


| Basic Information | |
|---|---|
| Family ID | F080157 |
| Family Type | Metagenome |
| Number of Sequences | 115 |
| Average Sequence Length | 40 residues |
| Representative Sequence | SQVRIKPHYDKWTITVIEDIEEGEELTLKYKLYDPEKK |
| Number of Associated Samples | 74 |
| Number of Associated Scaffolds | 115 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 97.39 % |
| % of genes from short scaffolds (< 2000 bps) | 94.78 % |
| Associated GOLD sequencing projects | 66 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.13 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (69.565 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (46.956 % of family members) |
| Environment Ontology (ENVO) | Unclassified (97.391 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (91.304 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 7.58% β-sheet: 0.00% Coil/Unstructured: 92.42% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.13 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 115 Family Scaffolds |
|---|---|---|
| PF00856 | SET | 3.48 |
| PF02195 | ParBc | 3.48 |
| PF13640 | 2OG-FeII_Oxy_3 | 2.61 |
| PF00145 | DNA_methylase | 0.87 |
| PF04471 | Mrr_cat | 0.87 |
| PF03592 | Terminase_2 | 0.87 |
| PF00961 | LAGLIDADG_1 | 0.87 |
| COG ID | Name | Functional Category | % Frequency in 115 Family Scaffolds |
|---|---|---|---|
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 0.87 |
| COG3728 | Phage terminase, small subunit | Mobilome: prophages, transposons [X] | 0.87 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 69.57 % |
| All Organisms | root | All Organisms | 30.43 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 46.96% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine | 18.26% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 14.78% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 9.57% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 1.74% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.74% |
| Filtered Seawater | Environmental → Aquatic → Marine → Unclassified → Unclassified → Filtered Seawater | 1.74% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.87% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 0.87% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 0.87% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.87% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.87% |
| Hydrothermal Vent Plume | Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vent Plume | 0.87% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001589 | Marine viral communities from the Pacific Ocean - LP-40 | Environmental | Open in IMG/M |
| 3300001683 | Hydrothermal vent plume microbial communities from Guaymas Basin, Gulf of California - IDBA assembly | Environmental | Open in IMG/M |
| 3300001728 | Marine viral communities from the Pacific Ocean - LP-46 | Environmental | Open in IMG/M |
| 3300001731 | Marine viral communities from the Pacific Ocean - LP-37 | Environmental | Open in IMG/M |
| 3300001743 | Marine viral communities from the Pacific Ocean - LP-38 | Environmental | Open in IMG/M |
| 3300002511 | Marine viral communities from the Pacific Ocean - ETNP_2_1000 | Environmental | Open in IMG/M |
| 3300002760 | Marine viral communities from the Pacific Ocean - ETNP_6_1000 | Environmental | Open in IMG/M |
| 3300006306 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_1_0500m | Environmental | Open in IMG/M |
| 3300006308 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_2_0500m | Environmental | Open in IMG/M |
| 3300006310 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_3_0500m | Environmental | Open in IMG/M |
| 3300006324 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_1_0500m | Environmental | Open in IMG/M |
| 3300006325 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_1_0500m | Environmental | Open in IMG/M |
| 3300006335 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT232_2_0500m | Environmental | Open in IMG/M |
| 3300006336 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_2_0500m | Environmental | Open in IMG/M |
| 3300006338 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT232_1_0770m | Environmental | Open in IMG/M |
| 3300006340 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_2_0770m | Environmental | Open in IMG/M |
| 3300006750 | Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG | Environmental | Open in IMG/M |
| 3300006751 | Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG | Environmental | Open in IMG/M |
| 3300006754 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
| 3300008217 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_215 | Environmental | Open in IMG/M |
| 3300008219 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_b05 | Environmental | Open in IMG/M |
| 3300008220 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_908 | Environmental | Open in IMG/M |
| 3300009412 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s2 | Environmental | Open in IMG/M |
| 3300009418 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s17 | Environmental | Open in IMG/M |
| 3300009604 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s16 | Environmental | Open in IMG/M |
| 3300009605 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9 | Environmental | Open in IMG/M |
| 3300009786 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300010155 | Marine viral communities from the Subarctic Pacific Ocean - 12_ETSP_OMZ_AT15267 metaG | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
| 3300017715 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_06 viral metaG | Environmental | Open in IMG/M |
| 3300017719 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 | Environmental | Open in IMG/M |
| 3300017727 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20 | Environmental | Open in IMG/M |
| 3300017731 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16 | Environmental | Open in IMG/M |
| 3300017750 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29 | Environmental | Open in IMG/M |
| 3300017752 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22 | Environmental | Open in IMG/M |
| 3300017764 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11 | Environmental | Open in IMG/M |
| 3300017771 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13 | Environmental | Open in IMG/M |
| 3300017773 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24 | Environmental | Open in IMG/M |
| 3300017775 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 55 SPOT_SRF_2014-07-17 | Environmental | Open in IMG/M |
| 3300021084 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 | Environmental | Open in IMG/M |
| 3300024520 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_1 | Environmental | Open in IMG/M |
| 3300025042 | Marine viral communities from the Pacific Ocean - LP-47 (SPAdes) | Environmental | Open in IMG/M |
| 3300025045 | Marine viral communities from the Pacific Ocean - LP-46 (SPAdes) | Environmental | Open in IMG/M |
| 3300025046 | Marine viral communities from the Pacific Ocean - LP-45 (SPAdes) | Environmental | Open in IMG/M |
| 3300025047 | Marine viral communities from the Pacific Ocean - LP-42 (SPAdes) | Environmental | Open in IMG/M |
| 3300025050 | Marine viral communities from the Pacific Ocean - LP-54 (SPAdes) | Environmental | Open in IMG/M |
| 3300025052 | Marine viral communities from the Pacific Ocean - LP-37 (SPAdes) | Environmental | Open in IMG/M |
| 3300025112 | Marine viral communities from the Pacific Ocean - ETNP_2_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300025118 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025122 | Marine viral communities from the Pacific Ocean - ETNP_2_300 (SPAdes) | Environmental | Open in IMG/M |
| 3300025125 | Marine viral communities from the Pacific Ocean - ETNP_2_1000 (SPAdes) | Environmental | Open in IMG/M |
| 3300025131 | Marine viral communities from the Pacific Ocean - ETNP_6_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025241 | Marine viral communities from the Deep Pacific Ocean - MSP-121 (SPAdes) | Environmental | Open in IMG/M |
| 3300025251 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_906 (SPAdes) | Environmental | Open in IMG/M |
| 3300025264 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025277 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s16 (SPAdes) | Environmental | Open in IMG/M |
| 3300025280 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s17 (SPAdes) | Environmental | Open in IMG/M |
| 3300025300 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s6 (SPAdes) | Environmental | Open in IMG/M |
| 3300025301 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_908 (SPAdes) | Environmental | Open in IMG/M |
| 3300025873 | Marine viral communities from the Pacific Ocean - ETNP_6_1000 (SPAdes) | Environmental | Open in IMG/M |
| 3300027838 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300029787 | Marine viral communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000172 | Environmental | Open in IMG/M |
| 3300031701 | Marine microbial communities from Western Arctic Ocean, Canada - AG5_Bottom | Environmental | Open in IMG/M |
| 3300031801 | Marine microbial communities from Western Arctic Ocean, Canada - CB27_Tmax_986 | Environmental | Open in IMG/M |
| 3300032820 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - S1503-DNA-20-500_MG | Environmental | Open in IMG/M |
| 3300033742 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawater | Environmental | Open in IMG/M |
| 3300034629 | Seawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 543_2600 | Environmental | Open in IMG/M |
| 3300034655 | Seawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 494_2800 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI24005J15628_101357003 | 3300001589 | Marine | RLKPGFDKWIITVVEDINPGDELTLKYTMYDPRK* |
| GBIDBA_101183963 | 3300001683 | Hydrothermal Vent Plume | MPNCVRNQVRIRPGFDRWNITVIEDIEEGDELTLKYKLYVPTTN* |
| JGI24521J20086_10033254 | 3300001728 | Marine | QIRVKPNFDKWSIMTLEDIEEGDELTLKYKLYDPKKI* |
| JGI24521J20086_10047523 | 3300001728 | Marine | VRNQIRIRPGFDRWNIVIIEDIEEGDELTLKYKLYDPEKK* |
| JGI24521J20086_10199171 | 3300001728 | Marine | TPNCQRNQVRIRPGFDRWNITVIEDVEEGDELTLKYKLYDPKA* |
| JGI24514J20073_10041836 | 3300001731 | Marine | EPNCERSQVRIRPGFDKWNIMVIEDIDEGSELTLKYKLYDPKT* |
| JGI24515J20084_10234782 | 3300001743 | Marine | CSRAQVRIRPHYDKWNITVIEDIDEGEELTLKYKMYDPQKK* |
| JGI25131J35506_10171501 | 3300002511 | Marine | DEPNCVRNQIRIRPGFDKWNLVVIEDIEEGEELTLKYKMYDPKKI* |
| JGI25136J39404_10227581 | 3300002760 | Marine | NCIRNQIRIRPGFDKWNLVVIEDIEEGEELTLKYKMYDPKKI* |
| JGI25136J39404_10421903 | 3300002760 | Marine | RPGFDKWNITVMEDIEEGEELTLKYKLYDPEKKNDLHRNL* |
| JGI25136J39404_10549343 | 3300002760 | Marine | MKPNCLKNQIRIKPGFDKWNLTVIEDIEEGSELTLKYTWYEPRRN* |
| Ga0068469_11398051 | 3300006306 | Marine | KPNCVKSQVRVKPHYDKWTITVIEDIEEGEELTLKYTMYDPEKK* |
| Ga0068469_14259502 | 3300006306 | Marine | PNCVRNQVRIKPGFDRWNIVVIEDIEEGDELTLKYKMYDPEIK* |
| Ga0068469_14347891 | 3300006306 | Marine | QIRVKPGYDKWRNMTLEDIEEGDEFTLKYKLYDPKKI* |
| Ga0068470_12262192 | 3300006308 | Marine | VKPGFDKWSIMTLEDIEEGDELTLKYKLYDPKKI* |
| Ga0068470_14180914 | 3300006308 | Marine | PNCQRSQIRVKPEFDKWSIMTLEDIEEGDELTLKYKLYDPEKK* |
| Ga0068471_11634361 | 3300006310 | Marine | NCQRSQIRVKPGFDKWSIMTLEDIEEGEELTLKYKLYVPEKIK* |
| Ga0068471_13585391 | 3300006310 | Marine | VKSQVRVKPHYDKWTITVIEDIEEGEELTLKYTMYDPEKNTR* |
| Ga0068476_13375871 | 3300006324 | Marine | RIRPGFDRWNIVVIEDIEEGEELTLKYKLYDPKKI* |
| Ga0068501_14797941 | 3300006325 | Marine | SQVRVKPHYDKWTITVIEDIEEGEELTLKYKLYDPEKI* |
| Ga0068501_15477661 | 3300006325 | Marine | QVRIKPHYDKWTITVIDDIEEGDELTLKYKLYDPKKI* |
| Ga0068480_14641562 | 3300006335 | Marine | RVKPGYDKWSIMTLEDIEEGEELTLKYKLYDPKKI* |
| Ga0068502_14536221 | 3300006336 | Marine | RVKPGYDKWSIMTLDDIEEGDELTLKYKLYDPKKI* |
| Ga0068502_17971373 | 3300006336 | Marine | VKPGYDKWSIMTLDDIDEGEELTLKYKLYDPEKK* |
| Ga0068502_19042362 | 3300006336 | Marine | RHQVRVKPGFDKWSIMTLEDIEEGDELTLKYKLYDPEKK* |
| Ga0068482_15506431 | 3300006338 | Marine | SQVRIKPGFDKWTITIIEDIEEGDELTLKYKLYDPKKI* |
| Ga0068482_17954762 | 3300006338 | Marine | SQYRIRPHYDKWTITVIEDIEEGEELTLKYTMYDPEKK* |
| Ga0068503_104748772 | 3300006340 | Marine | NCLRSQVRIKPHYDKWTITVTEDIEEGEELTLKYTMYDPEKK* |
| Ga0068503_105419581 | 3300006340 | Marine | RSQVRIKPHYDKWIITVIEDIDEGEELTLKYKMYDPEKK* |
| Ga0068503_105852352 | 3300006340 | Marine | ERFQVRVKPGIDKWSIIVIEDIEEGEELTLKYKMYDPEKK* |
| Ga0068503_105916033 | 3300006340 | Marine | CVRSQVRIKPHYDKWTITVIEDIEEGEELTLKYTMYDPEKNTR* |
| Ga0068503_106169301 | 3300006340 | Marine | RIKPHYDKWTITVIEDIEEGEELTLKYTMYDPEKKNTR* |
| Ga0068503_110154261 | 3300006340 | Marine | CQRSQVRIKPGFDKWSIMTLEDIEEGEELTLKYKLYVPEKI* |
| Ga0098058_11397392 | 3300006750 | Marine | QVRVKPHYDKWTITVVEDIEEGEELTLKYTWYDPQKK* |
| Ga0098040_10214581 | 3300006751 | Marine | RVKPGFDKWNIMLLEDIEEGEELTLKYKMYDPEKK* |
| Ga0098044_13574101 | 3300006754 | Marine | TPNCQRSQIRVKPGFDKWGVMTLEDIEEGEELTLKYKLYVPKA* |
| Ga0098044_14127003 | 3300006754 | Marine | RVKPGFDKWSIMTLEDIEEGSELTLKYKLYDPKK* |
| Ga0098054_12056242 | 3300006789 | Marine | VRVRPHYDKWTITVIEDIEEGEELTLKYTMYDPEKK* |
| Ga0098054_13054121 | 3300006789 | Marine | QIRIRPGFDKWNLMVIEDIEEGEELTLKYKLYDPEKTNTR* |
| Ga0098055_13854191 | 3300006793 | Marine | IRIKPGLDKWNLMVIEDIEEGSELTLKYKLYVPEKT* |
| Ga0098036_12459841 | 3300006929 | Marine | PNCSRAQVRIRPHYDKWNITVIEDIDEGEELTLKYKMYDPSKD* |
| Ga0098036_12561362 | 3300006929 | Marine | SDEPNCQRHQVRVKPGYDKWSVMTLEDIEEGEELTLKYKLYDPKK* |
| Ga0114899_11623311 | 3300008217 | Deep Ocean | EPNCQRSQIRVKPGFDKWSITVIEDIEEGDELTLKYKMYDPEKK* |
| Ga0114905_11166101 | 3300008219 | Deep Ocean | QRSQIRVKPGYDKWSIMTLEDIEEGEELTLKYKLYVPEKI* |
| Ga0114905_11639301 | 3300008219 | Deep Ocean | TPNCIKNQIRIKPYYDKWNLVVIEDIDEGEELTLKYTWYDPEKI* |
| Ga0114910_10283101 | 3300008220 | Deep Ocean | CQRSQIRVKPGYDKWSIMTLEDIEEGEELTLKYKLYAPR* |
| Ga0114903_11061621 | 3300009412 | Deep Ocean | IRVKPGYDKWSIMTLEDIEEGEELTLKYKLYDPEKIK* |
| Ga0114908_12530841 | 3300009418 | Deep Ocean | EPNCQRSQIRIRPGFDKWNVIVLEDIEEGDELTLKYRLYDPKKKNTH* |
| Ga0114901_10742763 | 3300009604 | Deep Ocean | VRIKPHYDKWTITVIEDIEEGEELTLKYTMYVPEKK* |
| Ga0114906_10242474 | 3300009605 | Deep Ocean | IKPHYDKWTITVIEDIEEGEELTLKYTMYDPQKE* |
| Ga0114906_10405791 | 3300009605 | Deep Ocean | IKPGFDKWIITVIEDVNPGDELTLKYTMYDPKKV* |
| Ga0114906_10896871 | 3300009605 | Deep Ocean | PNCVKSQVRIKPHYDKWTITVTEDIEEGEELTLKYKLYDPEKK* |
| Ga0114999_107711812 | 3300009786 | Marine | VRIRPGFDKWNITVMEDIEEGDELTLKYKLYVPEKI* |
| Ga0098059_13309491 | 3300010153 | Marine | VRIKPHYDKWTITVIEDIEEGEELTIKYTMYDPEKKNTR* |
| Ga0098059_13368813 | 3300010153 | Marine | ETPNCKRNQIRIKPYYDKWNLLVIEDIEEGEELTLKYTMYDPEKNTR* |
| Ga0098047_100516261 | 3300010155 | Marine | SQVRVKPHYDKWTITVVEDIEEGEELTLKYTMYDPEKK* |
| Ga0133547_111768981 | 3300010883 | Marine | RSQVRIRPGFDKWSITVIEDIEEGDELTLKYKLYVPEKK* |
| Ga0181391_10294421 | 3300017713 | Seawater | HSDKPNCYRSQVRIKPGFDKWIITVIEDVNPGDELTLKYTMYDPKKV |
| Ga0181370_10346972 | 3300017715 | Marine | SKSQVRVKPHYDKWTITVVEDIEEGEELTLKYTMYDPEKI |
| Ga0181390_10915641 | 3300017719 | Seawater | YRSQVRIKPGFDKWIITVIEDINPGDELTLKYTMYDPKKV |
| Ga0181401_11420201 | 3300017727 | Seawater | DEPNCHRAQARIRQGFDKWFITVVEDVDEGEELTLKYILYDPK |
| Ga0181416_10050361 | 3300017731 | Seawater | RSQVRIKPGFDKWIITVIEDINPGDELTLKYTMYDPKKV |
| Ga0181405_10580711 | 3300017750 | Seawater | KPNCHRSQVRLKPGFDKWIITVVEDVNPGDELTLKYTMYDPAK |
| Ga0181400_11707644 | 3300017752 | Seawater | RAQARIRQGFDKWFITVVEDVDEGEELTLKYILYDPK |
| Ga0181385_10461114 | 3300017764 | Seawater | KDHSDKPNCHRSQIRVKPGFDKWTITVVEDVSPGDELTLKYTMYDPRK |
| Ga0181385_10964721 | 3300017764 | Seawater | PNCHRSQIRVKPGLDKWIITVVEDVNPGDELTLKYTMYDPRK |
| Ga0181425_10085321 | 3300017771 | Seawater | RSQIRVKPGLDKWIITVVEDVNPGDELTLKYTMYDPAK |
| Ga0181386_10502591 | 3300017773 | Seawater | NCHRSQIRVKPGLDKWIITVVEDINPGDELTLKYTMYDPRK |
| Ga0181432_11426252 | 3300017775 | Seawater | NPNCVKSQVRVKPHYDKWTITITEDIEEGEELTLKYTMYDPEKK |
| Ga0206678_102455263 | 3300021084 | Seawater | RNQIRIKPGFDKWNLVVIEDIEEGEELTLKYKLYDPKNK |
| (restricted) Ga0255047_101203751 | 3300024520 | Seawater | SDEPNCVRNQVRIRPGFDRWNIVVIEDIEEGDELTLKYKLYDPK |
| (restricted) Ga0255047_102941551 | 3300024520 | Seawater | QVRIKPGFDRWNIVVIDDIEEGDELTLKYKLYDPKT |
| Ga0207889_10228342 | 3300025042 | Marine | ETPNCQRNQVRIRPGLDRWNVTVIEDIEEGEELTLKYKLYNPRKD |
| Ga0207901_10076471 | 3300025045 | Marine | RVQVRIRPGFDRWNVTVIEDIEEGDELTLKYKLYDPKT |
| Ga0207901_10406023 | 3300025045 | Marine | ETPNCERSQVRIRPGFDRWNITVMEDIEEGEELTLKYKLYDPEKKNTH |
| Ga0207902_10110642 | 3300025046 | Marine | EPNCVRNQIRIKPGFDKWNLVVIEDIEEGEELTLKYKMYDPRKD |
| Ga0207902_10124622 | 3300025046 | Marine | LRIRPGFDKWNLVVIEDIEEGEELTLKYKLYKPQS |
| Ga0207902_10328622 | 3300025046 | Marine | CVRSQVRIKPHYDKWTITVTEDIEEGEELTLKYTMYDPEKK |
| Ga0207897_1261162 | 3300025047 | Marine | SQIRVKPDFDKWSIITLEDIDEGDELTLKYKLYDPKK |
| Ga0207892_10175611 | 3300025050 | Marine | PNCVRNQLRIRPGFDKWNLVVIEDIEEGEELTLKYKLYKPQS |
| Ga0207906_10027521 | 3300025052 | Marine | PNCERSQVRIRPGFDRWNIVVIEDIEEGDELTLKYKLYDPKK |
| Ga0209349_11864671 | 3300025112 | Marine | NHADEPNCVRNQIRIRPGFDKWKLLVIEDIEEGGELTLKYKLYKPQS |
| Ga0208790_10971073 | 3300025118 | Marine | NCVKNQVRIKPYYDKWNLVVIEDIEEGSELTLKYTWYEPRKN |
| Ga0208790_11742733 | 3300025118 | Marine | SETPNCVKNQVRIKPYYDKWNLVVIEDIEEGSELTLKYTWYEPRRN |
| Ga0209535_11751042 | 3300025120 | Marine | RSQIRVKPGFDKWTITVVEDVSPGDELTLKYTMYDPRK |
| Ga0209434_10561313 | 3300025122 | Marine | PNCKRNQIRIKPYYDKWNLLVIEDIEEGDELTLKYTWYDPQKK |
| Ga0209644_10354324 | 3300025125 | Marine | DEPNCVRNQIRIKPYYDKWKLVVIKDIDEGEELTLKYKMYDPKKI |
| Ga0209644_10367043 | 3300025125 | Marine | TQIRVRPGFDRWNLTVVDDIEEGCELTLKYKLYVPKK |
| Ga0209644_11013051 | 3300025125 | Marine | NEPNCLRSQVRIKPHYDKWTITVTEDIEEGEELTLKYTMYDPTKI |
| Ga0209644_11775751 | 3300025125 | Marine | PNCVRSQYRIRPHYDKWTITIIEDIEEGEELTLKYTMYDPEKK |
| Ga0209128_10968123 | 3300025131 | Marine | RIKPYYDKWNLVVIEDIEEGSELTLKYTWYEPRRN |
| Ga0207893_10229903 | 3300025241 | Deep Ocean | CLRSQIRIKPHYDKWTITVTEDIEEGEELTLKYTMYDPEKK |
| Ga0208182_11002152 | 3300025251 | Deep Ocean | EPNCVKSQIRIKPHYDKWTITVVEDIEEGEELTLKYTMYDPQKK |
| Ga0208029_10496752 | 3300025264 | Deep Ocean | SQIRVKPGYDKWSIMTLEDIEEGEELTLKYKLYDPKKK |
| Ga0208180_10921491 | 3300025277 | Deep Ocean | RSQVRIKPHYDKWTITVIEDIEEGEELTLKYTMYDPQK |
| Ga0208449_10567563 | 3300025280 | Deep Ocean | SQVRIKPHYDKWTITVIEDIEEGEELTLKYKLYDPEKK |
| Ga0208181_10640571 | 3300025300 | Deep Ocean | VRVKPGYDKWSVMTLEDIEEGEELTLKYKLYDPKKS |
| Ga0208450_10428693 | 3300025301 | Deep Ocean | RHQIRVKPGYDKWSVMTLEDIEEGEELTLKYKLYDPKKS |
| Ga0209757_100078227 | 3300025873 | Marine | NQIRIRPGFDKWNITVIEDIEEGEELTLKYKLYDPEKI |
| Ga0209757_100480364 | 3300025873 | Marine | LKNQIRIKPGFDKWNLTVMEDIEEGSELTLKYTWYEPRGKIDEE |
| Ga0209757_100884692 | 3300025873 | Marine | VRNQIRIRPGFDKWNLVVIEDIEEGEELTLKYKMYDPEK |
| Ga0209757_100898111 | 3300025873 | Marine | CQRSQVRIRPGFDKWNITVMEDIEEGEELTLKYKLYDPEKKNDLHRNL |
| Ga0209757_101350332 | 3300025873 | Marine | ETPNCQRSQVRIKPGFDKWNITVIEDIDEGEELTLKYKLYDPRKD |
| Ga0209757_101590611 | 3300025873 | Marine | SQIRIRPGFDKWNITVMEDIEEGDELTLKYKLYDPRTNS |
| Ga0209757_101822762 | 3300025873 | Marine | PNCQRSQIRIRPGFDKWNLMVIEDIEEGEELTLKYKLYDPEK |
| Ga0209757_103116361 | 3300025873 | Marine | HADEPNCQRSQVRIRPGFDKWNITVMEDIEEGEELTLKYKLYDPEKK |
| Ga0209089_101024192 | 3300027838 | Marine | DEPNCERSQVRIRPGFDKWNIIVIEDIDEGSELTLKYKLYDPEK |
| Ga0183757_10682552 | 3300029787 | Marine | RSQVRIKPGFDKWIITVVEDVNPGDELTLKYTMYDPKKV |
| Ga0302120_103639473 | 3300031701 | Marine | NCHRSQARIKEGFDKWFITVMEDIEEGDELTLKYILYDPK |
| Ga0310121_101915791 | 3300031801 | Marine | QRIKDRIRPGFDKWSITVMEDIEEGGELTLKYKLYVPKK |
| Ga0310121_101950043 | 3300031801 | Marine | ERSQVRIRSGFDKWNIIVTEDIEEGEELTLKYKLYDPKK |
| Ga0310342_1020443212 | 3300032820 | Seawater | NCVRSQVRIKPHYDKWTITVVEDIEEGEELTLKYTMYDPKNKS |
| Ga0314858_101331_594_731 | 3300033742 | Sea-Ice Brine | DEPNCERSQVRIRPGFDKWNIIVIEDIDEGSELTLKYKLYNPGKN |
| Ga0326756_014207_804_914 | 3300034629 | Filtered Seawater | RVRPGFDRWNLTVMEDIEEGEELTLKYKLYAPTIRK |
| Ga0326746_002060_1703_1822 | 3300034655 | Filtered Seawater | QIRVKPHYDKWTITVVEDIEEGEELTLKYTMYDPEKKNN |
| ⦗Top⦘ |