available | 3234 | Open in IMG/M |
| 3300021185|Ga0206682_10052584 | Not Available | 2213 | Open in IMG/M |
| 3300021347|Ga0213862_10064442 | All Organisms → Viruses → Predicted Viral | 1299 | Open in IMG/M |
| 3300021364|Ga0213859_10112211 | Not Available | 1291 | Open in IMG/M |
| 3300021373|Ga0213865_10000075 | Not Available | 58833 | Open in IMG/M |
| 3300021373|Ga0213865_10023074 | All Organisms → Viruses → Predicted Viral | 3513 | Open in IMG/M |
| 3300021375|Ga0213869_10000824 | Not Available | 24212 | Open in IMG/M |
| 3300022074|Ga0224906_1134856 | Not Available | 706 | Open in IMG/M |
| (restricted) 3300023112|Ga0233411_10131031 | Not Available | 812 | Open in IMG/M |
| (restricted) 3300023210|Ga0233412_10004958 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 5857 | Open in IMG/M |
| (restricted) 3300023210|Ga0233412_10005783 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 5331 | Open in IMG/M |
| (restricted) 3300023210|Ga0233412_10382110 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 629 | Open in IMG/M |
| (restricted) 3300024062|Ga0255039_10554671 | Not Available | 503 | Open in IMG/M |
| 3300024433|Ga0209986_10319595 | Not Available | 729 | Open in IMG/M |
| (restricted) 3300024519|Ga0255046_10000863 | Not Available | 8424 | Open in IMG/M |
| 3300025026|Ga0207879_101269 | Not Available | 2142 | Open in IMG/M |
| 3300025083|Ga0208791_1000308 | Not Available | 24214 | Open in IMG/M |
| 3300025086|Ga0208157_1001524 | Not Available | 10347 | Open in IMG/M |
| 3300025120|Ga0209535_1012494 | All Organisms → Viruses → Predicted Viral | 4669 | Open in IMG/M |
| 3300025127|Ga0209348_1021753 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 2387 | Open in IMG/M |
| 3300025127|Ga0209348_1053398 | Not Available | 1356 | Open in IMG/M |
| 3300025127|Ga0209348_1078003 | Not Available | 1062 | Open in IMG/M |
| 3300025151|Ga0209645_1017027 | Not Available | 2815 | Open in IMG/M |
| 3300025168|Ga0209337_1005452 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 8677 | Open in IMG/M |
| 3300025276|Ga0208814_1004658 | Not Available | 5422 | Open in IMG/M |
| 3300025276|Ga0208814_1118885 | Not Available | 636 | Open in IMG/M |
| 3300025645|Ga0208643_1123518 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 683 | Open in IMG/M |
| 3300025759|Ga0208899_1003317 | Not Available | 10422 | Open in IMG/M |
| 3300025759|Ga0208899_1035617 | Not Available | 2280 | Open in IMG/M |
| 3300025769|Ga0208767_1116000 | Not Available | 1038 | Open in IMG/M |
| 3300025849|Ga0209603_1000908 | Not Available | 33167 | Open in IMG/M |
| 3300025849|Ga0209603_1172465 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae | 854 | Open in IMG/M |
| 3300025853|Ga0208645_1026961 | Not Available | 3046 | Open in IMG/M |
| 3300026517|Ga0228607_1090389 | Not Available | 769 | Open in IMG/M |
| 3300027506|Ga0208973_1064621 | Not Available | 903 | Open in IMG/M |
| 3300027668|Ga0209482_1000184 | Not Available | 54998 | Open in IMG/M |
| 3300027859|Ga0209503_10060327 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 1741 | Open in IMG/M |
| (restricted) 3300027861|Ga0233415_10685731 | Not Available | 501 | Open in IMG/M |
| 3300028008|Ga0228674_1010330 | Not Available | 4312 | Open in IMG/M |
| 3300028128|Ga0228645_1134788 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 544 | Open in IMG/M |
| 3300029293|Ga0135211_1050433 | Not Available | 526 | Open in IMG/M |
| 3300029318|Ga0185543_1028773 | Not Available | 1262 | Open in IMG/M |
| 3300029318|Ga0185543_1029913 | All Organisms → Viruses → Predicted Viral | 1231 | Open in IMG/M |
| 3300029632|Ga0135266_107470 | Not Available | 738 | Open in IMG/M |
| 3300031519|Ga0307488_10063801 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 2796 | Open in IMG/M |
| 3300031519|Ga0307488_10703366 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 571 | Open in IMG/M |
| 3300031569|Ga0307489_10004421 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 9235 | Open in IMG/M |
| 3300031773|Ga0315332_10466136 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300032373|Ga0316204_10333525 | All Organisms → Viruses → Predicted Viral | 1167 | Open in IMG/M |
| 3300033742|Ga0314858_135991 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 630 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 23.48% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 10.43% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 8.70% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 6.96% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 6.09% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 4.35% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 4.35% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 3.48% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 2.61% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 2.61% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 2.61% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 2.61% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.74% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 1.74% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 1.74% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.74% |
| Marine Harbor | Environmental → Aquatic → Marine → Harbor → Unclassified → Marine Harbor | 1.74% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 0.87% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.87% |
| Marine Plankton | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton | 0.87% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 0.87% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 0.87% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 0.87% |
| Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 0.87% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.87% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 0.87% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.87% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.87% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.87% |
| Freshwater And Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine | 0.87% |
| Coastal Water And Sediment | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Coastal Water And Sediment | 0.87% |
| Marine Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Sediment | 0.87% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2140918005 | Marine sediment microbial communities from Arctic Ocean, off the coast from Alaska - sample from high methane PC12-225-485cm | Environmental | Open in IMG/M |
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300000223 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - June 2009 P4 10m | Environmental | Open in IMG/M |
| 3300000928 | Marine plume microbial communities from the Columbia River - 25 PSU | Environmental | Open in IMG/M |
| 3300001349 | Pelagic Microbial community sample from North Sea - COGITO 998_met_10 | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300001589 | Marine viral communities from the Pacific Ocean - LP-40 | Environmental | Open in IMG/M |
| 3300001833 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM24, ROCA_DNA012_0.2um_2l | Environmental | Open in IMG/M |
| 3300005735 | Seawater microbial communities from Vineyard Sound, MA, USA - control T0 | Environmental | Open in IMG/M |
| 3300005821 | Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 25 cmbsf, PM1 | Environmental | Open in IMG/M |
| 3300005837 | Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18 | Environmental | Open in IMG/M |
| 3300006191 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA | Environmental | Open in IMG/M |
| 3300006467 | Coastal sediment microbial communities from Rhode Island, USA: Combined Assembly of Gp0121717, Gp0123912, Gp0123935 | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300009086 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 | Environmental | Open in IMG/M |
| 3300009136 | Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 82 cmbsf | Environmental | Open in IMG/M |
| 3300009428 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 | Environmental | Open in IMG/M |
| 3300009467 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530 | Environmental | Open in IMG/M |
| 3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
| 3300009550 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300010430 | Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples | Environmental | Open in IMG/M |
| 3300011118 | Deep subsurface microbial communities from Aarhus Bay to uncover new lineages of life (NeLLi) - Aarhus_00045 metaG | Environmental | Open in IMG/M |
| 3300011126 | Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, 0.02 | Environmental | Open in IMG/M |
| 3300012952 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 Metagenome | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017708 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017720 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 | Environmental | Open in IMG/M |
| 3300017726 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 | Environmental | Open in IMG/M |
| 3300017732 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 38 SPOT_SRF_2012-12-11 | Environmental | Open in IMG/M |
| 3300017738 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12 | Environmental | Open in IMG/M |
| 3300017756 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 | Environmental | Open in IMG/M |
| 3300017768 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2) | Environmental | Open in IMG/M |
| 3300017769 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2) | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300019077 | Metatranscriptome of marine microbial communities from Baltic Sea - GS695_0p8 | Environmental | Open in IMG/M |
| 3300019751 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW18Oct16_MG | Environmental | Open in IMG/M |
| 3300019756 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW6Sep16_MG | Environmental | Open in IMG/M |
| 3300020385 | Marine microbial communities from Tara Oceans - TARA_B100001059 (ERX556045-ERR598965) | Environmental | Open in IMG/M |
| 3300020420 | Marine microbial communities from Tara Oceans - TARA_B100001248 (ERX556094-ERR599142) | Environmental | Open in IMG/M |
| 3300020450 | Marine microbial communities from Tara Oceans - TARA_B100000575 (ERX555933-ERR599077) | Environmental | Open in IMG/M |
| 3300021085 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 | Environmental | Open in IMG/M |
| 3300021185 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 | Environmental | Open in IMG/M |
| 3300021347 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266 | Environmental | Open in IMG/M |
| 3300021364 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304 | Environmental | Open in IMG/M |
| 3300021373 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282 | Environmental | Open in IMG/M |
| 3300021375 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132 | Environmental | Open in IMG/M |
| 3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
| 3300023112 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_2_MG | Environmental | Open in IMG/M |
| 3300023210 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MG | Environmental | Open in IMG/M |
| 3300024062 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_1 | Environmental | Open in IMG/M |
| 3300024433 | Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024519 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_27 | Environmental | Open in IMG/M |
| 3300025026 | Marine viral communities from the Pacific Ocean - LP-24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025083 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025127 | Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025276 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 (SPAdes) | Environmental | Open in IMG/M |
| 3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025849 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300026517 | Seawater microbial communities from Monterey Bay, California, United States - 8D | Environmental | Open in IMG/M |
| 3300027506 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_66_BLW_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027668 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027859 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027861 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MG | Environmental | Open in IMG/M |
| 3300028008 | Seawater microbial communities from Monterey Bay, California, United States - 1D_r | Environmental | Open in IMG/M |
| 3300028128 | Seawater microbial communities from Monterey Bay, California, United States - 57D | Environmental | Open in IMG/M |
| 3300029293 | Marine harbor viral communities from the Indian Ocean - SCH2 | Environmental | Open in IMG/M |
| 3300029318 | Marine giant viral communities collected during Tara Oceans survey from station TARA_038 - TARA_Y100000289 | Environmental | Open in IMG/M |
| 3300029632 | Marine harbor viral communities from the Pacific Ocean - SMB3 | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031569 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2 | Environmental | Open in IMG/M |
| 3300031773 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 34915 | Environmental | Open in IMG/M |
| 3300032373 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 2 | Environmental | Open in IMG/M |
| 3300033742 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawater | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ASHM485C_06207380 | 2140918005 | Coastal Water And Sediment | MKEETEFEKMLKRLESQPVPERTCSINDDTCESCSG |
| DelMOSum2010_1000109239 | 3300000101 | Marine | MKEKETEFEKMLRNLESKPVPERTCNIDDETCESCSG* |
| DelMOSpr2010_100011766 | 3300000116 | Marine | MKEETEFEKMLKRLESQEVPERTCNIDDENCESCSG* |
| DelMOSpr2010_100792052 | 3300000116 | Marine | MEEKLTEFEKMLRELENKAVPERTCNIDDENCESCSG* |
| DelMOSpr2010_101198402 | 3300000116 | Marine | MEEKLTEFEKMLKELENKPVPERTCNIDDENCESCSG* |
| DelMOWin2010_100068833 | 3300000117 | Marine | MEEKLTEFEKMLKELEKKPVPERTCNIDDENCESCSG* |
| LPjun09P410mDRAFT_10040913 | 3300000223 | Marine | MEKKQSEFEKMLAELENKPVPERTCNIDDETCESCSG* |
| OpTDRAFT_103755481 | 3300000928 | Freshwater And Marine | MTEETEFEKMLKKLQDKPVPERTCNIDDENCESCSG* |
| JGI20160J14292_1000021633 | 3300001349 | Pelagic Marine | MEEKLTEFEKMLKELENKTVPERTCNIDDENCESCSG* |
| JGI24006J15134_1000139815 | 3300001450 | Marine | MIEEKTEFQKMLERLESQAVPERTCSIDDETCESCSG* |
| JGI24006J15134_100062557 | 3300001450 | Marine | MDNKETEFEKMLRELEKMPVPKRTCNIDDDNCESCSG* |
| JGI24006J15134_100476195 | 3300001450 | Marine | MKEETEFEKMLKRLESETVPERTCSIDDENCESCSG* |
| JGI24003J15210_1000094025 | 3300001460 | Marine | MEKKQSEFEKMLEQLENKPVPERTCNIDDETCESCSG* |
| JGI24005J15628_100029586 | 3300001589 | Marine | MXEEKTEFXKMLERLESQAVPERTCSIDDETCESCSG* |
| ACM24_10012836 | 3300001833 | Marine Plankton | MIEKKTEFEKMLERFEKEPVPERTCNIDDETCESCSG* |
| Ga0076923_1462922 | 3300005735 | Marine | MTEEKTEFEKMLERLEKETVPERTCSIDDDNCESCSG* |
| Ga0078746_10088684 | 3300005821 | Marine Sediment | MIEETEFEKMLKKLQDKPVPERTCNIDDENCESCSG* |
| Ga0078893_1044842037 | 3300005837 | Marine Surface Water | MDKKETEFDKMLRELAKKEVPERQCSIDDEDCESCGA* |
| Ga0075447_100652244 | 3300006191 | Marine | MKEDTEFEKMLKKLQDKPVPERTCNIDDENCESCSG* |
| Ga0099972_101663311 | 3300006467 | Marine | MENKETEFEKMLRELEKMPVPERTCNIDDDNCESCSG* |
| Ga0099972_128868332 | 3300006467 | Marine | MEEKLTEFEKMLKELENKEVPERTCNIDDENCESCSG* |
| Ga0098038_100079013 | 3300006735 | Marine | MIEEKTEFEKMLEKLENKPVPERTCDINDETCESCSG* |
| Ga0098037_10011262 | 3300006737 | Marine | MKNKETEFEKMLRELEKMPVPERTCNIDDDNCESCSG* |
| Ga0098037_10829863 | 3300006737 | Marine | MIEEKTEFQKMLEKLENKPVPERTCDIHDETCESCSG* |
| Ga0098037_11127022 | 3300006737 | Marine | MKEETEFEKMLKRLESQTVPERTCSIDDENCESCSG* |
| Ga0098037_12514012 | 3300006737 | Marine | MIEEKSEFEKMLERLEKETVPERTCSIGDDNCESCSG* |
| Ga0098048_10005047 | 3300006752 | Marine | MEEKLTEFEKMLKNLENKPVPERTCNIDDENCESCSG* |
| Ga0098048_10025789 | 3300006752 | Marine | MIEEKSEFQKMLEKLENQPVPERTCSIDDENCESCSG* |
| Ga0098048_10446042 | 3300006752 | Marine | MEEKLTEFEKMLKELENKAVPERTCNIDDENCESCSG* |
| Ga0098054_10018506 | 3300006789 | Marine | MIEEKSEFQKMLEKLEKQPVPERTCSIDDENCESCSG* |
| Ga0070750_100016196 | 3300006916 | Aqueous | MTEEKTEFEKMLEKLEKQPVPERTCSIDDENCESCSG* |
| Ga0070750_100162379 | 3300006916 | Aqueous | MIEEKSEFEKMLERLEKQTVPERTCSIDDENCESCSG* |
| Ga0070750_100383612 | 3300006916 | Aqueous | MQKKESEFDKMLRDLENKPVPERTCNIDDETCESCSG* |
| Ga0070748_10100752 | 3300006920 | Aqueous | MDNKETEFEKMLRELEKMPVPERTCDIDDDNCESCSG* |
| Ga0070748_10705494 | 3300006920 | Aqueous | MTEEKTEFQKMLEKLEKQPVPERTCSIDDENCESCSG* |
| Ga0102812_100020573 | 3300009086 | Estuarine | MEKKQSEFEKMLAELENKPVPERTCNIDDETCKSCSG* |
| Ga0102812_102768274 | 3300009086 | Estuarine | MIEEKSEFEKMLEKLEKQPVPERTCSIDDENCESCSG* |
| Ga0118735_100060756 | 3300009136 | Marine Sediment | MTEEKTEFQKMLERLESQTVPERTCSIDDETCESCSG* |
| Ga0114915_10987742 | 3300009428 | Deep Ocean | MKEETEFEKMLKRLESQAVPERTCSIDDENCESCSG* |
| Ga0115565_105139912 | 3300009467 | Pelagic Marine | MEEKLTEFEKMLRELENKAVPDRTCNIDDENCESCSG* |
| Ga0115572_104599952 | 3300009507 | Pelagic Marine | MEKKESEFDKMLRDLENKPVPERTCNIDDETCESCSG* |
| Ga0115013_100254353 | 3300009550 | Marine | MEEKLTEFEKMLKELESKPVPERTCNIDDENCESCSG* |
| Ga0098059_13123622 | 3300010153 | Marine | MIEEKSEFEKMLEKLEKEPVPARTCSIDDENCESCSG* |
| Ga0118733_1077927752 | 3300010430 | Marine Sediment | KLTEFEKMLKELEKKPVPERTCNIDDENCESCSG* |
| Ga0114922_101370304 | 3300011118 | Deep Subsurface | RGFIFRKMTEEKTEFEKMLERLEKETVPERTCSIDDDNCESCSG* |
| Ga0114922_102525403 | 3300011118 | Deep Subsurface | MEKKQSEFEKMLEQLENKPVPERTCNIDDENCESCSG* |
| Ga0151654_10251462 | 3300011126 | Marine | MIEEKSEFVIMLEMLESQPVPERTCSIDDENCESCSG* |
| Ga0163180_106664092 | 3300012952 | Seawater | MEEKLTEFEKMLKELENKPVPQRTCNIDDENCESCSG* |
| Ga0180120_100685402 | 3300017697 | Freshwater To Marine Saline Gradient | MEKKETEFDKMLRELEKMPVPERTCNIDDDNCESCSG |
| Ga0181369_10005857 | 3300017708 | Marine | MIEEKTEFEKMLERLEKQTVPERTCSIDDENCESCSG |
| Ga0181412_10043093 | 3300017714 | Seawater | MENKETEFEKMLRELEKMPVPERTCSIDDENCESCSG |
| Ga0181383_11165872 | 3300017720 | Seawater | MEEKLTEFEKMLKELENKTVPQRTCNIDDENCESCSG |
| Ga0181381_10649202 | 3300017726 | Seawater | MEEKLTEFEKMLKELENKPVPQRTCNIDDENCESCSG |
| Ga0181415_10102892 | 3300017732 | Seawater | MIEEKTEFEKMLEKLEKKPVPERTCDIHDETCESCSG |
| Ga0181428_10232883 | 3300017738 | Seawater | LTYLSKEKKSEFEKLLEELEKKKVPARQCNIDDNTCESCSG |
| Ga0181382_10062994 | 3300017756 | Seawater | MEEKLTEFEKMLKELENKAVPKRTCNIDDENCESCSG |
| Ga0187220_12378591 | 3300017768 | Seawater | KKDKSEFEKLLEEAEKKKVPVRQCNIEDTTCESCSG |
| Ga0187221_11173751 | 3300017769 | Seawater | IYRRFIFRKMIEEKTEFQKMLERLESQSVPERTCSIDDETCESCSG |
| Ga0181380_10036803 | 3300017782 | Seawater | MEEKLTEFEKMLKELENKTVPERTCNIDHENCESCSG |
| Ga0188868_10001083 | 3300019077 | Freshwater Lake | MEEKLTEFEKMLRELENKVVPERTCNIDDENCESCSG |
| Ga0194029_10544502 | 3300019751 | Freshwater | MIEEKSEFEKMLEKLEKEPVPERTCSIDDENCESCSG |
| Ga0194023_10620661 | 3300019756 | Freshwater | MEEKLTEFEKMLRELENKAVPERTCNIDDENCESC |
| Ga0211677_100079637 | 3300020385 | Marine | MIEEKSEFQKMLEKLEKQPVPERTCSIDDENCESCSG |
| Ga0211580_103900982 | 3300020420 | Marine | YKSFIFTQMIEEKTEFQKMLEKLEKEPVPERTCNIDDETCESCSG |
| Ga0211641_101518154 | 3300020450 | Marine | MIEEKTEFQKMLEKLENKPVPERTCNIHDETCESCSG |
| Ga0206677_100278734 | 3300021085 | Seawater | MIEEKSEFEKMLEKLEKQPVPERTCSIDDENCESCSG |
| Ga0206682_100525844 | 3300021185 | Seawater | MKEETEFEKMLKRLESQTVPERTCSIDDENCESCSG |
| Ga0213862_100644422 | 3300021347 | Seawater | MKEKLTEFEKMLKELENKTVPERTCNIDDENCESCSG |
| Ga0213859_101122112 | 3300021364 | Seawater | MTEKKTEFEKMLEKLEKEPVPERTCSIDDENCESCSG |
| Ga0213865_1000007558 | 3300021373 | Seawater | MIEKKSEFEKMLEKLEKQTVPERTCSIDDENCESCSG |
| Ga0213865_100230742 | 3300021373 | Seawater | MEEKLTEFEKMLKELENKAVPERTCNIDDENCESCSG |
| Ga0213869_1000082417 | 3300021375 | Seawater | MKEETEFEKMLKRLESQEVPERTCNIDDENCESCSG |
| Ga0224906_11348561 | 3300022074 | Seawater | IYRRFIFRKMIEEKTEFQKMLERLESQAVPERTCSIDDETCESCSG |
| (restricted) Ga0233411_101310312 | 3300023112 | Seawater | MEKKQSEFEKMLAELENKPVPERTCNIDDETCESCSG |
| (restricted) Ga0233412_100049583 | 3300023210 | Seawater | MEEKLTEFEKMLRELENKAVPERTCNIDDENCESCSG |
| (restricted) Ga0233412_100057832 | 3300023210 | Seawater | MKEKETEFEKMLRNLESKPVPERTCNIDDETCESCSG |
| (restricted) Ga0233412_103821102 | 3300023210 | Seawater | MENKETEFEKMLRELEKMPVPERTCNIDDDNCESCSG |
| (restricted) Ga0255039_105546712 | 3300024062 | Seawater | MKEETEFEKMLKRLESETVPERTCSIDDENCESCSG |
| Ga0209986_103195953 | 3300024433 | Deep Subsurface | MIEEKSEFEKMLERLEKETVPERTCSIGDDNCESCSG |
| (restricted) Ga0255046_100008636 | 3300024519 | Seawater | MIEETEFEKMLKKLQDKPVPERTCNIDDENCESCSG |
| Ga0207879_1012695 | 3300025026 | Marine | MIEEKTEFQKMLERLESQAVPERTCSIDDETCESCSG |
| Ga0208791_100030821 | 3300025083 | Marine | MIEEKSEFQKMLEKLENQPVPERTCSIDDENCESCSG |
| Ga0208157_10015246 | 3300025086 | Marine | MIEEKTEFEKMLEKLENKPVPERTCDINDETCESCSG |
| Ga0209535_10124942 | 3300025120 | Marine | MEKKQSEFEKMLEQLENKPVPERTCNIDDETCESCSG |
| Ga0209348_10217534 | 3300025127 | Marine | MIEEKTEFQKMLEKLENKPVPERTCDIHDETCESCSG |
| Ga0209348_10533982 | 3300025127 | Marine | MIEEKTEFQKMLEKLEKEPVPERTCNIDDETCESCSG |
| Ga0209348_10780033 | 3300025127 | Marine | MIEKKSEFEKMLEKLEKEPVPERTCNIDDENCESCSG |
| Ga0209645_10170272 | 3300025151 | Marine | MTEEKTEFEKMLEKLEKTPVPERTCDIHDETCESCSG |
| Ga0209337_10054524 | 3300025168 | Marine | MDNKETEFEKMLRELEKMPVPERTCNIDDDNCESCSG |
| Ga0208814_10046586 | 3300025276 | Deep Ocean | MKEETEFEKMLKKLQDKPVPERTCNIDDENCESCSG |
| Ga0208814_11188852 | 3300025276 | Deep Ocean | MKEETEFEKMLKRLESQAVPERTCSIDDENCESCSG |
| Ga0208643_11235182 | 3300025645 | Aqueous | MDNKETEFEKMLRELEKMPVPERTCDIDDDNCESCSG |
| Ga0208899_100331711 | 3300025759 | Aqueous | MTEEKTEFEKMLEKLEKQPVPERTCSIDDENCESCSG |
| Ga0208899_10356172 | 3300025759 | Aqueous | MQKKESEFDKMLRDLENKPVPERTCNIDDETCESCSG |
| Ga0208767_11160003 | 3300025769 | Aqueous | MIEEKSEFEKMLERLEKQTVPERTCSIDDENCESCSG |
| Ga0209603_100090819 | 3300025849 | Pelagic Marine | MEEKLTEFEKMLKELENKPVPERTCNIDDENCESCSG |
| Ga0209603_11724652 | 3300025849 | Pelagic Marine | MEKKESEFDKMLRDLENKPVPERTCNIDDETCESCSG |
| Ga0208645_10269615 | 3300025853 | Aqueous | MTEEKTEFEKMLERLEKETVPERTCSIDDDNCESCSG |
| Ga0228607_10903892 | 3300026517 | Seawater | MEKKQSEFEKMLEQLENKPVPERTCNIDDETCESCSGXKNLKIQN |
| Ga0208973_10646212 | 3300027506 | Marine | MEKKQSEFEKMLAELENKPVPERTCNIDDETCESCSGXKNLKIQN |
| Ga0209482_100018447 | 3300027668 | Marine | MKEDTEFEKMLKKLQDKPVPERTCNIDDENCESCSG |
| Ga0209503_100603272 | 3300027859 | Marine | MEEKLTEFEKMLKELESKPVPERTCNIDDENCESCSG |
| (restricted) Ga0233415_106857311 | 3300027861 | Seawater | FRKMIEETEFEKMLKKLQDKPVPERTCNIDDENCESCSG |
| Ga0228674_10103305 | 3300028008 | Seawater | MIEEKSEFEKMLEKLEKEPVPARTCSIDDENCESCSG |
| Ga0228645_11347882 | 3300028128 | Seawater | MEKKETEFEKMLRELEKMPVPERTCNIDDDNCESCSG |
| Ga0135211_10504332 | 3300029293 | Marine Harbor | MEEKSEFEKMLEKLEKKPVPERTCNIDDENCESCSG |
| Ga0185543_10287732 | 3300029318 | Marine | MIKEKTEFEKMLEKLEKTPVPERTCDIHDETCESCSG |
| Ga0185543_10299132 | 3300029318 | Marine | MENKETEFEKMLRELEKMPVPKRTCNIDDDNCESCSG |
| Ga0135266_1074703 | 3300029632 | Marine Harbor | MTEETEFEKMLKKLQDKPVPERTCNIDDENCESCSG |
| Ga0307488_100638012 | 3300031519 | Sackhole Brine | MKEIETEFEKMLRNLESKPVPERTCNIDDDNCESCSG |
| Ga0307488_107033661 | 3300031519 | Sackhole Brine | MKDKETEFEKMLRNLESKPVPERTCNIDDETCESCSG |
| Ga0307489_1000442110 | 3300031569 | Sackhole Brine | MKDKETEFEKMLKNLESIPVPERTCNIDDNNCESCSG |
| Ga0315332_104661363 | 3300031773 | Seawater | YLSKTKKTEFEKLLEELEKKPVPVRQCNIDDNNCESCSG |
| Ga0316204_103335252 | 3300032373 | Microbial Mat | MKNKETEFEKMLRELEKMPVPERTCNIDEDNCESCSG |
| Ga0314858_135991_295_408 | 3300033742 | Sea-Ice Brine | MEEKLTEFEKMLKELENKPIPERTCNIDDDNCESCSG |
| ⦗Top⦘ |