


| Basic Information | |
|---|---|
| Family ID | F080061 |
| Family Type | Metagenome |
| Number of Sequences | 115 |
| Average Sequence Length | 40 residues |
| Representative Sequence | QLFGILNFGHCDLPFDLAQGGGELVEPFGICDLLFEIF |
| Number of Associated Samples | 52 |
| Number of Associated Scaffolds | 115 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 5.22 % |
| % of genes near scaffold ends (potentially truncated) | 72.17 % |
| % of genes from short scaffolds (< 2000 bps) | 88.70 % |
| Associated GOLD sequencing projects | 44 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.26 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (73.913 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment (31.304 % of family members) |
| Environment Ontology (ENVO) | Unclassified (46.087 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Sediment (saline) (33.043 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 12.12% β-sheet: 21.21% Coil/Unstructured: 66.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.26 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 115 Family Scaffolds |
|---|---|---|
| PF00293 | NUDIX | 2.61 |
| PF02801 | Ketoacyl-synt_C | 2.61 |
| PF01103 | Omp85 | 2.61 |
| PF00343 | Phosphorylase | 1.74 |
| PF05193 | Peptidase_M16_C | 1.74 |
| PF13458 | Peripla_BP_6 | 1.74 |
| PF01196 | Ribosomal_L17 | 1.74 |
| PF07702 | UTRA | 1.74 |
| PF03453 | MoeA_N | 1.74 |
| PF01618 | MotA_ExbB | 1.74 |
| PF02518 | HATPase_c | 1.74 |
| PF01568 | Molydop_binding | 1.74 |
| PF00216 | Bac_DNA_binding | 1.74 |
| PF02627 | CMD | 0.87 |
| PF03462 | PCRF | 0.87 |
| PF00196 | GerE | 0.87 |
| PF02635 | DrsE | 0.87 |
| PF00501 | AMP-binding | 0.87 |
| PF07728 | AAA_5 | 0.87 |
| PF01168 | Ala_racemase_N | 0.87 |
| PF04055 | Radical_SAM | 0.87 |
| PF02538 | Hydantoinase_B | 0.87 |
| PF08546 | ApbA_C | 0.87 |
| PF16256 | DUF4911 | 0.87 |
| PF05201 | GlutR_N | 0.87 |
| PF00383 | dCMP_cyt_deam_1 | 0.87 |
| PF04060 | FeS | 0.87 |
| PF08889 | WbqC | 0.87 |
| PF01636 | APH | 0.87 |
| PF09084 | NMT1 | 0.87 |
| PF03454 | MoeA_C | 0.87 |
| PF13624 | SurA_N_3 | 0.87 |
| PF00152 | tRNA-synt_2 | 0.87 |
| PF02826 | 2-Hacid_dh_C | 0.87 |
| PF12727 | PBP_like | 0.87 |
| PF12706 | Lactamase_B_2 | 0.87 |
| PF02906 | Fe_hyd_lg_C | 0.87 |
| PF01467 | CTP_transf_like | 0.87 |
| PF07969 | Amidohydro_3 | 0.87 |
| PF02662 | FlpD | 0.87 |
| PF01312 | Bac_export_2 | 0.87 |
| PF00664 | ABC_membrane | 0.87 |
| PF13614 | AAA_31 | 0.87 |
| PF11794 | HpaB_N | 0.87 |
| PF04015 | DUF362 | 0.87 |
| PF07947 | YhhN | 0.87 |
| PF02915 | Rubrerythrin | 0.87 |
| PF06315 | AceK_kinase | 0.87 |
| PF14574 | RACo_C_ter | 0.87 |
| PF02310 | B12-binding | 0.87 |
| PF00691 | OmpA | 0.87 |
| PF13533 | Biotin_lipoyl_2 | 0.87 |
| PF12646 | DUF3783 | 0.87 |
| PF01872 | RibD_C | 0.87 |
| PF06253 | MTTB | 0.87 |
| PF12704 | MacB_PCD | 0.87 |
| PF03938 | OmpH | 0.87 |
| PF12838 | Fer4_7 | 0.87 |
| PF12766 | Pyridox_oxase_2 | 0.87 |
| PF00291 | PALP | 0.87 |
| PF07690 | MFS_1 | 0.87 |
| PF00218 | IGPS | 0.87 |
| PF01182 | Glucosamine_iso | 0.87 |
| PF13237 | Fer4_10 | 0.87 |
| PF03599 | CdhD | 0.87 |
| PF02367 | TsaE | 0.87 |
| PF11010 | DUF2848 | 0.87 |
| PF00300 | His_Phos_1 | 0.87 |
| PF02770 | Acyl-CoA_dh_M | 0.87 |
| PF13534 | Fer4_17 | 0.87 |
| COG ID | Name | Functional Category | % Frequency in 115 Family Scaffolds |
|---|---|---|---|
| COG0303 | Molybdopterin Mo-transferase (molybdopterin biosynthesis) | Coenzyme transport and metabolism [H] | 2.61 |
| COG0058 | Glucan phosphorylase | Carbohydrate transport and metabolism [G] | 1.74 |
| COG0146 | N-methylhydantoinase B/oxoprolinase/acetone carboxylase, alpha subunit | Amino acid transport and metabolism [E] | 1.74 |
| COG0203 | Ribosomal protein L17 | Translation, ribosomal structure and biogenesis [J] | 1.74 |
| COG0776 | Bacterial nucleoid DNA-binding protein IHF-alpha | Replication, recombination and repair [L] | 1.74 |
| COG0017 | Aspartyl/asparaginyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.87 |
| COG0134 | Indole-3-glycerol phosphate synthase | Amino acid transport and metabolism [E] | 0.87 |
| COG0173 | Aspartyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.87 |
| COG0216 | Protein chain release factor RF1 | Translation, ribosomal structure and biogenesis [J] | 0.87 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.87 |
| COG0363 | 6-phosphogluconolactonase/Glucosamine-6-phosphate isomerase/deaminase | Carbohydrate transport and metabolism [G] | 0.87 |
| COG0373 | Glutamyl-tRNA reductase | Coenzyme transport and metabolism [H] | 0.87 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.87 |
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.87 |
| COG0802 | tRNA A37 threonylcarbamoyladenosine biosynthesis protein TsaE | Translation, ribosomal structure and biogenesis [J] | 0.87 |
| COG1186 | Protein chain release factor PrfB | Translation, ribosomal structure and biogenesis [J] | 0.87 |
| COG1190 | Lysyl-tRNA synthetase, class II | Translation, ribosomal structure and biogenesis [J] | 0.87 |
| COG1456 | CO dehydrogenase/acetyl-CoA synthase gamma subunit (corrinoid Fe-S protein) | Energy production and conversion [C] | 0.87 |
| COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 0.87 |
| COG1908 | Coenzyme F420-reducing hydrogenase, delta subunit | Energy production and conversion [C] | 0.87 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.87 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.87 |
| COG2006 | Uncharacterized conserved protein, DUF362 family | Function unknown [S] | 0.87 |
| COG2069 | CO dehydrogenase/acetyl-CoA synthase delta subunit (corrinoid Fe-S protein) | Energy production and conversion [C] | 0.87 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.87 |
| COG2269 | Elongation factor P--beta-lysine ligase (EF-P beta-lysylation pathway) | Translation, ribosomal structure and biogenesis [J] | 0.87 |
| COG2825 | Periplasmic chaperone for outer membrane proteins, Skp family | Cell wall/membrane/envelope biogenesis [M] | 0.87 |
| COG3714 | Uncharacterized membrane protein YhhN | Function unknown [S] | 0.87 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.87 |
| COG4579 | Isocitrate dehydrogenase kinase/phosphatase | Signal transduction mechanisms [T] | 0.87 |
| COG4624 | Iron only hydrogenase large subunit, C-terminal domain | Energy production and conversion [C] | 0.87 |
| COG5598 | Trimethylamine:corrinoid methyltransferase | Coenzyme transport and metabolism [H] | 0.87 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 73.91 % |
| Unclassified | root | N/A | 26.09 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004008|Ga0055446_10204007 | Not Available | 589 | Open in IMG/M |
| 3300004113|Ga0065183_10362702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 682 | Open in IMG/M |
| 3300005588|Ga0070728_10277586 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
| 3300005588|Ga0070728_10681116 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300005589|Ga0070729_10047190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2865 | Open in IMG/M |
| 3300005589|Ga0070729_10117116 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1606 | Open in IMG/M |
| 3300005589|Ga0070729_10227196 | Not Available | 1071 | Open in IMG/M |
| 3300005589|Ga0070729_10480751 | Not Available | 681 | Open in IMG/M |
| 3300005589|Ga0070729_10498747 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300005589|Ga0070729_10636770 | Not Available | 576 | Open in IMG/M |
| 3300005590|Ga0070727_10442934 | Not Available | 724 | Open in IMG/M |
| 3300005600|Ga0070726_10372840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 720 | Open in IMG/M |
| 3300005600|Ga0070726_10689634 | Not Available | 515 | Open in IMG/M |
| 3300005601|Ga0070722_10101826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1102 | Open in IMG/M |
| 3300005612|Ga0070723_10105538 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1207 | Open in IMG/M |
| 3300005612|Ga0070723_10181359 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 951 | Open in IMG/M |
| 3300006467|Ga0099972_10881496 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 559 | Open in IMG/M |
| 3300006467|Ga0099972_11569477 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 883 | Open in IMG/M |
| 3300006467|Ga0099972_12362306 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 797 | Open in IMG/M |
| 3300007102|Ga0102541_1312099 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 632 | Open in IMG/M |
| 3300007614|Ga0102946_1415197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 515 | Open in IMG/M |
| 3300009035|Ga0102958_1035541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1407 | Open in IMG/M |
| 3300009138|Ga0102959_1017239 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1766 | Open in IMG/M |
| 3300010330|Ga0136651_10159706 | Not Available | 1163 | Open in IMG/M |
| 3300010392|Ga0118731_100961414 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300010392|Ga0118731_102103458 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300010392|Ga0118731_103114022 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 593 | Open in IMG/M |
| 3300010392|Ga0118731_103212777 | Not Available | 592 | Open in IMG/M |
| 3300010392|Ga0118731_109141768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 732 | Open in IMG/M |
| 3300010392|Ga0118731_109270776 | Not Available | 732 | Open in IMG/M |
| 3300010392|Ga0118731_109656052 | All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Spirochaeta → unclassified Spirochaeta → Spirochaeta sp. | 795 | Open in IMG/M |
| 3300010392|Ga0118731_109825494 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 716 | Open in IMG/M |
| 3300010392|Ga0118731_111303538 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 637 | Open in IMG/M |
| 3300010392|Ga0118731_111638224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2004 | Open in IMG/M |
| 3300010392|Ga0118731_114566569 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300010430|Ga0118733_100340874 | Not Available | 2968 | Open in IMG/M |
| 3300010430|Ga0118733_100932380 | All Organisms → cellular organisms → Bacteria | 1733 | Open in IMG/M |
| 3300010430|Ga0118733_101577596 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1308 | Open in IMG/M |
| 3300010430|Ga0118733_102030552 | All Organisms → cellular organisms → Bacteria | 1143 | Open in IMG/M |
| 3300010430|Ga0118733_102235083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1085 | Open in IMG/M |
| 3300010430|Ga0118733_102310875 | All Organisms → cellular organisms → Bacteria | 1066 | Open in IMG/M |
| 3300010430|Ga0118733_103022358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 1 | 922 | Open in IMG/M |
| 3300010430|Ga0118733_103194858 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 895 | Open in IMG/M |
| 3300010430|Ga0118733_103274459 | Not Available | 883 | Open in IMG/M |
| 3300010430|Ga0118733_104426990 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 750 | Open in IMG/M |
| 3300010430|Ga0118733_104707019 | Not Available | 725 | Open in IMG/M |
| 3300010430|Ga0118733_104910772 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 709 | Open in IMG/M |
| 3300010430|Ga0118733_107627042 | Not Available | 561 | Open in IMG/M |
| 3300010430|Ga0118733_109514640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 500 | Open in IMG/M |
| 3300013099|Ga0164315_10108789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2245 | Open in IMG/M |
| 3300013099|Ga0164315_10416145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1090 | Open in IMG/M |
| 3300013099|Ga0164315_10437541 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1060 | Open in IMG/M |
| 3300014903|Ga0164321_10297785 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 767 | Open in IMG/M |
| 3300019696|Ga0194017_1013024 | Not Available | 818 | Open in IMG/M |
| 3300019711|Ga0193993_1014583 | Not Available | 832 | Open in IMG/M |
| 3300019712|Ga0193969_1049155 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300019748|Ga0194018_1027605 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300022202|Ga0224498_10051008 | Not Available | 1167 | Open in IMG/M |
| 3300022202|Ga0224498_10148489 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 687 | Open in IMG/M |
| 3300022202|Ga0224498_10157405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 668 | Open in IMG/M |
| 3300022206|Ga0224499_10170044 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont | 743 | Open in IMG/M |
| 3300022217|Ga0224514_10115600 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
| 3300022218|Ga0224502_10037163 | All Organisms → cellular organisms → Bacteria | 1819 | Open in IMG/M |
| 3300022218|Ga0224502_10112448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1035 | Open in IMG/M |
| 3300022306|Ga0224509_10221307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 680 | Open in IMG/M |
| 3300022306|Ga0224509_10233252 | Not Available | 662 | Open in IMG/M |
| 3300022306|Ga0224509_10233942 | Not Available | 661 | Open in IMG/M |
| 3300022306|Ga0224509_10254564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 634 | Open in IMG/M |
| 3300022308|Ga0224504_10103486 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 1158 | Open in IMG/M |
| (restricted) 3300024519|Ga0255046_10330966 | Not Available | 715 | Open in IMG/M |
| (restricted) 3300024519|Ga0255046_10418649 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| (restricted) 3300024519|Ga0255046_10482489 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfosarcina → Desulfosarcina alkanivorans | 593 | Open in IMG/M |
| (restricted) 3300024528|Ga0255045_10024430 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae → Syntrophobacter → Syntrophobacter fumaroxidans | 1841 | Open in IMG/M |
| 3300025883|Ga0209456_10007153 | All Organisms → cellular organisms → Bacteria | 4956 | Open in IMG/M |
| 3300025883|Ga0209456_10023259 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfonema → Desulfonema limicola | 2781 | Open in IMG/M |
| 3300025883|Ga0209456_10059723 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1710 | Open in IMG/M |
| 3300025883|Ga0209456_10148149 | Not Available | 1018 | Open in IMG/M |
| 3300025883|Ga0209456_10352474 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 602 | Open in IMG/M |
| 3300025895|Ga0209567_10064963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 1688 | Open in IMG/M |
| 3300025895|Ga0209567_10072070 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1601 | Open in IMG/M |
| 3300025895|Ga0209567_10228447 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 881 | Open in IMG/M |
| 3300025895|Ga0209567_10330492 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 729 | Open in IMG/M |
| 3300025895|Ga0209567_10451233 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300025977|Ga0210072_1039449 | Not Available | 627 | Open in IMG/M |
| 3300025977|Ga0210072_1044241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 593 | Open in IMG/M |
| 3300027820|Ga0209578_10265862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 803 | Open in IMG/M |
| 3300027828|Ga0209692_10320406 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 679 | Open in IMG/M |
| 3300027845|Ga0209271_10031617 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2184 | Open in IMG/M |
| 3300027845|Ga0209271_10146130 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 971 | Open in IMG/M |
| 3300027852|Ga0209345_10313378 | Not Available | 948 | Open in IMG/M |
| (restricted) 3300027856|Ga0255054_10010928 | All Organisms → cellular organisms → Bacteria | 4782 | Open in IMG/M |
| 3300027917|Ga0209536_101712391 | Not Available | 760 | Open in IMG/M |
| 3300027978|Ga0209165_10062954 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1315 | Open in IMG/M |
| 3300027978|Ga0209165_10158656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 785 | Open in IMG/M |
| 3300027980|Ga0209475_10070794 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 1758 | Open in IMG/M |
| 3300027980|Ga0209475_10089058 | Not Available | 1516 | Open in IMG/M |
| 3300028598|Ga0265306_10715412 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 554 | Open in IMG/M |
| 3300028599|Ga0265309_10616159 | Not Available | 731 | Open in IMG/M |
| 3300028600|Ga0265303_10922682 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300032136|Ga0316201_10734118 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300032251|Ga0316198_10089285 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfonema → Desulfonema limicola | 1830 | Open in IMG/M |
| 3300032251|Ga0316198_10127190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 1502 | Open in IMG/M |
| 3300032251|Ga0316198_10193509 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 1 | 1179 | Open in IMG/M |
| 3300032252|Ga0316196_10010640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 4251 | Open in IMG/M |
| 3300032252|Ga0316196_10438123 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300032258|Ga0316191_10864919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 655 | Open in IMG/M |
| 3300032259|Ga0316190_10100712 | Not Available | 2027 | Open in IMG/M |
| 3300032262|Ga0316194_10086382 | Not Available | 2030 | Open in IMG/M |
| 3300032262|Ga0316194_10824185 | Not Available | 584 | Open in IMG/M |
| 3300032272|Ga0316189_10113355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 2198 | Open in IMG/M |
| 3300032272|Ga0316189_11421743 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 522 | Open in IMG/M |
| 3300033429|Ga0316193_10009940 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7212 | Open in IMG/M |
| 3300033429|Ga0316193_11245705 | Not Available | 591 | Open in IMG/M |
| 3300033429|Ga0316193_11411518 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 552 | Open in IMG/M |
| 3300033429|Ga0316193_11432621 | Not Available | 548 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 31.30% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 12.17% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 10.43% |
| Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Sediment | 9.57% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 9.57% |
| Worm Burrow | Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow | 4.35% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 3.48% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 3.48% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 3.48% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 2.61% |
| Sediment | Environmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment | 2.61% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.61% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 0.87% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.87% |
| Marine Hydrothermal Vent | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Hydrothermal Vent | 0.87% |
| Marine | Environmental → Aquatic → Marine → Oil Seeps → Unclassified → Marine | 0.87% |
| Marine Sediment | Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Marine Sediment | 0.87% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004008 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_CordB_D2 | Environmental | Open in IMG/M |
| 3300004113 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - COGITO 998_met_12 (version 2) | Environmental | Open in IMG/M |
| 3300005588 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.1 | Environmental | Open in IMG/M |
| 3300005589 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.2 | Environmental | Open in IMG/M |
| 3300005590 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2 | Environmental | Open in IMG/M |
| 3300005600 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.1 | Environmental | Open in IMG/M |
| 3300005601 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.1 | Environmental | Open in IMG/M |
| 3300005612 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.2 | Environmental | Open in IMG/M |
| 3300006467 | Coastal sediment microbial communities from Rhode Island, USA: Combined Assembly of Gp0121717, Gp0123912, Gp0123935 | Environmental | Open in IMG/M |
| 3300007102 | Combined Assembly of Marine Sediment Inoculum and Enrichments | Engineered | Open in IMG/M |
| 3300007614 | Soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_D1_MG | Environmental | Open in IMG/M |
| 3300009035 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_D1_MG | Environmental | Open in IMG/M |
| 3300009138 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_D2_MG | Environmental | Open in IMG/M |
| 3300010330 | Marine hydrothermal vent microbial communities from Guaymas Basin, Gulf of California to study Microbial Dark Matter (Phase II) - Marker 14 Mat core 4569-2 3-6 cm metaG | Environmental | Open in IMG/M |
| 3300010392 | Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385 | Environmental | Open in IMG/M |
| 3300010430 | Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples | Environmental | Open in IMG/M |
| 3300013099 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay6, Core 4569-2, 0-3 cm | Environmental | Open in IMG/M |
| 3300014903 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay12, Core 4567-28, 21-24 cm | Environmental | Open in IMG/M |
| 3300019696 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRC_3-4_MG | Environmental | Open in IMG/M |
| 3300019711 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BLC_4-5_MG | Environmental | Open in IMG/M |
| 3300019712 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRT_5-6_MG | Environmental | Open in IMG/M |
| 3300019748 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRC_4-5_MG | Environmental | Open in IMG/M |
| 3300022202 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_21 | Environmental | Open in IMG/M |
| 3300022206 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_24 | Environmental | Open in IMG/M |
| 3300022217 | Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_24 | Environmental | Open in IMG/M |
| 3300022218 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_13 | Environmental | Open in IMG/M |
| 3300022306 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_24 | Environmental | Open in IMG/M |
| 3300022308 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_24 | Environmental | Open in IMG/M |
| 3300024519 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_27 | Environmental | Open in IMG/M |
| 3300024528 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_23 | Environmental | Open in IMG/M |
| 3300025883 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - COGITO 998_met_11 (SPAdes) | Environmental | Open in IMG/M |
| 3300025895 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - COGITO 998_met_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025977 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_ThreeSqB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027820 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027828 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027845 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027852 | Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 7 (SPAdes) | Environmental | Open in IMG/M |
| 3300027856 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_23 | Environmental | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027978 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027980 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028598 | Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160420 (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300028599 | Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160524 (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300028600 | Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160317 (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300032136 | Coastal sediment microbial communities from Delaware Bay, Delaware, United States - CS-6 worm burrow | Environmental | Open in IMG/M |
| 3300032251 | Coastal sediment microbial communities from Oude Bieten Haven, Netherlands - site A anoxic | Environmental | Open in IMG/M |
| 3300032252 | Coastal sediment microbial communities from Maine, United States - Eddy sediment 2 cm | Environmental | Open in IMG/M |
| 3300032258 | Coastal sediment microbial communities from Maine, United States - Eddy worm burrow 2 cm | Environmental | Open in IMG/M |
| 3300032259 | Coastal sediment microbial communities from Maine, United States - Eddy worm burrow 2 | Environmental | Open in IMG/M |
| 3300032262 | Coastal sediment microbial communities from Maine, United States - Cross River sediment 1 | Environmental | Open in IMG/M |
| 3300032272 | Coastal sediment microbial communities from Maine, United States - Lowes Cove worm burrow | Environmental | Open in IMG/M |
| 3300033429 | Coastal sediment microbial communities from Maine, United States - Merrow Island sediment 2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0055446_102040071 | 3300004008 | Natural And Restored Wetlands | LFGILNLGHCDLPFDLAQDREPIEGLVEPFGIYYLLFELFNC* |
| Ga0065183_103627021 | 3300004113 | Pelagic Marine | QLFGILNFGHCDLPFDFAQDGGELVEPFGICVLLFEILNF* |
| Ga0070728_102775862 | 3300005588 | Marine Sediment | LGNLNFGHCVLPFDLAQGGGELVEPFGIYDLLFGILIAET* |
| Ga0070728_106811161 | 3300005588 | Marine Sediment | GHCDLPFDLAQGGGELVEPFGICVLRFEFLIAEA* |
| Ga0070729_100471901 | 3300005589 | Marine Sediment | VFDKFQISNKIKSQLFGILNFGHCDLPFGLAQGGGELVEPFGICILLFEI |
| Ga0070729_101171162 | 3300005589 | Marine Sediment | MKGSFLQGHKVWNFGHCDLPFDLAQGGGELVEPFGICELLFEIY* |
| Ga0070729_102271962 | 3300005589 | Marine Sediment | LFGILNFDHCDLPFDLAQGGGELVEPFDICDLLFEIFYY* |
| Ga0070729_104807512 | 3300005589 | Marine Sediment | QLFGILNIGHCDLPFDLAQGGEPVEPFVICVLLFEYLIAET* |
| Ga0070729_104987472 | 3300005589 | Marine Sediment | QLFGILNFGHCDLPFDLAQGGGELVEPFGICDLLFEIFLLKPEH* |
| Ga0070729_106367702 | 3300005589 | Marine Sediment | LFGLLNFGHCDLPFDLAQGGGERVEPFGICVLLFEIFITET* |
| Ga0070727_104429342 | 3300005590 | Marine Sediment | LFGILNFGHCDLPFDLAQGGGELVEPFGICDLLFEI |
| Ga0070726_103728402 | 3300005600 | Marine Sediment | LNFGHCVLPFDLAQGGGELVEPFGIYDLLFGILIAET* |
| Ga0070726_106896341 | 3300005600 | Marine Sediment | QLFGILNFGHCDLPFDLAQGGGELVEPFGICDLLFEIF* |
| Ga0070722_101018261 | 3300005601 | Marine Sediment | LGNLNFGHCDLPFDLAQGGGELVEPFGIYDLLFGILIAET* |
| Ga0070723_101055382 | 3300005612 | Marine Sediment | QLFGILNFGHCDLPFDLAQGDGELVEPFGICDLLFEIF* |
| Ga0070723_101813592 | 3300005612 | Marine Sediment | ILNFGHCYLPFDLAQGGGELVEPFGIYVLLFEIFYH* |
| Ga0099972_108814962 | 3300006467 | Marine | VNRLKRCSHAFEIWNFGHWDLPFDWAQGGELVEPFGICDLLFEIFNC* |
| Ga0099972_115694772 | 3300006467 | Marine | LFGILNFGHCDLPFDLAQGGGELVEPFGIYNLLFEFFNG* |
| Ga0099972_123623062 | 3300006467 | Marine | RQIKFEILNFDHCDLPFDVAQGGELVEPFGICVLLFEIFYY* |
| Ga0102541_13120992 | 3300007102 | Marine Sediment | IKSQLFGILNFGHCDLPFDLAQGGGELVEPFAICDLLFGILKNP* |
| Ga0102946_14151971 | 3300007614 | Soil | LFGIFNFGHCDLPFDLAQGGELVKPFGIYDLSFEI |
| Ga0102958_10355411 | 3300009035 | Soil | LFGIFNFGHCDLPFDLAQGGELVKPFGICDLSFEIF |
| Ga0102959_10172391 | 3300009138 | Soil | MNLKDLFPLFGILNFGHCDLPFDLAQGGELVKPFGIYDLSFEIFIVET* |
| Ga0136651_101597062 | 3300010330 | Marine Hydrothermal Vent | LAQMAADHSFGILNFGHCDLPFDLAQGGGELVEPFVICDLLFEIY* |
| Ga0118731_1009614141 | 3300010392 | Marine | ILNFGHCDLPFDLAQGGGELVEPFDICILLFEIF* |
| Ga0118731_1021034581 | 3300010392 | Marine | LFGILNFGHWDLPFDLAQGGGELVEPFGICVLLFEIF |
| Ga0118731_1031140222 | 3300010392 | Marine | LFGILNFGHCDLPFDLAQGGGELVEPFGICGLLFEIFITET* |
| Ga0118731_1032127771 | 3300010392 | Marine | QLFGILNFDNCDLPFDLAQGGGELVEPFGTCVLSFDTFNC* |
| Ga0118731_1091417681 | 3300010392 | Marine | LFGILNFGHCDLPFDLAQGGGELVEPFGICELLFEIY* |
| Ga0118731_1092707761 | 3300010392 | Marine | LFGISNFGHCDLPFDLAQGGGELVEPFGICVLLFEIF |
| Ga0118731_1096560522 | 3300010392 | Marine | LFGILNLGHCDLPFDLAQGGGELAEPFGIWYLLFEIY* |
| Ga0118731_1098254941 | 3300010392 | Marine | LFGILIFGHFDLPFDLAQGGGELVEPFDICVLLFEIF* |
| Ga0118731_1113035381 | 3300010392 | Marine | IQISNKIKSQLFGILNFGHCDLPFDLAQGGGELVESFGICDLLFEIFYY* |
| Ga0118731_1116382242 | 3300010392 | Marine | MLNFSHCDLPFDLAQGGGELVEPFGICDLLFEIY* |
| Ga0118731_1145665691 | 3300010392 | Marine | HCDLPFDLAQGGGELVEPFGICDLLFEIFLLKPEH* |
| Ga0118733_1003408741 | 3300010430 | Marine Sediment | KIKNQLFGILNFGHCYLPFDLAQGGGELVEPFGIYVLLFEIFYH* |
| Ga0118733_1009323801 | 3300010430 | Marine Sediment | LFGILNFGHCDLHFDLAQGGELVEPFGFWFLLFEIFLLLKS |
| Ga0118733_1015775961 | 3300010430 | Marine Sediment | LFGILIFGHCDLPFDLAQGGGELVEPFDICVLLFEIF* |
| Ga0118733_1020305521 | 3300010430 | Marine Sediment | NIQISNKIKNQLFGILNFGHCDLPFDLAQGGGELVEPFGIYDLRFFNC* |
| Ga0118733_1022350831 | 3300010430 | Marine Sediment | ILNLGHCDLPFDLAQGGELVEPFGICDLLFEIFNG* |
| Ga0118733_1023108752 | 3300010430 | Marine Sediment | QLFGILNFGHCDMPFDLAQGGELVEPFGICVLLFEIFNG* |
| Ga0118733_1030223582 | 3300010430 | Marine Sediment | LFGILNFGHCDLPFDLAQGGGELVEPFGICVLLFE |
| Ga0118733_1031948581 | 3300010430 | Marine Sediment | MFKTFEILNFGHCNLPFDFAQGGGELVEPFGICDLLFVITET* |
| Ga0118733_1032744592 | 3300010430 | Marine Sediment | QLFGILNFGHCDLPFDLAQGGELVEPFGFCYLLFGIFNC* |
| Ga0118733_1044269901 | 3300010430 | Marine Sediment | NYNIQISNKIKSQLFGILNFGHCDLPFDFAQDGGELVEPFGICVLLFEILNF* |
| Ga0118733_1047070191 | 3300010430 | Marine Sediment | LFGILNLGHCDLPFDLAQGGGELVEPFGICVLLF* |
| Ga0118733_1049107721 | 3300010430 | Marine Sediment | LFEILNFGHCDLPFDLAQGGGELVEPFGICDLLFEIF |
| Ga0118733_1076270422 | 3300010430 | Marine Sediment | LNFGHCDLPFDWAQGGESFDSAQDREPVEPFGICVLLFEIFYH* |
| Ga0118733_1095146401 | 3300010430 | Marine Sediment | LNFGHCDLPFDLAQGGGELVEPFGICVLLFEFFY* |
| Ga0164315_101087892 | 3300013099 | Marine Sediment | MPADHPFGILNFGHCDLPFDLAQGGEPVEPFGICVLVFVIF* |
| Ga0164315_104161451 | 3300013099 | Marine Sediment | FGILNFGHCDLPFDWAQGGEPVEPFVICDLIFGIYCP* |
| Ga0164315_104375411 | 3300013099 | Marine Sediment | PADHPFGILNFGLCDLPFDLAQSGGELVEPFDICDLLFEFF* |
| Ga0164321_102977851 | 3300014903 | Marine Sediment | MAADHPFGILNFGHCDLPFDLAQGGEPVEPFGICDLLFGIFNC* |
| Ga0194017_10130241 | 3300019696 | Sediment | KRQLFGILNFSHCDSPFDLAQGGGELVEPFGNCDLLFEVLYY |
| Ga0193993_10145832 | 3300019711 | Sediment | LFGILNFGHCDLPFDLAQGGGELVEPFGFCDLLFE |
| Ga0193969_10491551 | 3300019712 | Sediment | KLKRQLFGILNFGRCDLPFDLTQGGGERVEPFGICVLLFEIFYY |
| Ga0194018_10276051 | 3300019748 | Sediment | QISNKIKSQLFGNLNFGHCGLPFDLAQGGGELVEPFGICYLLFEIF |
| Ga0224498_100510081 | 3300022202 | Sediment | NFGHCDLPFDLAQSGGELVEPFGICYLIFLLLKPDT |
| Ga0224498_101484891 | 3300022202 | Sediment | PNLNIKISNKIKSQLFGILNFGHCDLPFDLAQGGGELVEPFGIYVLLFEIFYH |
| Ga0224498_101574052 | 3300022202 | Sediment | HQLFGILNLGHCDLPFDLAQGGGELVEPFAICGLLFEIF |
| Ga0224499_101700442 | 3300022206 | Sediment | LNFGHCDLPFDIAQGGELVEPFGSCFLSFEIFITET |
| Ga0224514_101156002 | 3300022217 | Sediment | MIKSQLFGNLNFGHCDLPFDLAQGGELVEPFGICNLLFEIFNG |
| Ga0224502_100371632 | 3300022218 | Sediment | LFGILNFGHCDLPFDLAQGGGELVEPFGICVLLFEIFYY |
| Ga0224502_101124482 | 3300022218 | Sediment | IKSQLFGILNFGHCDLPFDLAQGGGELVEPFGICVLLFEIF |
| Ga0224509_102213072 | 3300022306 | Sediment | LFGILNFGHCDLPFDLAQGGGELVEPFGIYVLLFEIF |
| Ga0224509_102332522 | 3300022306 | Sediment | NFSHCDLPFDLAQGGGELVEPFGICDLLYENLITDT |
| Ga0224509_102339422 | 3300022306 | Sediment | LFGILNFGHCDLPFDLAQGGELVEPFGICVLLFEIFN |
| Ga0224509_102545642 | 3300022306 | Sediment | LINKIKSQLFGILNFDHCDLPFDLAQGGGELVEPFGICVLLFEIFYY |
| Ga0224504_101034861 | 3300022308 | Sediment | LFGILNFGHCDLPFDLAQGGGELVEPFGICVLLFEI |
| (restricted) Ga0255046_103309662 | 3300024519 | Seawater | DKIKRRLFGILNFGHCDLPFDLAQGGGELVEPFGICVLLFEFFITET |
| (restricted) Ga0255046_104186492 | 3300024519 | Seawater | LFGILNFGHCDLPFDLAQGGGELVEPFGICVLLFEF |
| (restricted) Ga0255046_104824892 | 3300024519 | Seawater | NIKISNKIKSQLFGILIFGHFDLPFDLAQGGGELVEPFDICVLLFEIF |
| (restricted) Ga0255045_100244301 | 3300024528 | Seawater | DHEFGILNFGHCYLPFDSAQGGELVEPFDFYDLLFVISSFP |
| Ga0209456_100071535 | 3300025883 | Pelagic Marine | MINNQLFGILNFGHCDLPFDLAQGGGELVEPFGICDLLFEILIAEP |
| Ga0209456_100232594 | 3300025883 | Pelagic Marine | LNFGHCDLPFDLAQGGGELVEPFVICVLLFEYFTET |
| Ga0209456_100597233 | 3300025883 | Pelagic Marine | LFRILNFSHCDLPFDLAQGGGELVEPFGICDLLFEILIAET |
| Ga0209456_101481491 | 3300025883 | Pelagic Marine | LSGILNFGDCDLPFDLAQGGGELVEPFGICILLFEIF |
| Ga0209456_103524742 | 3300025883 | Pelagic Marine | TQLFGILNFGHCDLPIDLAQGGGELVEPFGICVLLFGYFTET |
| Ga0209567_100649633 | 3300025895 | Pelagic Marine | LFGILKFGHCDLPFDLAQGGGEFVEPFGICDLLFEIFLI |
| Ga0209567_100720701 | 3300025895 | Pelagic Marine | RRIGHCDLPFDLAQGGGELVEPFGICDLVFEIFIYGNLDTVH |
| Ga0209567_102284473 | 3300025895 | Pelagic Marine | LGVLNFGYCYLPFDLAQDGGELVEPFDICALLFEIFNC |
| Ga0209567_103304922 | 3300025895 | Pelagic Marine | LFGILNFDHCDLPFDLAQGGGELVEPFGFCDLLFEIFYY |
| Ga0209567_104512332 | 3300025895 | Pelagic Marine | LKFGHCDLPFDLAQGGGELVEPFGICDLLFEIFLLKPEH |
| Ga0210072_10394492 | 3300025977 | Natural And Restored Wetlands | LFGILTLGHCGLPFDLAQGGGELVEPFGICDLKFEIF |
| Ga0210072_10442411 | 3300025977 | Natural And Restored Wetlands | IQISDKIKRHLFGILNFGHCDLPFDLAQGGGELVEPFVICVLLFEIFYH |
| Ga0209578_102658621 | 3300027820 | Marine Sediment | LFGVLKLSHCDLPFDLAQGGGELVEPFGISVLLFE |
| Ga0209692_103204062 | 3300027828 | Marine Sediment | KSQLFGILNFGHCDLPFDLAQGGELVEPFGICDLLFEIFNC |
| Ga0209271_100316174 | 3300027845 | Marine Sediment | LFGVLKLSHCDLPFDLAQGGGELVEPFGISVLLFEIF |
| Ga0209271_101461301 | 3300027845 | Marine Sediment | FGILNFGHCDLPFDLAQGGGELVEPFGFCDLLFEIFYY |
| Ga0209345_103133781 | 3300027852 | Marine | MILNFGHCDLPFDLAQGGGELVEPFVICVLLFGIFYY |
| (restricted) Ga0255054_100109281 | 3300027856 | Seawater | MQTDHWFGILNLNHWDLPFDLAQGGELVEPFGICDLVFGIY |
| Ga0209536_1017123912 | 3300027917 | Marine Sediment | FGILNFGHCDLPFDLAQGGGESFDLAQDREPVEPFGICDLLFEIFYY |
| Ga0209165_100629542 | 3300027978 | Marine Sediment | LFGILNFGHCDLPFDLAQGGGELVEPFDFCDLLFEIFYY |
| Ga0209165_101586561 | 3300027978 | Marine Sediment | GMLNFSHCDLPFDLAQGGGELVEPFGICDLLFEIY |
| Ga0209475_100707942 | 3300027980 | Marine Sediment | LNFGHCYLPFDLAQGGGELVEPFGIYVLLFEIFYH |
| Ga0209475_100890583 | 3300027980 | Marine Sediment | LFGILNFGHCDLPFDFAQGGGELVEPFGICVLLFEIF |
| Ga0265306_107154122 | 3300028598 | Sediment | RFEILNFGHCSLPFDLAQGGELVEPFEICNLLFGI |
| Ga0265309_106161591 | 3300028599 | Sediment | MPIALNFGHCDLPYDLAQGGGELVEPFGICVLLFEIFN |
| Ga0265303_109226822 | 3300028600 | Sediment | VFGILNLKHCDLPFDLAQGGELVEPFEICYLVLGNS |
| Ga0316201_107341182 | 3300032136 | Worm Burrow | MGSFGIWIFGHCDLPFDMAQGGEPAEPFVICVLLFVILSFIL |
| Ga0316198_100892852 | 3300032251 | Sediment | LNFGHCDLPFDLAQGGGELVEPFGIYDLVFMIFLIAET |
| Ga0316198_101271902 | 3300032251 | Sediment | LFGILNFGHCDLPFDLAQGGELVEPFGICDLLFEILIVKT |
| Ga0316198_101935091 | 3300032251 | Sediment | LNKIKRQLFGILNFGHCDLPFDLAQGGGELVEPFGICVLLFEIFYY |
| Ga0316196_100106401 | 3300032252 | Sediment | LFGILNFGHCDLPFDLAQGGGELVEPFGIYVLLFEIFYH |
| Ga0316196_104381231 | 3300032252 | Sediment | RQLFGILNFGHCYLPFDLAQGGSELAESFGICVLLFEIFYY |
| Ga0316191_108649191 | 3300032258 | Worm Burrow | LGNLNFGHCVLPFDLAQGGGELVEPFGIYDLLFGILIAET |
| Ga0316190_101007122 | 3300032259 | Worm Burrow | FGSLNFSHCDLPFDLAQGAGELVEPFGICVLLFEIF |
| Ga0316194_100863822 | 3300032262 | Sediment | LNFGHCDLPFDLAQGGGELVEPFGICVLLFEIFYY |
| Ga0316194_108241852 | 3300032262 | Sediment | LFGILIFGHCDLPFDLAQGGGELVEPFDICVLLFEIFITDT |
| Ga0316189_101133551 | 3300032272 | Worm Burrow | NIQIHRRRIKRQLFGILNFGHCDLPFDLAQGGGELVEPFGIWNLLFGIF |
| Ga0316189_114217431 | 3300032272 | Worm Burrow | LFGILNFGHCDLPFDLAQGGGEPVEPFGICVLLFKIFLIAET |
| Ga0316193_100099406 | 3300033429 | Sediment | SNNIKRHLFGILNFGHCDLPFDLAQGGGELVEPFGIYNLLFEFFNG |
| Ga0316193_112457051 | 3300033429 | Sediment | LFGVLNFNHCDLPFGLAQGGEPVEPFVIWDLLFGIFAPKE |
| Ga0316193_114115181 | 3300033429 | Sediment | LFGILNFGHCDLPFDLAQGGGELAEPFGICNLVFVET |
| Ga0316193_114326212 | 3300033429 | Sediment | ILNFGHCDLPFDLAQGGGELVEPFGICVLLFEFFNC |
| ⦗Top⦘ |