


| Basic Information | |
|---|---|
| Family ID | F080094 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 115 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MKKQTQKDKRIRKLFNQQELNYVILKSIVKNENLSLIVK |
| Number of Associated Samples | 97 |
| Number of Associated Scaffolds | 115 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Eukaryota |
| % of genes with valid RBS motifs | 1.74 % |
| % of genes near scaffold ends (potentially truncated) | 46.09 % |
| % of genes from short scaffolds (< 2000 bps) | 78.26 % |
| Associated GOLD sequencing projects | 95 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Eukaryota (62.609 % of family members) |
| NCBI Taxonomy ID | 2759 |
| Taxonomy | All Organisms → cellular organisms → Eukaryota |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine (26.087 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.652 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (73.913 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.78% β-sheet: 0.00% Coil/Unstructured: 55.22% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 115 Family Scaffolds |
|---|---|---|
| PF00329 | Complex1_30kDa | 64.35 |
| PF00507 | Oxidored_q4 | 16.52 |
| PF00346 | Complex1_49kDa | 7.83 |
| PF10588 | NADH-G_4Fe-4S_3 | 1.74 |
| PF00253 | Ribosomal_S14 | 1.74 |
| PF00384 | Molybdopterin | 0.87 |
| PF00420 | Oxidored_q2 | 0.87 |
| PF06455 | NADH5_C | 0.87 |
| PF00115 | COX1 | 0.87 |
| PF00119 | ATP-synt_A | 0.87 |
| COG ID | Name | Functional Category | % Frequency in 115 Family Scaffolds |
|---|---|---|---|
| COG0852 | NADH:ubiquinone oxidoreductase 27 kD subunit (chain C) | Energy production and conversion [C] | 64.35 |
| COG3262 | Ni,Fe-hydrogenase III component G | Energy production and conversion [C] | 64.35 |
| COG0838 | NADH:ubiquinone oxidoreductase subunit 3 (chain A) | Energy production and conversion [C] | 16.52 |
| COG0649 | NADH:ubiquinone oxidoreductase 49 kD subunit (chain D) | Energy production and conversion [C] | 7.83 |
| COG3261 | Ni,Fe-hydrogenase III large subunit | Energy production and conversion [C] | 7.83 |
| COG0199 | Ribosomal protein S14 | Translation, ribosomal structure and biogenesis [J] | 1.74 |
| COG1009 | Membrane H+-translocase/NADH:ubiquinone oxidoreductase subunit 5 (chain L)/Multisubunit Na+/H+ antiporter, MnhA subunit | Energy production and conversion [C] | 1.74 |
| COG0356 | FoF1-type ATP synthase, membrane subunit a | Energy production and conversion [C] | 0.87 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 82.61 % |
| Unclassified | root | N/A | 17.39 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000120|SA_S2_NOR13_50mDRAFT_c1002566 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta | 3870 | Open in IMG/M |
| 3300000792|BS_KBA_SWE02_21mDRAFT_10018040 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta | 2292 | Open in IMG/M |
| 3300003682|Ga0008456_1048026 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 734 | Open in IMG/M |
| 3300003712|Ga0008276_103164 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 780 | Open in IMG/M |
| 3300004097|Ga0055584_100470093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1306 | Open in IMG/M |
| 3300005565|Ga0068885_1827836 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300006378|Ga0075498_1290212 | All Organisms → cellular organisms → Eukaryota | 913 | Open in IMG/M |
| 3300006379|Ga0075513_1354672 | All Organisms → cellular organisms → Eukaryota → Sar | 820 | Open in IMG/M |
| 3300006383|Ga0075504_1013030 | All Organisms → cellular organisms → Eukaryota → Sar | 707 | Open in IMG/M |
| 3300006383|Ga0075504_1039532 | All Organisms → cellular organisms → Eukaryota | 992 | Open in IMG/M |
| 3300006383|Ga0075504_1365081 | Not Available | 581 | Open in IMG/M |
| 3300006383|Ga0075504_1407413 | All Organisms → cellular organisms → Eukaryota | 1132 | Open in IMG/M |
| 3300006384|Ga0075516_1391357 | All Organisms → cellular organisms → Eukaryota | 756 | Open in IMG/M |
| 3300006393|Ga0075517_1577728 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica | 914 | Open in IMG/M |
| 3300006396|Ga0075493_1560574 | All Organisms → cellular organisms → Eukaryota → Sar | 858 | Open in IMG/M |
| 3300006403|Ga0075514_1823455 | All Organisms → cellular organisms → Eukaryota | 741 | Open in IMG/M |
| 3300006571|Ga0075505_1008741 | All Organisms → cellular organisms → Eukaryota | 857 | Open in IMG/M |
| 3300006641|Ga0075471_10045332 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta | 2468 | Open in IMG/M |
| 3300006874|Ga0075475_10280630 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica | 692 | Open in IMG/M |
| 3300006874|Ga0075475_10322248 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta | 634 | Open in IMG/M |
| 3300007552|Ga0102818_1034692 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta | 997 | Open in IMG/M |
| 3300007552|Ga0102818_1077881 | All Organisms → cellular organisms → Eukaryota | 654 | Open in IMG/M |
| 3300007555|Ga0102817_1004026 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3535 | Open in IMG/M |
| 3300007559|Ga0102828_1157996 | Not Available | 571 | Open in IMG/M |
| 3300007561|Ga0102914_1290444 | Not Available | 500 | Open in IMG/M |
| 3300007636|Ga0102856_1050640 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta | 656 | Open in IMG/M |
| 3300007661|Ga0102866_1082468 | All Organisms → cellular organisms → Eukaryota | 794 | Open in IMG/M |
| 3300007681|Ga0102824_1043334 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta | 1191 | Open in IMG/M |
| 3300007715|Ga0102827_1016933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1643 | Open in IMG/M |
| 3300007864|Ga0105749_1175052 | All Organisms → cellular organisms → Eukaryota | 516 | Open in IMG/M |
| 3300007955|Ga0105740_1009584 | All Organisms → cellular organisms → Eukaryota | 1219 | Open in IMG/M |
| 3300008116|Ga0114350_1097772 | All Organisms → cellular organisms → Eukaryota | 934 | Open in IMG/M |
| 3300008158|Ga0100217_10042 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta | 40543 | Open in IMG/M |
| 3300008958|Ga0104259_1037145 | Not Available | 519 | Open in IMG/M |
| 3300008995|Ga0102888_1001144 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta | 5582 | Open in IMG/M |
| 3300009000|Ga0102960_1106308 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1021 | Open in IMG/M |
| 3300009002|Ga0102810_1257819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 538 | Open in IMG/M |
| 3300009003|Ga0102813_1198457 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta | 621 | Open in IMG/M |
| 3300009027|Ga0102957_1132812 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta | 878 | Open in IMG/M |
| 3300009054|Ga0102826_1022470 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta | 1593 | Open in IMG/M |
| 3300009055|Ga0102905_1003453 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2756 | Open in IMG/M |
| 3300009130|Ga0118729_1000783 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta | 41923 | Open in IMG/M |
| 3300009235|Ga0103857_10001483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2788 | Open in IMG/M |
| 3300009243|Ga0103860_10074875 | All Organisms → cellular organisms → Eukaryota | 704 | Open in IMG/M |
| 3300009402|Ga0103742_1048195 | Not Available | 554 | Open in IMG/M |
| 3300009436|Ga0115008_10007965 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta | 8724 | Open in IMG/M |
| 3300009543|Ga0115099_10187216 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta | 4089 | Open in IMG/M |
| 3300009543|Ga0115099_10371472 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta | 1289 | Open in IMG/M |
| 3300009543|Ga0115099_10541409 | Not Available | 3736 | Open in IMG/M |
| 3300009543|Ga0115099_10614735 | Not Available | 503 | Open in IMG/M |
| 3300009543|Ga0115099_10689389 | All Organisms → cellular organisms → Eukaryota | 867 | Open in IMG/M |
| 3300009543|Ga0115099_10854435 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 846 | Open in IMG/M |
| 3300009592|Ga0115101_1048935 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica | 1436 | Open in IMG/M |
| 3300009592|Ga0115101_1522295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 591 | Open in IMG/M |
| 3300009592|Ga0115101_1649479 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica | 834 | Open in IMG/M |
| 3300010305|Ga0129320_102116 | All Organisms → cellular organisms → Eukaryota | 688 | Open in IMG/M |
| 3300010404|Ga0129323_1089918 | All Organisms → cellular organisms → Eukaryota | 708 | Open in IMG/M |
| 3300010997|Ga0139324_1120964 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 676 | Open in IMG/M |
| 3300012408|Ga0138265_1008575 | All Organisms → cellular organisms → Eukaryota | 859 | Open in IMG/M |
| 3300012408|Ga0138265_1121836 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta | 5630 | Open in IMG/M |
| 3300012523|Ga0129350_1441914 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 710 | Open in IMG/M |
| 3300012935|Ga0138257_1517118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 816 | Open in IMG/M |
| 3300018636|Ga0193377_1008903 | All Organisms → cellular organisms → Eukaryota | 813 | Open in IMG/M |
| 3300019009|Ga0192880_10100798 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 735 | Open in IMG/M |
| 3300019021|Ga0192982_10006645 | Not Available | 2147 | Open in IMG/M |
| 3300019022|Ga0192951_10003950 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2150 | Open in IMG/M |
| 3300019022|Ga0192951_10119236 | All Organisms → cellular organisms → Eukaryota | 894 | Open in IMG/M |
| 3300019198|Ga0180033_116870 | All Organisms → cellular organisms → Eukaryota → Sar | 767 | Open in IMG/M |
| 3300019200|Ga0180036_1055202 | Not Available | 528 | Open in IMG/M |
| 3300019207|Ga0180034_1033869 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta | 733 | Open in IMG/M |
| 3300019214|Ga0180037_1062854 | Not Available | 1399 | Open in IMG/M |
| 3300019214|Ga0180037_1080737 | All Organisms → cellular organisms → Eukaryota → Sar | 590 | Open in IMG/M |
| 3300019214|Ga0180037_1130912 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta | 1350 | Open in IMG/M |
| 3300019700|Ga0194006_1013076 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta | 840 | Open in IMG/M |
| 3300019715|Ga0193966_1014266 | Not Available | 819 | Open in IMG/M |
| 3300019718|Ga0193999_1000953 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2110 | Open in IMG/M |
| 3300019718|Ga0193999_1019145 | All Organisms → cellular organisms → Eukaryota | 753 | Open in IMG/M |
| 3300019724|Ga0194003_1000129 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta | 4169 | Open in IMG/M |
| 3300019733|Ga0194013_1003794 | Not Available | 1239 | Open in IMG/M |
| 3300019734|Ga0193970_1005331 | Not Available | 1281 | Open in IMG/M |
| 3300019747|Ga0193978_1000582 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2600 | Open in IMG/M |
| 3300019753|Ga0194010_1095541 | Not Available | 549 | Open in IMG/M |
| 3300020074|Ga0194113_10275429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1292 | Open in IMG/M |
| 3300021091|Ga0194133_10374480 | All Organisms → cellular organisms → Eukaryota | 807 | Open in IMG/M |
| 3300021093|Ga0194123_10185570 | Not Available | 1080 | Open in IMG/M |
| 3300021345|Ga0206688_10314517 | All Organisms → cellular organisms → Eukaryota | 686 | Open in IMG/M |
| 3300021347|Ga0213862_10024460 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta | 2242 | Open in IMG/M |
| 3300021373|Ga0213865_10088104 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta | 1671 | Open in IMG/M |
| 3300021376|Ga0194130_10048601 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta | 3062 | Open in IMG/M |
| 3300021378|Ga0213861_10062113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2349 | Open in IMG/M |
| 3300021849|Ga0210304_1036828 | All Organisms → cellular organisms → Eukaryota | 701 | Open in IMG/M |
| 3300021960|Ga0222715_10282723 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta | 950 | Open in IMG/M |
| 3300021961|Ga0222714_10384815 | Not Available | 745 | Open in IMG/M |
| 3300022374|Ga0210311_1018075 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica | 849 | Open in IMG/M |
| (restricted) 3300023085|Ga0233406_10000031 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta | 8023 | Open in IMG/M |
| (restricted) 3300023210|Ga0233412_10347396 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta | 660 | Open in IMG/M |
| 3300024346|Ga0244775_10077510 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta | 2844 | Open in IMG/M |
| 3300024547|Ga0255292_1099424 | Not Available | 571 | Open in IMG/M |
| 3300025840|Ga0208917_1047567 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1708 | Open in IMG/M |
| 3300027195|Ga0208676_1001412 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2223 | Open in IMG/M |
| 3300027236|Ga0208026_1024380 | All Organisms → cellular organisms → Eukaryota | 870 | Open in IMG/M |
| 3300027243|Ga0208174_1017253 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta | 911 | Open in IMG/M |
| 3300027254|Ga0208177_1096938 | Not Available | 536 | Open in IMG/M |
| 3300027393|Ga0209867_1062659 | All Organisms → cellular organisms → Eukaryota | 563 | Open in IMG/M |
| 3300027506|Ga0208973_1099754 | All Organisms → cellular organisms → Eukaryota | 657 | Open in IMG/M |
| 3300027525|Ga0208437_1046562 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica | 1049 | Open in IMG/M |
| 3300027525|Ga0208437_1079607 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta | 764 | Open in IMG/M |
| 3300027751|Ga0208304_10198984 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica | 723 | Open in IMG/M |
| 3300027836|Ga0209230_10182166 | Not Available | 1204 | Open in IMG/M |
| 3300028524|Ga0210314_112957 | All Organisms → cellular organisms → Eukaryota | 731 | Open in IMG/M |
| 3300031589|Ga0307996_1000026 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta | 40470 | Open in IMG/M |
| 3300031658|Ga0307984_1029288 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta | 1813 | Open in IMG/M |
| 3300033995|Ga0335003_0289521 | All Organisms → cellular organisms → Eukaryota | 740 | Open in IMG/M |
| 3300034019|Ga0334998_0225550 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta | 1150 | Open in IMG/M |
| 3300034107|Ga0335037_0661342 | Not Available | 547 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 26.09% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 15.65% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 13.04% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 7.83% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.48% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.61% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 2.61% |
| Polar Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine | 2.61% |
| River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 1.74% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 1.74% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 1.74% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.74% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.74% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine | 1.74% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 1.74% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.74% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 1.74% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 0.87% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.87% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 0.87% |
| Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment | 0.87% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.87% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.87% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.87% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.87% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.87% |
| Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.87% |
| Ocean Water | Environmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water | 0.87% |
| Ice Edge, Mcmurdo Sound, Antarctica | Environmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica | 0.87% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000120 | Marine microbial communities from chronically polluted sediments in Adventfjord, Norway - Svalbard Archipelago station 2 sample NOR 13_50m | Environmental | Open in IMG/M |
| 3300000792 | Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBA sample SWE 02_21m | Environmental | Open in IMG/M |
| 3300003682 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome CAN11_03_M0_10 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300003712 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_85LU_5_RNA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004097 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaG | Environmental | Open in IMG/M |
| 3300005565 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel7S_1600h metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006378 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006379 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006383 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006384 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006393 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006396 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006403 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006571 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006874 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007552 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.571 | Environmental | Open in IMG/M |
| 3300007555 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 | Environmental | Open in IMG/M |
| 3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
| 3300007561 | Estuarine microbial communities from the Columbia River estuary - metaG 1561A-3 | Environmental | Open in IMG/M |
| 3300007636 | Estuarine microbial communities from the Columbia River estuary - metaG 1371A-3 | Environmental | Open in IMG/M |
| 3300007661 | Estuarine microbial communities from the Columbia River estuary - metaG 1546A-3 | Environmental | Open in IMG/M |
| 3300007681 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.753 | Environmental | Open in IMG/M |
| 3300007715 | Estuarine microbial communities from the Columbia River estuary - metaG S.751 | Environmental | Open in IMG/M |
| 3300007864 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461B_3.0um | Environmental | Open in IMG/M |
| 3300007955 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373B_3.0um | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008158 | Minidiscus trioculatus and Planctomycetes bacterium Co-assembly | Environmental | Open in IMG/M |
| 3300008958 | Marine microbial communities from eastern North Pacific Ocean - P1 particle-associated | Environmental | Open in IMG/M |
| 3300008995 | Estuarine microbial communities from the Columbia River estuary - metaG 1551A-3 | Environmental | Open in IMG/M |
| 3300009000 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG | Environmental | Open in IMG/M |
| 3300009002 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.573 | Environmental | Open in IMG/M |
| 3300009003 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.725 | Environmental | Open in IMG/M |
| 3300009027 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG | Environmental | Open in IMG/M |
| 3300009054 | Estuarine microbial communities from the Columbia River estuary - metaG S.737 | Environmental | Open in IMG/M |
| 3300009055 | Estuarine microbial communities from the Columbia River estuary - metaG 1556B-3 | Environmental | Open in IMG/M |
| 3300009130 | Combined Assembly of Gp0139511, Gp0139512 | Environmental | Open in IMG/M |
| 3300009235 | Microbial communities of water from Amazon river, Brazil - RCM10 | Environmental | Open in IMG/M |
| 3300009243 | Microbial communities of water from Amazon river, Brazil - RCM13 | Environmental | Open in IMG/M |
| 3300009402 | Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 4B | Environmental | Open in IMG/M |
| 3300009436 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome | Environmental | Open in IMG/M |
| 3300009543 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009592 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M1_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010305 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_0.1_0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010404 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010997 | ECM15MPS05_Aassembled -- Sediment microbial communities from coastal marsh in Port Sulphur, LA sequencing method A (2X250bp) | Environmental | Open in IMG/M |
| 3300012408 | Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 192hr light incubation - RNA23.A_192.20151118 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012523 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012935 | Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA5.ICE_1m.20151110 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300018636 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_122 - TARA_N000001943 (ERX1782245-ERR1711897) | Environmental | Open in IMG/M |
| 3300019009 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_067 - TARA_N000000756 (ERX1782233-ERR1711966) | Environmental | Open in IMG/M |
| 3300019021 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782268-ERR1711957) | Environmental | Open in IMG/M |
| 3300019022 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782474-ERR1712194) | Environmental | Open in IMG/M |
| 3300019198 | Estuarine microbial communities from the Columbia River estuary - R8.48AS metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019200 | Estuarine microbial communities from the Columbia River estuary - R.1175 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019207 | Estuarine microbial communities from the Columbia River estuary - R.871 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019214 | Estuarine microbial communities from the Columbia River estuary - R.1189 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019700 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLC_2-3_MG | Environmental | Open in IMG/M |
| 3300019715 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRT_2-3_MG | Environmental | Open in IMG/M |
| 3300019718 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLT_5-6_MG | Environmental | Open in IMG/M |
| 3300019724 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLT_9-10_MG | Environmental | Open in IMG/M |
| 3300019733 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLC_9-10_MG | Environmental | Open in IMG/M |
| 3300019734 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRT_6-7_MG | Environmental | Open in IMG/M |
| 3300019747 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FRT_5-6_MG | Environmental | Open in IMG/M |
| 3300019753 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLC_6-7_MG | Environmental | Open in IMG/M |
| 3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
| 3300021091 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015055 Kigoma Offshore 40m | Environmental | Open in IMG/M |
| 3300021093 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015023 Mahale A surface | Environmental | Open in IMG/M |
| 3300021345 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021347 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266 | Environmental | Open in IMG/M |
| 3300021373 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282 | Environmental | Open in IMG/M |
| 3300021376 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surface | Environmental | Open in IMG/M |
| 3300021378 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131 | Environmental | Open in IMG/M |
| 3300021849 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1037 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300022374 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1166 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023085 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_5_MG | Environmental | Open in IMG/M |
| 3300023210 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MG | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024547 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Miss_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025840 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027195 | Estuarine microbial communities from the Columbia River estuary - metaG 1370A-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027236 | Estuarine microbial communities from the Columbia River estuary - metaG 1554A-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027243 | Estuarine microbial communities from the Columbia River estuary - metaG 1556A-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027254 | Estuarine microbial communities from the Columbia River estuary - metaG 1561A-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027393 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_4-Nov-14 (SPAdes) | Environmental | Open in IMG/M |
| 3300027506 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_66_BLW_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027525 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705 (SPAdes) | Environmental | Open in IMG/M |
| 3300027751 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 (SPAdes) | Environmental | Open in IMG/M |
| 3300027836 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300028524 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031589 | Marine microbial communities from David Island wharf, Antarctic Ocean - #35 | Environmental | Open in IMG/M |
| 3300031658 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #78 | Environmental | Open in IMG/M |
| 3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
| 3300034019 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049 | Environmental | Open in IMG/M |
| 3300034107 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Apr2017-rr0133 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| SA_S2_NOR13_50mDRAFT_10025664 | 3300000120 | Marine | MKKQTQKDKKLRKLFNQQELNNIILKSIVKNENLSLIVK* |
| BS_KBA_SWE02_21mDRAFT_100180405 | 3300000792 | Marine | MKKQTQKDKQIRKLFNKQELNYVILKSIVKNENLSLITK* |
| Ga0008456_10480263 | 3300003682 | Seawater | MKKKLQKDIKLRKLFNQQELNHIILKSIVKNENLSLILKWNAVSKLSNFLGGQNK |
| Ga0008276_1031643 | 3300003712 | Marine | MKKQIQRDKRIRKLFNKRELNRIILKSIVKNENLSLLIK* |
| Ga0055584_1004700931 | 3300004097 | Pelagic Marine | MKKQIKKDKNIRKLFAQQELDNIILKSIIKNENLSLIVK* |
| Ga0068885_18278361 | 3300005565 | Freshwater Lake | MKKQTQKDKKLRKSFNQQELNHVILKSIVKNENLSLLVKWNAVLKLSNFL |
| Ga0075498_12902122 | 3300006378 | Aqueous | MKKQTQKDKQIRKLFNKRELNYVILKSIIKNENLSLIIK* |
| Ga0075513_13546722 | 3300006379 | Aqueous | MKKQTQKDKNIRKIFNKQELDFILLKSIIKNENLSLITK* |
| Ga0075504_10130302 | 3300006383 | Aqueous | MKKQTQKDKNIRKIFNKQELDFILLKSIIKNENLSLITK*NAVSKLA |
| Ga0075504_10395322 | 3300006383 | Aqueous | MKKQIKKDKTIRKLFAQQEVDNIILKSIIKNENLSLIVK* |
| Ga0075504_13650812 | 3300006383 | Aqueous | MKKQLQKDKKIRKLYNQHELNHVILKSIIKNENLSLIIK* |
| Ga0075504_14074133 | 3300006383 | Aqueous | LIILLFLRYMKKQTQKDKKIRRLFNQQELNYVILKSIIKNENLSLIIK* |
| Ga0075516_13913572 | 3300006384 | Aqueous | MKKHTQKDKKIRKRFNQQEVSSIILKSIVKNENFSLIVK* |
| Ga0075517_15777282 | 3300006393 | Aqueous | MKKQTQKDKRIRKLFNRRELNYIILKSIIKNENLSLITK* |
| Ga0075493_15605742 | 3300006396 | Aqueous | MKKQTQKDKRIRKLFNQREVSQVILKSIIKNENLSLNVK* |
| Ga0075514_18234551 | 3300006403 | Aqueous | MKKKLQKDIKLRKLFNQQELNHIILKSIVKNENLSLILKWNAVSKLSNFLGGQNKTRF |
| Ga0075505_10087412 | 3300006571 | Aqueous | MKKHIQKDRKLRKFFDREELSYIVLKSIVKNENLSLTIK* |
| Ga0075471_100453327 | 3300006641 | Aqueous | QKDKQIRKLFNKRELNYVILKSIIKNENLSLIIK* |
| Ga0075475_102806301 | 3300006874 | Aqueous | MKKQTQKDKRIRKLFNRRELNYIILKSIIKNENLSLITK*NAILKLSS |
| Ga0075475_103222483 | 3300006874 | Aqueous | MKKQTQKDKKIRRLFNQQELNYVILKSIIKNENLSLIIK* |
| Ga0102818_10346921 | 3300007552 | Estuarine | ICMKKKTQKDKKIRKLFIRQELKYVILKSIVKNENLSLTVK* |
| Ga0102818_10778811 | 3300007552 | Estuarine | MKKQTQKDKKLRKSFNQQELNHVILKSIVKNENLSLLIKWNAILKLSKFSG |
| Ga0102817_10040262 | 3300007555 | Estuarine | MKKKNQKDKKIRKLFNQQEIKYVILKSIIKNENLSLIVK* |
| Ga0102828_11579961 | 3300007559 | Estuarine | MKKQTQKDKKLRKSFNQQELNNVILKSIVKNENLSLLIK* |
| Ga0102914_12904443 | 3300007561 | Estuarine | MKKQTQKDKNLRKSFNRQELNYIILKSIVKNENLSLLIKW |
| Ga0102856_10506401 | 3300007636 | Estuarine | FMKKQTQKDKQIRKLFNKQELNYVILKSIVKNENLSLITK* |
| Ga0102866_10824682 | 3300007661 | Estuarine | MKKQTQKDKKIRKLFNQQELNYVILKSIVKNENLSLITKWNAISKLSHFSRNHN |
| Ga0102824_10433342 | 3300007681 | Estuarine | MKKQTQKDKKLRKSFNQQELNHVILKSIVKNENLSLLIK* |
| Ga0102827_10169333 | 3300007715 | Estuarine | MKKKLQKDIKIRKLFNQKELNHTILKSIVKNENLSLITK* |
| Ga0105749_11750522 | 3300007864 | Estuary Water | MKKQTQKDKKIRKFFNQQELNHIILKSIVKNENLSLVLKWNAI |
| Ga0105740_10095843 | 3300007955 | Estuary Water | MKKQTQKDKKLRKSFNQQELNHVILKSIVKNENLSLLVKWNAVLKLSNFLGS |
| Ga0114350_10977722 | 3300008116 | Freshwater, Plankton | MKKQTQKDKNLRKSFNRQELNYIILKSIVKNENLSLLIKWNAV |
| Ga0100217_1004261 | 3300008158 | Marine | MKKQTQKDKKVRKLFNQNEVNNIILKSIVKNENLSLIVK* |
| Ga0104259_10371452 | 3300008958 | Ocean Water | MKKQTQKDKRIRKLFNKRELNYVILKSIVKNENLSLIVK* |
| Ga0102888_10011444 | 3300008995 | Estuarine | MKKQTQKDKRIRKMFNQQEVSQVILKSIIKNENLSLNVK* |
| Ga0102960_11063082 | 3300009000 | Pond Water | LINGMKKHTQKDKKIRKRFNQQEVSSIILKSIVKNENFSLIVK* |
| Ga0102810_12578191 | 3300009002 | Estuarine | MKKQTQKDKNLRKSFNRQELNYIILKSIVKNENLSLLIK |
| Ga0102813_11984571 | 3300009003 | Estuarine | ICMKKKTQKDKKIRKLFNRQELKYVILKSIVKNENLSLTVK* |
| Ga0102957_11328123 | 3300009027 | Pond Water | MKKQTQKDKRIRKLFNRRELNYIILKSIVKNENLSLITK* |
| Ga0102826_10224706 | 3300009054 | Estuarine | QKDKKIRKLFNRQELKYVILKSIVKNENLSLTVK* |
| Ga0102905_10034534 | 3300009055 | Estuarine | MKKKNQKDKKIRKLFNQREIKYVILKSIIKNENLSLIVK* |
| Ga0118729_100078323 | 3300009130 | Marine | MKKKLPKDIKIRKFFNQQELNYIILKSVVKNENLPLMVK* |
| Ga0103857_100014833 | 3300009235 | River Water | MKKQTQKDKKCRKSFNQQELNQVILKSIVKNENLSLLIK* |
| Ga0103860_100748751 | 3300009243 | River Water | MKKQTQKDKKIRKFFNQQELNHIILKSIVKNENLSLVLKWNAISRLSTFAGNQNK |
| Ga0103742_10481952 | 3300009402 | Ice Edge, Mcmurdo Sound, Antarctica | MKKKLQKDKKIRKLFNRRELNHVILKSIVKNENLSLIAQT |
| Ga0115008_100079655 | 3300009436 | Marine | MKKQTQKDKRIRKLFNQQELNYVILKSIVKNENLSLIVK* |
| Ga0115099_101872163 | 3300009543 | Marine | MKKKFQKDIKIRKFLNQQELNHIILKSIVKNENLSLIVK* |
| Ga0115099_103714722 | 3300009543 | Marine | MKKKTQKDKKIRKLFNRQELKYVILKSIVKNENLSLTVK* |
| Ga0115099_105414098 | 3300009543 | Marine | MQKQIQKDRKIRKIFNKQELNYSILKSMVKNENLSLIIK* |
| Ga0115099_106147352 | 3300009543 | Marine | MQKKSQKDKKIRKLFYRQELIQIFTKSIIRNENLSLIVK* |
| Ga0115099_106893892 | 3300009543 | Marine | MKKKSQKDKKIRKLFNQQELSQIILKSVIRNENVSLLVK* |
| Ga0115099_108544353 | 3300009543 | Marine | MKKQLQKDKKIRTLFSQQEINWIIFKSIVKNENLPLMVK* |
| Ga0115101_10489354 | 3300009592 | Marine | MKKQIKKDKNIRRLFAQQELDNIILKSIIKNENLSLIVK* |
| Ga0115101_15222951 | 3300009592 | Marine | MQKKSQKDKKIRKLFYRQELIQIFTKSIIRNENLSLIVK*KAILKLSNFS |
| Ga0115101_16494792 | 3300009592 | Marine | MKKLFQKDKKIRKLFNQQELDYIVLKNIVKNENLSLVVK* |
| Ga0129320_1021162 | 3300010305 | Aqueous | MKKQTQKDKKIRKFFNQQELNHIILKSIVKNENLSLVLK* |
| Ga0129323_10899183 | 3300010404 | Aqueous | MKKKTQKDKRIRKLFNKRELNYVILKSIVKNENLSLITK*NAILKLSN |
| Ga0139324_11209643 | 3300010997 | Sediment | MKKQIQKDKLIRKLFNKRELNHIILKSIVKNENLPLVTK* |
| Ga0138265_10085752 | 3300012408 | Polar Marine | MKKQTQKDKKIRQLFNQQEISSIILKSIVKNENLSLIVK* |
| Ga0138265_11218367 | 3300012408 | Polar Marine | MKKQTQKDKKLRKLFNQQELNHTILKSIAKNENLSLIVK* |
| Ga0129350_14419141 | 3300012523 | Aqueous | MKKQTQKDKRIRKLFNKRELNHIILKSIVKNENLPLVTK* |
| Ga0138257_15171181 | 3300012935 | Polar Marine | MKKQTQKDKKIRQLFNQQEISSIILKSIVKNENLSLIVKKRSF* |
| Ga0193377_10089031 | 3300018636 | Marine | MKKQFQKDKKLRKLFNQKELSTFLLKSIVRNSNLSVITKXNAILKLSDA |
| Ga0192880_101007981 | 3300019009 | Marine | MKKQTQKDKRIRKLFNQQELNYVILKSIVKNENLSLIVK |
| Ga0192982_100066454 | 3300019021 | Marine | MKKQFQKDKKLRKLFDKKELTNLILKNIVRNSNLSLIVKXNAILKLSNLSKHY |
| Ga0192951_100039506 | 3300019022 | Marine | MKKKSQKDKKTRKSFNQQELTQTIIKSIIRNENLSSIVKWNAISKLSNLP |
| Ga0192951_101192362 | 3300019022 | Marine | MKKKSQKDKKTRKFFNQQELTQIILKSIIRNENLSSIVK |
| Ga0180033_1168702 | 3300019198 | Estuarine | MKKQTQKDKRIRKMFNQQEVSQVILKSIIKNENLSLNVK |
| Ga0180036_10552021 | 3300019200 | Estuarine | MKKQTQKDKKLRKSFNQQELNHVILKSIVKNENLSL |
| Ga0180034_10338692 | 3300019207 | Estuarine | MKKQTQKDKKLRKSFNQQELNNVILKSIVKNENLSLLIK |
| Ga0180037_10628544 | 3300019214 | Estuarine | MKKQIQRDKRIRKLFNKRELNRIILKSIVKNENLSL |
| Ga0180037_10807372 | 3300019214 | Estuarine | MKKHTQKDKKIRKRFNQQEVSSIILKSIVKNENFSLIVK |
| Ga0180037_11309122 | 3300019214 | Estuarine | MKKKTQKDKKIRKLFNRQELKYVILKSIVKNENLSLTVK |
| Ga0194006_10130762 | 3300019700 | Sediment | NCLNICMKKQTQKDKKIRQLFNQQEISSIILKSIVKNENLSLIVK |
| Ga0193966_10142661 | 3300019715 | Sediment | MKKQTQKDKKIRRLFNQQELKHIILKNIVKNENLSLNVKWNAISKLSNFSLSHKKTRFVN |
| Ga0193999_10009533 | 3300019718 | Sediment | MKKQTQKDKKIRQLFNQQEISSIILKSIVKNENLSLIVK |
| Ga0193999_10191451 | 3300019718 | Sediment | MKKHTQKDKKIRKRFNQQEMSSIILKSIVKNENFSLIVK |
| Ga0194003_10001291 | 3300019724 | Sediment | ISLINDMKKHTQKDKKIRKRFNQQEVSSIILKSIVKNENFSLIVK |
| Ga0194013_10037943 | 3300019733 | Sediment | MKKQTQKDKRIRKLFNRRELNYIILKSIIKNENLSLITKXNA |
| Ga0193970_10053315 | 3300019734 | Sediment | MKKQTQKDKKIRRLFNQQELKHIILKSIVKNENLSLNVKWNAISKLSNFSLSHKKTRFVN |
| Ga0193978_10005822 | 3300019747 | Sediment | LINDLKKHTQKDKKIRKRFNQQEVSSIILKSIVKNENFSLIVK |
| Ga0194010_10955412 | 3300019753 | Sediment | MKKQIKKDKNSRKLFAQQELDNIILKSIIKNENLSLIVK |
| Ga0194113_102754293 | 3300020074 | Freshwater Lake | MKKQTQKDRKLRKSFNQQELNNVILKSIVKNENLSLLIK |
| Ga0194133_103744803 | 3300021091 | Freshwater Lake | MKKQTQKDRKLRKSFNQQELNNVILKSIVKNENLSLLIKXNAV |
| Ga0194123_101855704 | 3300021093 | Freshwater Lake | MKKQTQKDRKLRKSFNQQELNNVILKSIVKNENLSLLIKXNAVLKLSK |
| Ga0206688_103145172 | 3300021345 | Seawater | MKKQTQKDKKIRQLFNQQEISSIILKSIVKNENLSLIVKXNAVSK |
| Ga0213862_100244601 | 3300021347 | Seawater | INDMKKHTQKDKKIRKRFNQQEVSSIILKSIVKNENFSLIVK |
| Ga0213865_100881047 | 3300021373 | Seawater | MKKQIQKDKQIRKLFNKRELNYTILKSIVKNENLSLVIK |
| Ga0194130_100486013 | 3300021376 | Freshwater Lake | MKKQTQKDRKLRKSFNQQELNNLILKSIVKNENLSLLIK |
| Ga0213861_100621134 | 3300021378 | Seawater | MKKQTQKDKRIRKLFNKRELNYVILKSIVKNENLSLITK |
| Ga0210304_10368283 | 3300021849 | Estuarine | MKKQTQKDKNLRKSFNRQELNYLILKSIVKNENLSLLIKWNAILKLSNYL |
| Ga0222715_102827232 | 3300021960 | Estuarine Water | MKKQKQRDKKIRKLFNQQELNQVILKSIVKNENLSLLVK |
| Ga0222714_103848151 | 3300021961 | Estuarine Water | MKKQFQKDKKIRNHYFQQELNNIVLKSIVRNENIPLLVK |
| Ga0210311_10180752 | 3300022374 | Estuarine | MKKIFQKDKKIRKLFNQQELDYIVLKNIVKNENLSLVVK |
| (restricted) Ga0233406_100000313 | 3300023085 | Seawater | MKKQIQRDKRIRKLFNKRELNRIILKSIVKNENLSLLIK |
| (restricted) Ga0233412_103473962 | 3300023210 | Seawater | GMKKQTQKDKKIRQLFNQQEISSIILKSIVKNENLSLIVK |
| Ga0244775_100775101 | 3300024346 | Estuarine | MKKQTQKDKKLRKSFNQQELNHVILKSIVKNENLSLLIK |
| Ga0255292_10994241 | 3300024547 | Freshwater | MKKQTQKDKKLRKSFNQQELNHVILKSIVKNENLSLLIKXNAVLKLSKFSGSQN |
| Ga0208917_10475672 | 3300025840 | Aqueous | MKKQTQKDKNIRKIFNKQELDFILLKSIIKNENLSLITK |
| Ga0208676_10014124 | 3300027195 | Estuarine | MKKKNQKDKKIRKLFNQQEIKYVILKSIIKNENLSLIVK |
| Ga0208026_10243801 | 3300027236 | Estuarine | MKKQTQKDKKIRKFFNQQELNHIILKSIVKNENLSLVLKWN |
| Ga0208174_10172531 | 3300027243 | Estuarine | SVCMKKKNQKDKKIRKLFNQREIKYVILKSIIKNENLSLIVK |
| Ga0208177_10969382 | 3300027254 | Estuarine | MKKQTQKDKQIRKLFNKQELNYVILKSIVKNENLSLITKXNAILKLSNLSGSH |
| Ga0209867_10626592 | 3300027393 | Sand | MKKQTQKDKKIRKFFNQQELNHIILKSIVKNENLSLVLKW |
| Ga0208973_10997541 | 3300027506 | Marine | MKKQTQKDKKIRQLFNQQEISSIILKSIVKNENLSL |
| Ga0208437_10465621 | 3300027525 | Estuarine | MKKQTQKDKKIRKFFNQQELNHIILKSIVKNENLSLVLKWNAISKLS |
| Ga0208437_10796072 | 3300027525 | Estuarine | KTQKDKKIRKLFNRQELKYVILKSIVKNENLSLTVK |
| Ga0208304_101989842 | 3300027751 | Estuarine | MKKKNQKDKKIRKLFNQQEIKYVILKSIIKNENLSLIVKXNAI |
| Ga0209230_101821661 | 3300027836 | Freshwater And Sediment | MKKQTQRDKKLRKFFNQQELSHFILKSIVKNENLSLLVKWNAILKLSNFLGSRSK |
| Ga0210314_1129572 | 3300028524 | Estuarine | MKKQTQKDKKLRKSFNQQELNHVILKSIVKNENLS |
| Ga0307996_100002654 | 3300031589 | Marine | MKKQTQKDKKLRKLFNQQELNHTILKSIAKNENLSLIVK |
| Ga0307984_10292886 | 3300031658 | Marine | MKKNSQKDKKIRKLYNQQELNYIVLKSIVKNENLSLVVK |
| Ga0335003_0289521_594_740 | 3300033995 | Freshwater | MKKQTQKDKNLRKSFNRQELNYIILKSIVKNENLSLLIKWNAVLKLSNF |
| Ga0334998_0225550_327_446 | 3300034019 | Freshwater | MKKQTQKDKKIRKLYNQQELNHIILKSIVKNENLSLVLK |
| Ga0335037_0661342_396_545 | 3300034107 | Freshwater | MKKQTQKDKNLRKSFNRQELNYIILKSIVKNENLSLLIKWNAVLKLSNFL |
| ⦗Top⦘ |