


| Basic Information | |
|---|---|
| Family ID | F080103 |
| Family Type | Metagenome |
| Number of Sequences | 115 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MKITALDTYFLSAPLPQPVRTSTSTISRVSELIVRLTTDA |
| Number of Associated Samples | 95 |
| Number of Associated Scaffolds | 115 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 80.87 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 86.96 % |
| Associated GOLD sequencing projects | 93 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (87.826 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (20.870 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.565 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.783 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 47.06% Coil/Unstructured: 52.94% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 115 Family Scaffolds |
|---|---|---|
| PF00496 | SBP_bac_5 | 14.78 |
| PF13458 | Peripla_BP_6 | 6.09 |
| PF02538 | Hydantoinase_B | 5.22 |
| PF02515 | CoA_transf_3 | 5.22 |
| PF03446 | NAD_binding_2 | 4.35 |
| PF01027 | Bax1-I | 4.35 |
| PF01266 | DAO | 4.35 |
| PF12867 | DinB_2 | 3.48 |
| PF04392 | ABC_sub_bind | 2.61 |
| PF00588 | SpoU_methylase | 2.61 |
| PF11794 | HpaB_N | 2.61 |
| PF04072 | LCM | 1.74 |
| PF00144 | Beta-lactamase | 1.74 |
| PF14595 | Thioredoxin_9 | 1.74 |
| PF00296 | Bac_luciferase | 1.74 |
| PF04909 | Amidohydro_2 | 1.74 |
| PF05685 | Uma2 | 1.74 |
| PF14833 | NAD_binding_11 | 0.87 |
| PF03795 | YCII | 0.87 |
| PF00440 | TetR_N | 0.87 |
| PF13602 | ADH_zinc_N_2 | 0.87 |
| PF02668 | TauD | 0.87 |
| PF01850 | PIN | 0.87 |
| PF01408 | GFO_IDH_MocA | 0.87 |
| PF10066 | DUF2304 | 0.87 |
| PF00753 | Lactamase_B | 0.87 |
| PF02746 | MR_MLE_N | 0.87 |
| PF03841 | SelA | 0.87 |
| PF02012 | BNR | 0.87 |
| PF13378 | MR_MLE_C | 0.87 |
| PF07366 | SnoaL | 0.87 |
| PF01425 | Amidase | 0.87 |
| PF13365 | Trypsin_2 | 0.87 |
| PF15902 | Sortilin-Vps10 | 0.87 |
| PF13495 | Phage_int_SAM_4 | 0.87 |
| PF00561 | Abhydrolase_1 | 0.87 |
| COG ID | Name | Functional Category | % Frequency in 115 Family Scaffolds |
|---|---|---|---|
| COG0146 | N-methylhydantoinase B/oxoprolinase/acetone carboxylase, alpha subunit | Amino acid transport and metabolism [E] | 10.43 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 5.22 |
| COG0219 | tRNA(Leu) C34 or U34 (ribose-2'-O)-methylase TrmL, contains SPOUT domain | Translation, ribosomal structure and biogenesis [J] | 2.61 |
| COG0565 | tRNA C32,U32 (ribose-2'-O)-methylase TrmJ or a related methyltransferase | Translation, ribosomal structure and biogenesis [J] | 2.61 |
| COG0566 | tRNA G18 (ribose-2'-O)-methylase SpoU | Translation, ribosomal structure and biogenesis [J] | 2.61 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 2.61 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 1.74 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 1.74 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 1.74 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 1.74 |
| COG3315 | O-Methyltransferase involved in polyketide biosynthesis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.74 |
| COG4636 | Endonuclease, Uma2 family (restriction endonuclease fold) | General function prediction only [R] | 1.74 |
| COG4948 | L-alanine-DL-glutamate epimerase or related enzyme of enolase superfamily | Cell wall/membrane/envelope biogenesis [M] | 1.74 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.87 |
| COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 0.87 |
| COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.87 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.87 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 87.83 % |
| Unclassified | root | N/A | 12.17 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2067725002|GPICC_F5MS3JC01EDP4P | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300000559|F14TC_102178292 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 612 | Open in IMG/M |
| 3300004156|Ga0062589_101643514 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300005167|Ga0066672_10488059 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300005175|Ga0066673_10585188 | Not Available | 651 | Open in IMG/M |
| 3300005332|Ga0066388_101626668 | Not Available | 1138 | Open in IMG/M |
| 3300005444|Ga0070694_100711093 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 818 | Open in IMG/M |
| 3300005450|Ga0066682_10020143 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3760 | Open in IMG/M |
| 3300005467|Ga0070706_100623997 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
| 3300005552|Ga0066701_10607839 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300005618|Ga0068864_100178220 | All Organisms → cellular organisms → Bacteria | 1941 | Open in IMG/M |
| 3300005713|Ga0066905_101007554 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 735 | Open in IMG/M |
| 3300005713|Ga0066905_101627001 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300005764|Ga0066903_103432695 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 855 | Open in IMG/M |
| 3300005764|Ga0066903_106304506 | Not Available | 619 | Open in IMG/M |
| 3300005764|Ga0066903_107061925 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300006358|Ga0068871_101890937 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300006794|Ga0066658_10409278 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300006797|Ga0066659_10515968 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 960 | Open in IMG/M |
| 3300006797|Ga0066659_11036662 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 685 | Open in IMG/M |
| 3300006844|Ga0075428_101424285 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300006845|Ga0075421_101502668 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300006865|Ga0073934_10287095 | All Organisms → cellular organisms → Bacteria | 1059 | Open in IMG/M |
| 3300006880|Ga0075429_101612891 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300006903|Ga0075426_10037733 | All Organisms → cellular organisms → Bacteria | 3455 | Open in IMG/M |
| 3300006904|Ga0075424_100589908 | All Organisms → cellular organisms → Bacteria | 1187 | Open in IMG/M |
| 3300006904|Ga0075424_101942630 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300007255|Ga0099791_10420635 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300007265|Ga0099794_10362683 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300009090|Ga0099827_10403872 | Not Available | 1168 | Open in IMG/M |
| 3300009092|Ga0105250_10576650 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 519 | Open in IMG/M |
| 3300009100|Ga0075418_10850574 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 985 | Open in IMG/M |
| 3300009148|Ga0105243_10820326 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 918 | Open in IMG/M |
| 3300009162|Ga0075423_11987991 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300009806|Ga0105081_1039108 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 657 | Open in IMG/M |
| 3300010043|Ga0126380_10011601 | All Organisms → cellular organisms → Bacteria | 3978 | Open in IMG/M |
| 3300010043|Ga0126380_10997401 | Not Available | 705 | Open in IMG/M |
| 3300010043|Ga0126380_11365295 | Not Available | 620 | Open in IMG/M |
| 3300010046|Ga0126384_11388172 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 654 | Open in IMG/M |
| 3300010047|Ga0126382_10286229 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1229 | Open in IMG/M |
| 3300010047|Ga0126382_10356594 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1123 | Open in IMG/M |
| 3300010047|Ga0126382_12319893 | Not Available | 519 | Open in IMG/M |
| 3300010303|Ga0134082_10018040 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2582 | Open in IMG/M |
| 3300010359|Ga0126376_10831991 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 905 | Open in IMG/M |
| 3300010360|Ga0126372_10055585 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2714 | Open in IMG/M |
| 3300010360|Ga0126372_11722476 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300010361|Ga0126378_13314166 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium 13_1_40CM_2_61_4 | 512 | Open in IMG/M |
| 3300010362|Ga0126377_11121454 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
| 3300010362|Ga0126377_11750288 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 697 | Open in IMG/M |
| 3300010362|Ga0126377_12069087 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300010366|Ga0126379_11166892 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300010375|Ga0105239_12106772 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 655 | Open in IMG/M |
| 3300010376|Ga0126381_100555503 | Not Available | 1627 | Open in IMG/M |
| 3300010376|Ga0126381_102243419 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300010376|Ga0126381_103063871 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300010391|Ga0136847_11583825 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1447 | Open in IMG/M |
| 3300010398|Ga0126383_10578556 | Not Available | 1192 | Open in IMG/M |
| 3300010398|Ga0126383_13513227 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium 13_1_40CM_2_61_4 | 512 | Open in IMG/M |
| 3300010401|Ga0134121_10818931 | Not Available | 896 | Open in IMG/M |
| 3300011271|Ga0137393_10253254 | All Organisms → cellular organisms → Bacteria | 1495 | Open in IMG/M |
| 3300012209|Ga0137379_11583694 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium 13_1_40CM_2_61_4 | 554 | Open in IMG/M |
| 3300012285|Ga0137370_10394870 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 837 | Open in IMG/M |
| 3300012360|Ga0137375_10334505 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1352 | Open in IMG/M |
| 3300012360|Ga0137375_11282690 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300012362|Ga0137361_11373041 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium 13_1_40CM_2_61_4 | 630 | Open in IMG/M |
| 3300012923|Ga0137359_11607335 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300012948|Ga0126375_10162941 | All Organisms → cellular organisms → Bacteria | 1421 | Open in IMG/M |
| 3300012948|Ga0126375_10232309 | All Organisms → cellular organisms → Bacteria | 1235 | Open in IMG/M |
| 3300012948|Ga0126375_11601629 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 561 | Open in IMG/M |
| 3300012971|Ga0126369_12407445 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 612 | Open in IMG/M |
| 3300012975|Ga0134110_10199915 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium 13_1_40CM_2_61_4 | 838 | Open in IMG/M |
| 3300015373|Ga0132257_102135086 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 724 | Open in IMG/M |
| 3300017656|Ga0134112_10002439 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5671 | Open in IMG/M |
| 3300017659|Ga0134083_10098496 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1150 | Open in IMG/M |
| 3300018068|Ga0184636_1308099 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300018077|Ga0184633_10189285 | Not Available | 1064 | Open in IMG/M |
| 3300018482|Ga0066669_11687333 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 581 | Open in IMG/M |
| 3300020074|Ga0194113_10804718 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300021078|Ga0210381_10398804 | Not Available | 508 | Open in IMG/M |
| 3300025961|Ga0207712_11247035 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 664 | Open in IMG/M |
| 3300026035|Ga0207703_10120840 | All Organisms → cellular organisms → Bacteria | 2249 | Open in IMG/M |
| 3300026116|Ga0207674_10219011 | All Organisms → cellular organisms → Bacteria | 1852 | Open in IMG/M |
| 3300026118|Ga0207675_102530277 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 524 | Open in IMG/M |
| 3300026297|Ga0209237_1067854 | All Organisms → cellular organisms → Bacteria | 1692 | Open in IMG/M |
| 3300026298|Ga0209236_1022372 | All Organisms → cellular organisms → Bacteria | 3508 | Open in IMG/M |
| 3300026306|Ga0209468_1023170 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2205 | Open in IMG/M |
| 3300026309|Ga0209055_1003086 | All Organisms → cellular organisms → Bacteria | 10250 | Open in IMG/M |
| 3300026310|Ga0209239_1123095 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 1073 | Open in IMG/M |
| 3300026323|Ga0209472_1089280 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1242 | Open in IMG/M |
| 3300026326|Ga0209801_1043929 | All Organisms → cellular organisms → Bacteria | 2057 | Open in IMG/M |
| 3300026327|Ga0209266_1052821 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1989 | Open in IMG/M |
| 3300026329|Ga0209375_1000152 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 63031 | Open in IMG/M |
| 3300026499|Ga0257181_1046778 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium 13_1_40CM_2_61_4 | 713 | Open in IMG/M |
| 3300026524|Ga0209690_1290666 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300026529|Ga0209806_1088559 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium 13_1_40CM_2_61_4 | 1350 | Open in IMG/M |
| 3300026532|Ga0209160_1016077 | All Organisms → cellular organisms → Bacteria | 5207 | Open in IMG/M |
| 3300026538|Ga0209056_10089361 | All Organisms → cellular organisms → Bacteria | 2559 | Open in IMG/M |
| 3300026540|Ga0209376_1154799 | All Organisms → cellular organisms → Bacteria | 1094 | Open in IMG/M |
| 3300027846|Ga0209180_10730583 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 536 | Open in IMG/M |
| 3300028047|Ga0209526_10795791 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300028380|Ga0268265_10172108 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1852 | Open in IMG/M |
| 3300028812|Ga0247825_10514654 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
| 3300031846|Ga0318512_10386749 | Not Available | 702 | Open in IMG/M |
| 3300031943|Ga0310885_10335265 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| 3300032059|Ga0318533_10486202 | Not Available | 904 | Open in IMG/M |
| 3300032122|Ga0310895_10298153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 761 | Open in IMG/M |
| 3300032180|Ga0307471_101002509 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1002 | Open in IMG/M |
| 3300032205|Ga0307472_102512926 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 524 | Open in IMG/M |
| 3300033550|Ga0247829_10610693 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300033550|Ga0247829_10707791 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 838 | Open in IMG/M |
| 3300033550|Ga0247829_10934658 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300033551|Ga0247830_10088028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 2154 | Open in IMG/M |
| 3300033805|Ga0314864_0203400 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 519 | Open in IMG/M |
| 3300033814|Ga0364930_0247756 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 603 | Open in IMG/M |
| 3300034820|Ga0373959_0070631 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 789 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 20.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 15.65% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.57% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 6.09% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.22% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.48% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.48% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.61% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.74% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.74% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.74% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.74% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.74% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.87% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.87% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.87% |
| Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 0.87% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.87% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.87% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.87% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.87% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.87% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.87% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.87% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.87% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.87% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.87% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.87% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2067725002 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006865 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG | Environmental | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009806 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_50_60 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018068 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_b2 | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
| 3300026499 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-B | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300033805 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_10 | Environmental | Open in IMG/M |
| 3300033814 | Sediment microbial communities from East River floodplain, Colorado, United States - 55_j17 | Environmental | Open in IMG/M |
| 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPICC_01037540 | 2067725002 | Soil | VKITGLETYFLSAPLPQPVRTSTHVISAVSEVVVRLTT |
| F14TC_1021782922 | 3300000559 | Soil | MKIKALDTYFLSAPLPQPVRTSTSTISRVSELIVKLTTDAGLVGIGEAH |
| Ga0062589_1016435141 | 3300004156 | Soil | MKITSLETYSLSAPLPQVVRTSTHAISQVSEVIVKLTTDAGHVGIGE |
| Ga0066672_104880592 | 3300005167 | Soil | MKITALDTYFLSAPLPQAVRTSTSTISRVSELIVRLTTDAGLV |
| Ga0066673_105851882 | 3300005175 | Soil | MKITGLETFSLSAPLPQVVRTSTHAISQVSEVIVKLTTDAGHVGIGEA |
| Ga0066388_1016266681 | 3300005332 | Tropical Forest Soil | MKISALETYMLSVPLPQPVRTSTSTISRVSELIVRLTTDA |
| Ga0070694_1007110932 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MKITALETYFLAAPLAQPVRVSNSTIAQVSEVIVKLTTDS |
| Ga0066682_100201431 | 3300005450 | Soil | MKIKALDTYFLSATLPQPVRTSTSTISRVSELVVKLTTDA |
| Ga0070706_1006239971 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VPDMKISALETYFLAAPLAQPVRVSNSTIAQVSEVIVKLTTD |
| Ga0066701_106078391 | 3300005552 | Soil | MKITTLETYLLSAPLPQPVRTSTTTISRVSEVIVKLT |
| Ga0068864_1001782201 | 3300005618 | Switchgrass Rhizosphere | MKITALETYFLAAPLAQPVRVSNSTIAQVSEVIVKLTTDSG |
| Ga0066905_1010075542 | 3300005713 | Tropical Forest Soil | MKITALDTYFLSAPLPAPVRTSTSTISRVSELIVKLTTDA |
| Ga0066905_1016270011 | 3300005713 | Tropical Forest Soil | MKIKALDTYFLSAPLPQPVRTSTSTISRVSELIVRLT |
| Ga0066903_1034326952 | 3300005764 | Tropical Forest Soil | MKITQLDTYFLSAPLPAPVRTSTSTISRVSELIVKLTT |
| Ga0066903_1063045062 | 3300005764 | Tropical Forest Soil | MKITRLDTYFLSIPLPQPVRTSTSTISQVSEVIVKLTTD |
| Ga0066903_1070619251 | 3300005764 | Tropical Forest Soil | MKITTLETYLLSAPLPQPVRTSTSTISRVSEVIVKLTTDA |
| Ga0068871_1018909372 | 3300006358 | Miscanthus Rhizosphere | MKIKALDTYFLSAPLPQPVRTSTSTISRVSELIVRLTTDSGLVGIG |
| Ga0066658_104092781 | 3300006794 | Soil | MKIKALDTYFLSASLPQPVRTSTSTISRVSELIVTLATDAG |
| Ga0066659_105159681 | 3300006797 | Soil | MKIKALDTYFLSAPLPQPVRTSTSTISRVSELIVTLATDAGLV |
| Ga0066659_110366621 | 3300006797 | Soil | MKITALDTYFLSAPLPQAVRTSTSTISRVSELIVRLTTDAGLVGI |
| Ga0075428_1014242851 | 3300006844 | Populus Rhizosphere | MKITTLETYLLSAPLPQAVRTSTHAITRVSEVVVKLTTDAGLVGIG |
| Ga0075421_1015026682 | 3300006845 | Populus Rhizosphere | MKIKALDTYFLSAPLPQPVRTSTSTISRVSELIVTLTTD |
| Ga0073934_102870953 | 3300006865 | Hot Spring Sediment | VKITALETYALSAPLPQPVRTSTHRITQVSEVIVKLT |
| Ga0075429_1016128911 | 3300006880 | Populus Rhizosphere | MKITGLETYSLSAPLPQTVRTSTHAISQVSEVIVKLTTDAGHVGIGEAH |
| Ga0075426_100377335 | 3300006903 | Populus Rhizosphere | MHARMKVTGLETYCLSAPLPQPVRTSTHTISSVSEIV |
| Ga0075424_1005899081 | 3300006904 | Populus Rhizosphere | MKITGLETYSLSAPLPQVVRTSTHAITQVSEVIVKLT |
| Ga0075424_1019426301 | 3300006904 | Populus Rhizosphere | MKIKALDTYFLSAPLPQPVRTSTSTIARVSELVVKLTTDAGLVGIG |
| Ga0099791_104206352 | 3300007255 | Vadose Zone Soil | MKIKALDTYFLSAPLPQPVRTSTSTISKVSELIVTLT |
| Ga0099794_103626831 | 3300007265 | Vadose Zone Soil | VKVTRLETCLLSAPLPQAVSTSTHRITTVSEVVVRLTTDSG |
| Ga0099827_104038721 | 3300009090 | Vadose Zone Soil | MHITRLDTYFLSIPLPQPVRTSTSTISQVSEVIVKL |
| Ga0105250_105766501 | 3300009092 | Switchgrass Rhizosphere | MKITTLETYFLAAPLAQPVRVSNSTIAQVSEVIVK |
| Ga0075418_108505741 | 3300009100 | Populus Rhizosphere | MKITTLETYLLSAPLPQAVRTSTHAITRVSEVVVKLT |
| Ga0105243_108203261 | 3300009148 | Miscanthus Rhizosphere | IAGERGRVMKITALETYFLSAPLPQPVRTSNSTISRVSELIVTLTTDAGPVGIG* |
| Ga0075423_119879911 | 3300009162 | Populus Rhizosphere | MKVTALETYFLSAPLPQPVRTSTAAISRVSEVIVKLTTDAGLV |
| Ga0105081_10391081 | 3300009806 | Groundwater Sand | MRYDADPMKVTTLETYLLSAPLPQAVRTSTNTITRVSEVIV |
| Ga0126380_100116011 | 3300010043 | Tropical Forest Soil | MKITTLETYMLSAPLPQPVRTSTSTISRVSELIVRLTTD |
| Ga0126380_109974011 | 3300010043 | Tropical Forest Soil | MQITTLDTYMLSVPLPQPVRTSTSTISRVSELIVRLTTDA |
| Ga0126380_113652952 | 3300010043 | Tropical Forest Soil | MKITRLDTYFLSIPLPQPVRTSTSTISQVSEVLVKLTTDAGLV |
| Ga0126384_113881722 | 3300010046 | Tropical Forest Soil | MKVTGLETYFLSAPLPQPVRTSTHVISAVSEVVVRLTTDAGHVGIG |
| Ga0126382_102862291 | 3300010047 | Tropical Forest Soil | MKITALDTYFLSAPLPQPVRTSTSTISRVSELIVRLTTDA |
| Ga0126382_103565941 | 3300010047 | Tropical Forest Soil | MKISALETYMLSVPLPQPVRTSTSTISRVSELIVRLTT |
| Ga0126382_123198931 | 3300010047 | Tropical Forest Soil | MKITRLDTYFLSIPLPQPVRTSTSTISQVSEVIVKLTTDTG |
| Ga0134082_100180403 | 3300010303 | Grasslands Soil | MKIKALDTYFLSAPLPQPVRTSTSTISRVSELIVQLTTDSGLIGIGE |
| Ga0126376_108319912 | 3300010359 | Tropical Forest Soil | MKITQLETYFLAIPLPQPVRTSTSTISQVSEVIVKLT |
| Ga0126372_100555851 | 3300010360 | Tropical Forest Soil | MKIKALDTYFLSAPLPQPVRTSTSTISRVSELIVKLTTDS |
| Ga0126372_117224761 | 3300010360 | Tropical Forest Soil | MQITALETYMLSAPLPQPVRTSTSTISRVSELIVRLTTDAGLV |
| Ga0126378_133141662 | 3300010361 | Tropical Forest Soil | MKVTALETYFLSAPLPQAVRTSTHRIASVSEVIVRLSTDA |
| Ga0126377_111214542 | 3300010362 | Tropical Forest Soil | MKVEALDTYFLSAPLPQPVRTSTSTIARVSELIVKLTTDSGLVG |
| Ga0126377_117502882 | 3300010362 | Tropical Forest Soil | MKITTLETYLLSAPLPQVVRTSTHAITRVSEVVVKLTTDAGLVG |
| Ga0126377_120690871 | 3300010362 | Tropical Forest Soil | MKITTLETYMLSAPLPHPVRTSTSTISRVSELIVRL |
| Ga0126379_111668922 | 3300010366 | Tropical Forest Soil | MQITALETYILSAPLPQPVRTSTSTISRVSELIVRL |
| Ga0105239_121067721 | 3300010375 | Corn Rhizosphere | MKITALETYFLAAPLAQPVRVSNSTIAQVTEVIVKLTTD |
| Ga0126381_1005555033 | 3300010376 | Tropical Forest Soil | MKISALETYMLSVPLPQPVRTSTSTISRVSELIVRLTTDAG |
| Ga0126381_1022434192 | 3300010376 | Tropical Forest Soil | MKITTLETYMLSAPLPQPVRTSTSTISRVSELIVRL |
| Ga0126381_1030638712 | 3300010376 | Tropical Forest Soil | MKVKALDTYFLSAPLPQPVRTSTSTIARVSELIVKLTTD |
| Ga0136847_115838252 | 3300010391 | Freshwater Sediment | MKIATLETYLLSAPLPQAVRTSTHTITRVSEVIVKLT |
| Ga0126383_105785561 | 3300010398 | Tropical Forest Soil | MKITQLDTYFLSIPLPQPVRTSTSTIGQVSEVIVKLTTDA |
| Ga0126383_135132272 | 3300010398 | Tropical Forest Soil | MKVTALETYFLSAPLPQAVRTSTHRIASVSEVIVRL |
| Ga0134121_108189312 | 3300010401 | Terrestrial Soil | MKIKALDTYFLSAPLPQPVRTSTSTISRVSELIVRL |
| Ga0137393_102532541 | 3300011271 | Vadose Zone Soil | MRYDADPMKVTTLETYLLSAPLPQAVRTSTSTISR |
| Ga0137379_115836942 | 3300012209 | Vadose Zone Soil | MKVTALETYFLSAPLPQAVRTSTHRITSVSEVIVRLSTDAGLMGIGE |
| Ga0137370_103948702 | 3300012285 | Vadose Zone Soil | MKVTALDTYFLSAPLPQAVRTSTHTIASVSEVIVTLTTDSGLVG |
| Ga0137375_103345052 | 3300012360 | Vadose Zone Soil | VKVTTLETYLLSAPLPQAVRTSTHTITRVSEVIVKL |
| Ga0137375_112826901 | 3300012360 | Vadose Zone Soil | MKVTALETYFLSAPLPQAVRTSTHRITSVSEVVVKLTTDAGLV |
| Ga0137361_113730411 | 3300012362 | Vadose Zone Soil | MKVTSLETYFLSAPLPQAVRTSTHRITSVSEVIVRLSTDAGLMGIG |
| Ga0137359_116073352 | 3300012923 | Vadose Zone Soil | MKITKLETYALSAPLPQVVRTSTHAISQVSEVIVKLTTD |
| Ga0126375_101629411 | 3300012948 | Tropical Forest Soil | MKITTLDTYVLSVPLPQPVRTSTSTISRVSELIVRLTTDAGL |
| Ga0126375_102323092 | 3300012948 | Tropical Forest Soil | MHISALETYMLSVPLPQPVRTSTSTISRVSELIVRLT |
| Ga0126375_116016292 | 3300012948 | Tropical Forest Soil | MKVTGLETYFLSAPLPQPVRTSTHVISAVSEVVVRLTTDA |
| Ga0126369_124074452 | 3300012971 | Tropical Forest Soil | MKIAALETYFLSAPLPQAVRTSTSTIARVSELIVT |
| Ga0134110_101999152 | 3300012975 | Grasslands Soil | MKVTSLETYFLSAPLPQAVRTSTHRITSVSEVIVRLSTDAGLMGIGEAH |
| Ga0132257_1021350862 | 3300015373 | Arabidopsis Rhizosphere | MKITALETYFLAAPLAQPVRVSNSTIAQVSEVIVKLTTD |
| Ga0134112_100024396 | 3300017656 | Grasslands Soil | VKVTRLDTYFLSAPLPQPVSTSTHRITSVSEVVVKLTTDAGLVGI |
| Ga0134083_100984961 | 3300017659 | Grasslands Soil | VKVTRLDTYFLSAPLPQPVSTSTHRITSVSEVVVKLTTDA |
| Ga0184636_13080991 | 3300018068 | Groundwater Sediment | VKGSDAMKITKLDTYFLSVSLPQPVRISTATISQVSEV |
| Ga0184633_101892851 | 3300018077 | Groundwater Sediment | MHITRLDTYFLSIPLPQPVRTSTSTISQVSEVIVKLSTDTG |
| Ga0066669_116873332 | 3300018482 | Grasslands Soil | MKITGLETYSLSAPLPQVVRTSTHAITQVRQVIVKLTTDADLGGIAEAPDAFLF |
| Ga0194113_108047182 | 3300020074 | Freshwater Lake | MKITGLETYSLSAPLPQPVRTSTIAISQVSEVIVKLATDEGHVGLGE |
| Ga0210381_103988041 | 3300021078 | Groundwater Sediment | MKVTALETYLLSAPLPQPVRTSTHTIARVSEVVVKLTTDAGH |
| Ga0207712_112470352 | 3300025961 | Switchgrass Rhizosphere | MKITALETYFLSAPLPQPVRTSNSTISRVSELIVTLATDAGHVGIG |
| Ga0207703_101208401 | 3300026035 | Switchgrass Rhizosphere | MKITALETYFLAAPLAQPVRVSNSTIAQVTEVIVKLTT |
| Ga0207674_102190111 | 3300026116 | Corn Rhizosphere | MKITNLETYSLSAPLPQVVRTSTHAISQVSEVIVKLTTDAGHVGIGEGHVQARG |
| Ga0207675_1025302772 | 3300026118 | Switchgrass Rhizosphere | MKIKALDTYFLSAPLPQPVRTSTSTISRVSELIVTLTTDSGLVGI |
| Ga0209237_10678543 | 3300026297 | Grasslands Soil | MKITALDTYFLSAPLPQAVRTSTSTISRVSELIVRLTTDAGL |
| Ga0209236_10223724 | 3300026298 | Grasslands Soil | MKITALDTYFLSAPLPQAVRTSTSTISRVSELIVRLTTDAGLVGIG |
| Ga0209468_10231704 | 3300026306 | Soil | MKITALDTYFLSAPLPQAVRTSTSTISRVSELIVRLTTDAGLVGIGE |
| Ga0209055_10030861 | 3300026309 | Soil | MKIKALDTYFLSAPLPQPVRTSTSTISRVSELIVTLATDAG |
| Ga0209239_11230951 | 3300026310 | Grasslands Soil | MKIKALDTYFLSAPLPQPVRTSTSTISRVSELIVQLTTDSGLVGIG |
| Ga0209472_10892801 | 3300026323 | Soil | MKIAALDTYFLSAPLPQAVRTSTSTISRVSELIVRL |
| Ga0209801_10439294 | 3300026326 | Soil | MKIKALDTYFLSATLPQPVRTSTSTISRVSELVVKLTTDAG |
| Ga0209266_10528213 | 3300026327 | Soil | MKIAALDTYFLSAPLPQAVRTSTSTISRVSELIVRLTTDAGLVGIGE |
| Ga0209375_10001521 | 3300026329 | Soil | VKVTRLDTYFLSAPPPQPVSTSTHRITSVSEVVVKLTTDAGP |
| Ga0257181_10467782 | 3300026499 | Soil | MKVTSLETYFLSAPLPQAVRTSTHRITSVSEVIVRLSTDAGH |
| Ga0209690_12906662 | 3300026524 | Soil | VKVTRLDTYFLSAPLPQPVSTSTHRITSVSEVVVKLTTDAG |
| Ga0209806_10885591 | 3300026529 | Soil | MKVTSLETYFLSAPLPQAVRTSTHRITSVSELIVR |
| Ga0209160_10160771 | 3300026532 | Soil | MKIKALDTYFLSAPLPQPVRTSTSTISRVSELIVTL |
| Ga0209056_100893611 | 3300026538 | Soil | MKIKALDTYFLSATLPQPVRTSTSTISRVSELVVKLTTDASLVG |
| Ga0209376_11547991 | 3300026540 | Soil | MKIKALDTYFLSAPLPQPVRTSTSTISRVSELIVKLTTD |
| Ga0209180_107305831 | 3300027846 | Vadose Zone Soil | MRYDADSMKVTTLETYLLSASLPQAVRTSTSTISRVSEVIVKLTTDAGLVGIG |
| Ga0209526_107957912 | 3300028047 | Forest Soil | MKVTTLETYFLSAPLPQAVRTSTHVISRVNEVVVKLTTDSGLVGI |
| Ga0268265_101721083 | 3300028380 | Switchgrass Rhizosphere | MKIKALDTYFLSAPLPQPVRTSTSTISRVSELIVKLT |
| Ga0247825_105146542 | 3300028812 | Soil | MKVTGLETYLLSAPLPQPVRTSTSTIARVSEVVVRLTTDTGLV |
| Ga0318512_103867491 | 3300031846 | Soil | MKISALETYMLSVPLPQPVRTSTSTISRVSELIVRLT |
| Ga0310885_103352652 | 3300031943 | Soil | MKVTGLETYLLSAPLPQPVRTSTSTIARVSEVVVRLTT |
| Ga0318533_104862021 | 3300032059 | Soil | MKISALETYMLSVPLPQPVRTSTSTISRVSELIVRLTTDAR |
| Ga0310895_102981531 | 3300032122 | Soil | MKVTALETYLLSAPLPQPVRTSTHTIARVSEVVVKLTTDAG |
| Ga0307471_1010025092 | 3300032180 | Hardwood Forest Soil | MRIADLETYFLSAPLAQPVRVSNSTIAQVSEVIVKLTT |
| Ga0307472_1025129262 | 3300032205 | Hardwood Forest Soil | MKVKALDTYFLSAPLPQPVRTSTSTIARVSELIVKLTTDSGLCG |
| Ga0247829_106106932 | 3300033550 | Soil | MKVTGLETYLLSAPLPQPVRTSTSTIARVSEVVVRLTTDTG |
| Ga0247829_107077911 | 3300033550 | Soil | MKITALETYFLSAPLPQPVRTSNSTIARVSELVVTLTTDAGHVGIGEA |
| Ga0247829_109346582 | 3300033550 | Soil | MKITALETYSLSAPLPQTVRTSIHAISQVSEVIVKLTTD |
| Ga0247830_100880283 | 3300033551 | Soil | MKITALETYFLSAPLPQPVRTSNSTIARVSELVVTLTTDAGHVGIGEAR |
| Ga0314864_0203400_2_127 | 3300033805 | Peatland | MKITTLDTYMLSAPLPQPVRTSTSTISRVSELIVRLTTDAGH |
| Ga0364930_0247756_475_603 | 3300033814 | Sediment | VKITKLETYSLSAPLPQVVRTSTHAISQVSEVIVKLTTEAGHV |
| Ga0373959_0070631_682_789 | 3300034820 | Rhizosphere Soil | MKVTALETYLLSAPLPQPVRTSTHTIARVSEVVVKL |
| ⦗Top⦘ |