


| Basic Information | |
|---|---|
| Family ID | F080014 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 115 |
| Average Sequence Length | 41 residues |
| Representative Sequence | PGFDVVGSPAELQAEVAGWPRKSTGNNASAKNDLALAA |
| Number of Associated Samples | 103 |
| Number of Associated Scaffolds | 115 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 7.83 % |
| % of genes near scaffold ends (potentially truncated) | 93.04 % |
| % of genes from short scaffolds (< 2000 bps) | 89.57 % |
| Associated GOLD sequencing projects | 101 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.18 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (64.348 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (13.043 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.217 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.826 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 30.30% β-sheet: 0.00% Coil/Unstructured: 69.70% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.18 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 115 Family Scaffolds |
|---|---|---|
| PF01668 | SmpB | 3.48 |
| PF07883 | Cupin_2 | 2.61 |
| PF00211 | Guanylate_cyc | 1.74 |
| PF00589 | Phage_integrase | 1.74 |
| PF00561 | Abhydrolase_1 | 1.74 |
| PF06441 | EHN | 0.87 |
| PF00196 | GerE | 0.87 |
| PF02494 | HYR | 0.87 |
| PF05866 | RusA | 0.87 |
| PF00293 | NUDIX | 0.87 |
| PF12680 | SnoaL_2 | 0.87 |
| PF05977 | MFS_3 | 0.87 |
| PF07859 | Abhydrolase_3 | 0.87 |
| PF13302 | Acetyltransf_3 | 0.87 |
| PF04655 | APH_6_hur | 0.87 |
| PF12728 | HTH_17 | 0.87 |
| PF01850 | PIN | 0.87 |
| PF01643 | Acyl-ACP_TE | 0.87 |
| PF07731 | Cu-oxidase_2 | 0.87 |
| PF03861 | ANTAR | 0.87 |
| PF07676 | PD40 | 0.87 |
| PF03704 | BTAD | 0.87 |
| PF07726 | AAA_3 | 0.87 |
| PF02899 | Phage_int_SAM_1 | 0.87 |
| PF01370 | Epimerase | 0.87 |
| PF01425 | Amidase | 0.87 |
| PF07366 | SnoaL | 0.87 |
| PF01810 | LysE | 0.87 |
| COG ID | Name | Functional Category | % Frequency in 115 Family Scaffolds |
|---|---|---|---|
| COG0691 | tmRNA-binding protein | Posttranslational modification, protein turnover, chaperones [O] | 3.48 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 1.74 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.87 |
| COG0596 | 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase fold | Coenzyme transport and metabolism [H] | 0.87 |
| COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 0.87 |
| COG2132 | Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) | Cell cycle control, cell division, chromosome partitioning [D] | 0.87 |
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 0.87 |
| COG3570 | Streptomycin 6-kinase | Defense mechanisms [V] | 0.87 |
| COG3629 | DNA-binding transcriptional regulator DnrI/AfsR/EmbR, SARP family, contains BTAD domain | Transcription [K] | 0.87 |
| COG3707 | Two-component response regulator, AmiR/NasT family, consists of REC and RNA-binding antiterminator (ANTAR) domains | Transcription [K] | 0.87 |
| COG3884 | Acyl-ACP thioesterase | Lipid transport and metabolism [I] | 0.87 |
| COG3947 | Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domains | Transcription [K] | 0.87 |
| COG4570 | Holliday junction resolvase RusA (prophage-encoded endonuclease) | Replication, recombination and repair [L] | 0.87 |
| COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 0.87 |
| COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 0.87 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 64.35 % |
| All Organisms | root | All Organisms | 35.65 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001205|C688J13580_1030433 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 682 | Open in IMG/M |
| 3300001686|C688J18823_10339543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 980 | Open in IMG/M |
| 3300002568|C688J35102_118393177 | Not Available | 555 | Open in IMG/M |
| 3300002568|C688J35102_119980031 | Not Available | 834 | Open in IMG/M |
| 3300002915|JGI25387J43893_1066312 | Not Available | 532 | Open in IMG/M |
| 3300004070|Ga0055488_10220667 | Not Available | 519 | Open in IMG/M |
| 3300005171|Ga0066677_10272979 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 964 | Open in IMG/M |
| 3300005175|Ga0066673_10167992 | Not Available | 1232 | Open in IMG/M |
| 3300005176|Ga0066679_10032112 | All Organisms → cellular organisms → Bacteria | 2904 | Open in IMG/M |
| 3300005179|Ga0066684_11105059 | Not Available | 507 | Open in IMG/M |
| 3300005181|Ga0066678_10939023 | Not Available | 564 | Open in IMG/M |
| 3300005181|Ga0066678_10953228 | Not Available | 559 | Open in IMG/M |
| 3300005186|Ga0066676_11007222 | Not Available | 554 | Open in IMG/M |
| 3300005332|Ga0066388_101275990 | Not Available | 1264 | Open in IMG/M |
| 3300005333|Ga0070677_10811786 | Not Available | 535 | Open in IMG/M |
| 3300005334|Ga0068869_101343118 | Not Available | 631 | Open in IMG/M |
| 3300005364|Ga0070673_102306378 | Not Available | 512 | Open in IMG/M |
| 3300005434|Ga0070709_11074744 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 643 | Open in IMG/M |
| 3300005454|Ga0066687_10649962 | Not Available | 627 | Open in IMG/M |
| 3300005455|Ga0070663_101787138 | Not Available | 551 | Open in IMG/M |
| 3300005458|Ga0070681_10219515 | Not Available | 1816 | Open in IMG/M |
| 3300005526|Ga0073909_10008287 | All Organisms → cellular organisms → Bacteria | 3107 | Open in IMG/M |
| 3300005555|Ga0066692_10406820 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 863 | Open in IMG/M |
| 3300005561|Ga0066699_11270337 | Not Available | 505 | Open in IMG/M |
| 3300005563|Ga0068855_101381229 | Not Available | 726 | Open in IMG/M |
| 3300005569|Ga0066705_10080765 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1898 | Open in IMG/M |
| 3300005576|Ga0066708_10470314 | Not Available | 808 | Open in IMG/M |
| 3300005576|Ga0066708_10605530 | Not Available | 701 | Open in IMG/M |
| 3300005587|Ga0066654_10781116 | Not Available | 541 | Open in IMG/M |
| 3300005764|Ga0066903_100426281 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2200 | Open in IMG/M |
| 3300005764|Ga0066903_101586323 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1240 | Open in IMG/M |
| 3300005764|Ga0066903_105567989 | Not Available | 663 | Open in IMG/M |
| 3300005844|Ga0068862_102176079 | Not Available | 566 | Open in IMG/M |
| 3300005985|Ga0081539_10027951 | All Organisms → cellular organisms → Bacteria | 3557 | Open in IMG/M |
| 3300006046|Ga0066652_101730448 | Not Available | 568 | Open in IMG/M |
| 3300006576|Ga0074047_10018406 | Not Available | 502 | Open in IMG/M |
| 3300006795|Ga0075520_1148846 | All Organisms → cellular organisms → Bacteria | 1023 | Open in IMG/M |
| 3300006796|Ga0066665_10943227 | Not Available | 665 | Open in IMG/M |
| 3300006844|Ga0075428_100392136 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1488 | Open in IMG/M |
| 3300006846|Ga0075430_100181551 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1750 | Open in IMG/M |
| 3300006846|Ga0075430_100859369 | Not Available | 747 | Open in IMG/M |
| 3300006871|Ga0075434_100032131 | All Organisms → cellular organisms → Bacteria | 5175 | Open in IMG/M |
| 3300006876|Ga0079217_10756133 | Not Available | 665 | Open in IMG/M |
| 3300006876|Ga0079217_10923386 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 626 | Open in IMG/M |
| 3300006903|Ga0075426_10032356 | All Organisms → cellular organisms → Bacteria | 3739 | Open in IMG/M |
| 3300006904|Ga0075424_100935343 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
| 3300006954|Ga0079219_10582595 | Not Available | 813 | Open in IMG/M |
| 3300006969|Ga0075419_10025242 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3681 | Open in IMG/M |
| 3300009094|Ga0111539_12400767 | Not Available | 612 | Open in IMG/M |
| 3300009094|Ga0111539_12852888 | Not Available | 560 | Open in IMG/M |
| 3300009137|Ga0066709_104667404 | Not Available | 501 | Open in IMG/M |
| 3300009147|Ga0114129_10119722 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3626 | Open in IMG/M |
| 3300009147|Ga0114129_12173406 | Not Available | 668 | Open in IMG/M |
| 3300009156|Ga0111538_10466074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1601 | Open in IMG/M |
| 3300009553|Ga0105249_12929993 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 548 | Open in IMG/M |
| 3300009807|Ga0105061_1073832 | Not Available | 559 | Open in IMG/M |
| 3300009808|Ga0105071_1064332 | Not Available | 615 | Open in IMG/M |
| 3300009817|Ga0105062_1129470 | Not Available | 517 | Open in IMG/M |
| 3300009819|Ga0105087_1085640 | Not Available | 568 | Open in IMG/M |
| 3300010060|Ga0127425_106299 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Ascaridomorpha → Ascaridoidea → Toxocaridae → Toxocara → Toxocara canis | 649 | Open in IMG/M |
| 3300010098|Ga0127463_1040476 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 502 | Open in IMG/M |
| 3300010104|Ga0127446_1018840 | Not Available | 504 | Open in IMG/M |
| 3300010371|Ga0134125_11136471 | Not Available | 854 | Open in IMG/M |
| 3300010398|Ga0126383_12110986 | Not Available | 650 | Open in IMG/M |
| 3300010403|Ga0134123_12090556 | Not Available | 626 | Open in IMG/M |
| 3300012209|Ga0137379_11765772 | Not Available | 514 | Open in IMG/M |
| 3300012211|Ga0137377_10988238 | Not Available | 772 | Open in IMG/M |
| 3300012377|Ga0134029_1107912 | Not Available | 528 | Open in IMG/M |
| 3300012397|Ga0134056_1248286 | Not Available | 626 | Open in IMG/M |
| 3300012404|Ga0134024_1068625 | Not Available | 539 | Open in IMG/M |
| 3300014325|Ga0163163_13255558 | Not Available | 506 | Open in IMG/M |
| 3300014488|Ga0182001_10096195 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 909 | Open in IMG/M |
| 3300014497|Ga0182008_10337752 | Not Available | 796 | Open in IMG/M |
| 3300015359|Ga0134085_10438305 | Not Available | 591 | Open in IMG/M |
| 3300015371|Ga0132258_10273983 | All Organisms → cellular organisms → Bacteria | 4138 | Open in IMG/M |
| 3300015371|Ga0132258_10890716 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → unclassified Chloroflexia → Chloroflexia bacterium SDU3-3 | 2247 | Open in IMG/M |
| 3300015371|Ga0132258_12850586 | Not Available | 1203 | Open in IMG/M |
| 3300016404|Ga0182037_10639223 | Not Available | 906 | Open in IMG/M |
| 3300017947|Ga0187785_10132617 | All Organisms → cellular organisms → Bacteria | 1030 | Open in IMG/M |
| 3300018028|Ga0184608_10398646 | Not Available | 598 | Open in IMG/M |
| 3300018060|Ga0187765_10181169 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1207 | Open in IMG/M |
| 3300018073|Ga0184624_10068711 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1472 | Open in IMG/M |
| 3300018422|Ga0190265_10583425 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium RBG_16_68_12 | 1236 | Open in IMG/M |
| 3300018422|Ga0190265_11461340 | Not Available | 797 | Open in IMG/M |
| 3300018433|Ga0066667_11148855 | Not Available | 674 | Open in IMG/M |
| 3300018466|Ga0190268_11743441 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 558 | Open in IMG/M |
| 3300019249|Ga0184648_1263179 | Not Available | 532 | Open in IMG/M |
| 3300019361|Ga0173482_10398266 | Not Available | 639 | Open in IMG/M |
| 3300020059|Ga0193745_1096145 | Not Available | 634 | Open in IMG/M |
| 3300020069|Ga0197907_10158716 | Not Available | 541 | Open in IMG/M |
| 3300020075|Ga0206349_1723916 | Not Available | 604 | Open in IMG/M |
| 3300025324|Ga0209640_10026400 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → unclassified Nocardioides → Nocardioides sp. URHA0032 | 5062 | Open in IMG/M |
| 3300025791|Ga0210115_1041352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 998 | Open in IMG/M |
| 3300025935|Ga0207709_10917417 | Not Available | 713 | Open in IMG/M |
| 3300026116|Ga0207674_10754158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 939 | Open in IMG/M |
| 3300026221|Ga0209848_1079631 | Not Available | 576 | Open in IMG/M |
| 3300026535|Ga0256867_10344234 | Not Available | 521 | Open in IMG/M |
| 3300026550|Ga0209474_10236958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1136 | Open in IMG/M |
| 3300027332|Ga0209861_1061707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 553 | Open in IMG/M |
| 3300027636|Ga0214469_1089237 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 912 | Open in IMG/M |
| 3300027907|Ga0207428_11000109 | Not Available | 588 | Open in IMG/M |
| 3300027961|Ga0209853_1029576 | All Organisms → cellular organisms → Bacteria | 1614 | Open in IMG/M |
| 3300028717|Ga0307298_10076231 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 937 | Open in IMG/M |
| 3300028768|Ga0307280_10005294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3341 | Open in IMG/M |
| 3300028787|Ga0307323_10123352 | Not Available | 932 | Open in IMG/M |
| 3300028819|Ga0307296_10329720 | Not Available | 833 | Open in IMG/M |
| 3300030635|Ga0247627_10354449 | Not Available | 506 | Open in IMG/M |
| 3300030986|Ga0308154_104630 | Not Available | 792 | Open in IMG/M |
| 3300030993|Ga0308190_1161168 | Not Available | 541 | Open in IMG/M |
| 3300031091|Ga0308201_10381860 | Not Available | 525 | Open in IMG/M |
| 3300031491|Ga0314824_104096 | Not Available | 706 | Open in IMG/M |
| 3300031547|Ga0310887_10950796 | Not Available | 546 | Open in IMG/M |
| 3300031716|Ga0310813_12039120 | Not Available | 541 | Open in IMG/M |
| 3300031892|Ga0310893_10202025 | Not Available | 802 | Open in IMG/M |
| 3300034676|Ga0314801_175513 | Not Available | 534 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 13.04% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 12.17% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 11.30% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 6.09% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 5.22% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 5.22% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.48% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.61% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.61% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.61% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.74% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.74% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.74% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.74% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.74% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.74% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.74% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.87% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.87% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.87% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.87% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.87% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.87% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.87% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.87% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.87% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.87% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.87% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.87% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.87% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.87% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.87% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.87% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.87% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.87% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.87% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001205 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300002915 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm | Environmental | Open in IMG/M |
| 3300004070 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006576 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006795 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009807 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_0_10 | Environmental | Open in IMG/M |
| 3300009808 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_40_50 | Environmental | Open in IMG/M |
| 3300009817 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 | Environmental | Open in IMG/M |
| 3300009819 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_40_50 | Environmental | Open in IMG/M |
| 3300010060 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010098 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010104 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012377 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012397 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012404 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014488 | Bulk soil microbial communities from Mexico - San Felipe (SF) metaG | Environmental | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300019249 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300020059 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a2 | Environmental | Open in IMG/M |
| 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025791 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026221 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-062 (SPAdes) | Environmental | Open in IMG/M |
| 3300026535 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027332 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300027636 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 HiSeq | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027961 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300030635 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bnb4 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030986 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_143 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030993 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_185 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031091 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031491 | Metatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - MICR_R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031892 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2 | Environmental | Open in IMG/M |
| 3300034676 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| C688J13580_10304332 | 3300001205 | Soil | VVGSPAELQAEVAGWPRKSTGNNASAKNDLALAA* |
| C688J18823_103395432 | 3300001686 | Soil | VVDSPAELQAEVAGWPRKSTGKTVRAKTNLALAA* |
| C688J35102_1183931772 | 3300002568 | Soil | GRHGFDVVGSPGELQAEVSGRPPKTTGTNASAENNLALAA* |
| C688J35102_1199800311 | 3300002568 | Soil | RGRHGFDVVGSPAELQAEVSGRPRKTTGNQKVSAENKLALAA* |
| JGI25387J43893_10663121 | 3300002915 | Grasslands Soil | MQLDIRGRPGFDVVGSPAELQAEVAGWPRKSTGKNASANDKLALAA* |
| Ga0055488_102206671 | 3300004070 | Natural And Restored Wetlands | LWGRSGFDGVGSPEELQAEVPGGLVKQPGNNVSADRNELALAA* |
| Ga0066677_102729791 | 3300005171 | Soil | HIRGRPGFDVVGSPAELQAEVAGRPRKTTGTNASAKTDLALAA* |
| Ga0066673_101679924 | 3300005175 | Soil | TYGGDLVDVVGSPAELQAEVAGWPRKSTGKHVSAKNDLALAA* |
| Ga0066679_100321125 | 3300005176 | Soil | IRGRSGLDVVDSPAELQAEVAGWPRKSTGTNASAKQNLALAA* |
| Ga0066684_111050592 | 3300005179 | Soil | TYIRGRHGFDVVGSPGELQAEVSGGLQNNRKNNASAENNLALAA* |
| Ga0066678_109390233 | 3300005181 | Soil | IEATMCAHIRGRSGFDVVDSPAELQAEVPGRPPKTTGTNASANDNLALAA* |
| Ga0066678_109532281 | 3300005181 | Soil | NIRGRHGFDVVGSPGELQAEVSGRPPKTTGTNASADHDLALAA* |
| Ga0066676_110072222 | 3300005186 | Soil | DIRGRPGFDVVGSPAELQAEVAGRPRKTTGTNASAKNELALAA* |
| Ga0066388_1012759902 | 3300005332 | Tropical Forest Soil | GFDVVDSPVELQAEVPGRPRKTTGINVSAKNDHALALAA* |
| Ga0070677_108117861 | 3300005333 | Miscanthus Rhizosphere | IRGRPGFDVVGSPVELQAEVPGRPRKTTGKRTNAKNELAIAA* |
| Ga0068869_1013431181 | 3300005334 | Miscanthus Rhizosphere | WGRPGFDVVGSPEELQAEVPGRPRKTTGNKASAKNDLALAA* |
| Ga0070673_1023063782 | 3300005364 | Switchgrass Rhizosphere | IRGRPGFDVVGSPAELQAEVPGRPRKTTGNKASAKNDLALAA* |
| Ga0070709_110747442 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | IRGRPGFDVVGSPAELQAEVAGWPRKSTGNNASAKNDLALAA* |
| Ga0066687_106499621 | 3300005454 | Soil | DIRGRPGFDVVGSPAELQAEVAGWPRKSTGKKASAKNDLALAA* |
| Ga0070663_1017871381 | 3300005455 | Corn Rhizosphere | HTGATGLDVVGSPAELRAEVAGWPRKSTGTKASANKNELALAA* |
| Ga0070681_102195151 | 3300005458 | Corn Rhizosphere | RPGIDVVDSPVEQRAEVAGRPRKTTGTNASAKNDLALAA* |
| Ga0073909_100082874 | 3300005526 | Surface Soil | VVDSPAELQAEVAGWPRKSTGKTVRAKNNLALAA* |
| Ga0066692_104068202 | 3300005555 | Soil | VVGSPAELQAEVAGWPRKSTGKQASAKNDLALAA* |
| Ga0066699_112703373 | 3300005561 | Soil | IRGRHGFDVVGSPGELQAEVSGGLQNNRKNNASAENNLALAA* |
| Ga0068855_1013812292 | 3300005563 | Corn Rhizosphere | PGIDVVDSPVEQRAEVAGRPRKTTGTNASAKNDLALAA* |
| Ga0066705_100807654 | 3300005569 | Soil | VVDSPAELQAEVAGWPRKSTGTNASAKQNLALAA* |
| Ga0066708_104703142 | 3300005576 | Soil | HTYGGDLVDVVGSPAELQAEVAGWPRKSTGKQSKCEDNLALAA* |
| Ga0066708_106055302 | 3300005576 | Soil | DIRGRPGFDVVGSPAELQAEVAGWPRKSTGKNASANDKLALAA* |
| Ga0066654_107811161 | 3300005587 | Soil | DIRGRPGFDVVDSPAELQAEVAGRPRKTTGNNASAKNELALAA* |
| Ga0066903_1004262811 | 3300005764 | Tropical Forest Soil | VVGSPAELQAEVAGWPRKSTGKHVSAKNDLALAA* |
| Ga0066903_1015863231 | 3300005764 | Tropical Forest Soil | LDVVGSPAELRAEVAGWPRKSTGTKASANKNELALAA* |
| Ga0066903_1055679892 | 3300005764 | Tropical Forest Soil | DIRGRPGFDVVGSPAELRAEVAGWPRKSTGNNASAKNDLALAA* |
| Ga0068862_1021760791 | 3300005844 | Switchgrass Rhizosphere | HNIRGRPGFDVVGSPVELQAEVPGRPRKTTGKRTNAKNELAIAA* |
| Ga0081539_100279514 | 3300005985 | Tabebuia Heterophylla Rhizosphere | VVGSPAELQAEVAGWPRKSTGNKASAKNDLALAA* |
| Ga0066652_1017304481 | 3300006046 | Soil | MQLDIRGRPGFDVVGSPAELQAEVAGWPRKSTGKNASANDKL |
| Ga0074047_100184061 | 3300006576 | Soil | RPGFDVVGSPAEQRAEVAGWPRKSTGTKASANKNELALAA* |
| Ga0075520_11488461 | 3300006795 | Arctic Peat Soil | GYTVDNTQRGRHGFDVVGSPVELQAEVSGRPRKTTGNNASADHNLALAA* |
| Ga0066665_109432271 | 3300006796 | Soil | IRGRPGFDVVGSPAELQAEVAGWPRKSTGKQASAKNDLALAA* |
| Ga0075428_1003921361 | 3300006844 | Populus Rhizosphere | GLDVVGSPAELRAEVAGWPRKSTGTKASANKNELALAA* |
| Ga0075430_1001815514 | 3300006846 | Populus Rhizosphere | GRSGFDGVGSPEELQAEVPGWPRKTTGNNVSADRNELALAA* |
| Ga0075430_1008593693 | 3300006846 | Populus Rhizosphere | PGLDVVGSPAELRAEVAGWPRKSTGTKASANKNELALAA* |
| Ga0075434_1000321311 | 3300006871 | Populus Rhizosphere | AAKMQLDIRGRPGFDVVGSPAELQAEVAGWPRKSTGKNASANDKLALAA* |
| Ga0079217_107561333 | 3300006876 | Agricultural Soil | FWGRPGFDVVGSPEELQAEVPGRPRKTTGNNVSADHKLALAA* |
| Ga0079217_109233861 | 3300006876 | Agricultural Soil | RVRPGSYNSDFWGRSGFDGVGSPEELQAEVPGWPRKTTGNNVSADRNELALAA* |
| Ga0075426_100323561 | 3300006903 | Populus Rhizosphere | DVVGSPAELQAEVAGWPRKSTGKNASANDKLALAA* |
| Ga0075424_1009353431 | 3300006904 | Populus Rhizosphere | IRGRPGFDVVDSPAELQAEVAGRPRKTTGTNASAKNDLALAA* |
| Ga0079219_105825953 | 3300006954 | Agricultural Soil | TYGGDLVDVVGSPAELQAEVAGWPRKSTGKNASANDKLALAA* |
| Ga0075419_100252423 | 3300006969 | Populus Rhizosphere | VWGRSGFDGVGSPEELQAEVPGWPRKTTGNNVSADRNELALAA* |
| Ga0111539_124007672 | 3300009094 | Populus Rhizosphere | DVVGSPAELRAEVAGWPRKSTGTKASANKNELALAA* |
| Ga0111539_128528882 | 3300009094 | Populus Rhizosphere | GYNADAWGRSGFDVVGSPGELQAEVPGWPRKTTGNNASANDELALAA* |
| Ga0066709_1046674041 | 3300009137 | Grasslands Soil | HIRGRPGFDVVGSPAELQAEVAGWPRKSTGNKASAKNDLALAA* |
| Ga0114129_101197221 | 3300009147 | Populus Rhizosphere | IRGRPGFDVVGSPAELQAEVAGWPRKSTGNKASAKNDLALAA* |
| Ga0114129_121734062 | 3300009147 | Populus Rhizosphere | RPGLDVVGSPAELRAEVAGWPRKSTGTKASANKNELALAA* |
| Ga0111538_104660742 | 3300009156 | Populus Rhizosphere | RPGFDVVGSPAELQAEVAGWPRKSTGKNASANDKLALAA* |
| Ga0105249_129299931 | 3300009553 | Switchgrass Rhizosphere | NIRGRHGFDVVGSPAELQAEVSGRPRKTTGTNASAEHDLALVA* |
| Ga0105061_10738322 | 3300009807 | Groundwater Sand | GFDGVGSPEELQAEVPGWPRKTTGNKASANKNELALAA* |
| Ga0105071_10643321 | 3300009808 | Groundwater Sand | GYTLSLWGRSGFDGVGSPEELQAEVPGWPRKTTGNKASANKNELALAA* |
| Ga0105062_11294702 | 3300009817 | Groundwater Sand | FNPWGRSGFDGVGSPEELQAEVPGRPRKTTGNKASANKNELVLAA* |
| Ga0105087_10856402 | 3300009819 | Groundwater Sand | AILSVIWGRSGFDGVGSPEELQAEVPGWPRKTTGNKASANKNELALAA* |
| Ga0127425_1062991 | 3300010060 | Grasslands Soil | GFDVVGSPAELRAEVAGWPRKSTGTKASANKNELALAA* |
| Ga0127463_10404762 | 3300010098 | Grasslands Soil | DVVDSPAELQAEVPGRPPKTTGTNASANNNLALAA* |
| Ga0127446_10188402 | 3300010104 | Grasslands Soil | FDVVGSPEELQAEVPGRPRKTTGNNASADNKLALAA* |
| Ga0134125_111364711 | 3300010371 | Terrestrial Soil | GIDVVDSPVEQRAEVAGRPRKTTGTNASAKNDLALAA* |
| Ga0126383_121109862 | 3300010398 | Tropical Forest Soil | DIRGRPGFDVVGSPAELQAEVAGWPRKSTGNKASAKNDLALAA* |
| Ga0134123_120905561 | 3300010403 | Terrestrial Soil | VVDSPVEQRAEVAGRPRKTTGTNASAKNDLALAA* |
| Ga0137379_117657721 | 3300012209 | Vadose Zone Soil | PGFDVVGSPAELQAEVAGWPRKSTGNNASAKNDLALAA* |
| Ga0137377_109882382 | 3300012211 | Vadose Zone Soil | RGRPGFDVVGSPAELQAEVAGWPRKSTGKQASAKNDLALAA* |
| Ga0134029_11079121 | 3300012377 | Grasslands Soil | RPGFDVVGSPAELQAEVAGWPRKSTGKQASAKNDLALAA* |
| Ga0134056_12482861 | 3300012397 | Grasslands Soil | GFDVVGSPAELQAEVSGRPPKTTGTNASAKNDLALAA* |
| Ga0134024_10686251 | 3300012404 | Grasslands Soil | FDVVGSPAELRAEVAGWPRKSTGNNASAKNDLALAA* |
| Ga0163163_132555581 | 3300014325 | Switchgrass Rhizosphere | DVVGSPEELQAEVPGRPRKTTGNKASAKNDLALAA* |
| Ga0182001_100961951 | 3300014488 | Soil | DVVGSPEELQAEVPGRPRKTTGNNASAKNDLALAA* |
| Ga0182008_103377522 | 3300014497 | Rhizosphere | FDVVGSPEELQAEVPGRPRKTTGNKASAKNDLALAA* |
| Ga0134085_104383051 | 3300015359 | Grasslands Soil | FWLWGRSGFDVVGSPEELQAEVPGRPRKTTGNNASADNKLALAA* |
| Ga0132258_102739831 | 3300015371 | Arabidopsis Rhizosphere | ADIRGRPGFDVVGSPAELQAEVAGWPRKSTGNKASAKNDLALAA* |
| Ga0132258_108907161 | 3300015371 | Arabidopsis Rhizosphere | PGLDVVGSPVEQRAEVAGRPRKTTGTNASAKNDLALAA* |
| Ga0132258_128505861 | 3300015371 | Arabidopsis Rhizosphere | VVGSPAELRAEVAGWPRKSTGNNASAKNDLALAA* |
| Ga0182037_106392232 | 3300016404 | Soil | PGFDVVGSPAELRAEVAGWPRKSTGTTASANKNELALAA |
| Ga0187785_101326172 | 3300017947 | Tropical Peatland | DVVGSPAELRAEVAGWPRKSTGNNASAKNDLALAA |
| Ga0184608_103986461 | 3300018028 | Groundwater Sediment | PGFDVVGSPAELQAEVSGRPPKTTGTNASADNELALAA |
| Ga0187765_101811693 | 3300018060 | Tropical Peatland | FDVVGSPAELRAEVAGWPRKSTGNNASAKNDLALAA |
| Ga0184624_100687112 | 3300018073 | Groundwater Sediment | GFDVVGSPEELQAEVPGRPRKSTGKQINAKNDLAIAA |
| Ga0190265_105834251 | 3300018422 | Soil | GLDVVGSPAELRAEVAGWPRKSTGTKASANKNELALAA |
| Ga0190265_114613403 | 3300018422 | Soil | GYTFSLWGRSGFDGVGSPEELQAEVPGRPRKTTGNNVSADRDNLALAA |
| Ga0066667_111488552 | 3300018433 | Grasslands Soil | IRGRPGFDVVGSPAELQAEVAGWPRKSTGKQASAKNDLALAA |
| Ga0190268_117434412 | 3300018466 | Soil | FDVVDSPAEQRAEVAGRPRKTTGKKASAKNDLALAA |
| Ga0184648_12631791 | 3300019249 | Groundwater Sediment | SGLDVVGSPAELRAEVAGWPRKSTGTKASANKNQLALAA |
| Ga0173482_103982661 | 3300019361 | Soil | RPGFDVVGSPAELQAEVAGWPRKSTGKNASANDKLALAA |
| Ga0193745_10961451 | 3300020059 | Soil | RRYNSRNIRGRSGFDVVDSPAELQAEVAGWPRKSTGKTVRAKNNLALAA |
| Ga0197907_101587161 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | HGFDVVGSPVELQAEVSGRPRKTTGNNASAENNLALAA |
| Ga0206349_17239161 | 3300020075 | Corn, Switchgrass And Miscanthus Rhizosphere | DVVDSPVEQRAEVAGRPRKTTGTNASAKNDLALAA |
| Ga0209640_100264001 | 3300025324 | Soil | GLDVVGSPAELRAEVAGWPRKSTGTKASANKNDLALAA |
| Ga0210115_10413521 | 3300025791 | Natural And Restored Wetlands | WRPGFDVVGSPEELQAEVPGRPRKTTGNNASAKNDLALAA |
| Ga0207709_109174172 | 3300025935 | Miscanthus Rhizosphere | DVVGSPAELRAEVAGWPRKSTGTKASANKNELALAA |
| Ga0207674_107541581 | 3300026116 | Corn Rhizosphere | WGRPGFDVVGSPEELQAEVPGRPRKTTGNNASAKNDLALAA |
| Ga0209848_10796311 | 3300026221 | Permafrost Soil | QQENIGGRHGFDVVGSPDELQAEVSGRPRKTTGTNASADHNLALAA |
| Ga0256867_103442341 | 3300026535 | Soil | PPPGYTFKLWGRSGFDGVGSPEELQAEVPGWPRKTTGNNASADRNELALAA |
| Ga0209474_102369583 | 3300026550 | Soil | HNIRGRPGFDVVGSPAELQAEVAGWPRKSTGNKASAKNDLALAA |
| Ga0209861_10617071 | 3300027332 | Groundwater Sand | RLYFDAWGRSGLDGVGSPEELQAEVPGRPRKTTGNNVSADRNELALAA |
| Ga0214469_10892372 | 3300027636 | Soil | TFRLWGRSGFDGVGSPEELQAEVPGWPRKTTGNNASADRNELALAA |
| Ga0207428_110001091 | 3300027907 | Populus Rhizosphere | RGRPGFDVVGSPVEQRAEVAGRPRKSTGTKASAKNDLALAA |
| Ga0209853_10295763 | 3300027961 | Groundwater Sand | GYTLSLWGRSGFDGVGSPEELQAEVPGRPRKTTGNNASAKPNELALAA |
| Ga0307298_100762311 | 3300028717 | Soil | MLDALTHIRGRSGFDVVGSPVELRAEVAGWPRKSTGTKASANKNELALAA |
| Ga0307280_100052941 | 3300028768 | Soil | GRSGFDVVDSPAELQAEVAGWPRKSTGKTVRAKNNLALAA |
| Ga0307323_101233523 | 3300028787 | Soil | VYNFKFWGRSGFDVVGSPEELQAEVPGRPRKTTGNNASADNKLALAA |
| Ga0307296_103297202 | 3300028819 | Soil | MLVALTHIRGRSGFDVVGSPAELRAEVAGWPRKSTGTKASANKNELAL |
| Ga0247627_103544491 | 3300030635 | Soil | SEIDIRGRPGLDVVGSPAELRAEVAGWPRKSTGTKASANKNELALAA |
| Ga0308154_1046301 | 3300030986 | Soil | FDVVGSPEELQAEVPGRPRKTTGNNASADNKLALAA |
| Ga0308190_11611681 | 3300030993 | Soil | GFDVVGSPDELQAEVPGRPRKTTGNNASAKNDLALAA |
| Ga0308201_103818601 | 3300031091 | Soil | GLVVVGSPAELRAEVAGWPRKSTGTKASANKNELALAA |
| Ga0314824_1040961 | 3300031491 | Soil | FDVVGSPAELQAEVPGRPRKTTGTNASAKNELALAA |
| Ga0310887_109507961 | 3300031547 | Soil | RPGSYDSGVWGRSGFDGVGSPEELQAEVPGWPRKTTGNNVSADRNELALAA |
| Ga0310813_120391201 | 3300031716 | Soil | GFDVVGSPAELQAEVAGWPRKSTGKHVSAKNDLALAA |
| Ga0310893_102020251 | 3300031892 | Soil | PGLDVVGSPAELRAEVAGWPRKSTGTKASANKNELALAA |
| Ga0314801_175513_1_117 | 3300034676 | Soil | PGFDVVGSPVELQAEVPGRPRKTTGKRTNAKNELAIAA |
| ⦗Top⦘ |