


| Basic Information | |
|---|---|
| Family ID | F079984 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 115 |
| Average Sequence Length | 37 residues |
| Representative Sequence | LNKIAFLHAIVVDFCVERLQGFGMVSAEILQFYFGEKG |
| Number of Associated Samples | 92 |
| Number of Associated Scaffolds | 115 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 16.52 % |
| % of genes near scaffold ends (potentially truncated) | 22.61 % |
| % of genes from short scaffolds (< 2000 bps) | 88.70 % |
| Associated GOLD sequencing projects | 81 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (88.696 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (23.478 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.609 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.217 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 43.94% β-sheet: 0.00% Coil/Unstructured: 56.06% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 115 Family Scaffolds |
|---|---|---|
| PF05598 | DUF772 | 68.70 |
| PF00188 | CAP | 0.87 |
| PF01436 | NHL | 0.87 |
| PF14833 | NAD_binding_11 | 0.87 |
| PF03050 | DDE_Tnp_IS66 | 0.87 |
| PF13580 | SIS_2 | 0.87 |
| PF00118 | Cpn60_TCP1 | 0.87 |
| PF13490 | zf-HC2 | 0.87 |
| PF04368 | DUF507 | 0.87 |
| PF13174 | TPR_6 | 0.87 |
| PF04389 | Peptidase_M28 | 0.87 |
| PF07969 | Amidohydro_3 | 0.87 |
| PF00158 | Sigma54_activat | 0.87 |
| PF00408 | PGM_PMM_IV | 0.87 |
| PF02897 | Peptidase_S9_N | 0.87 |
| PF00905 | Transpeptidase | 0.87 |
| PF00857 | Isochorismatase | 0.87 |
| PF09832 | DUF2059 | 0.87 |
| PF00717 | Peptidase_S24 | 0.87 |
| COG ID | Name | Functional Category | % Frequency in 115 Family Scaffolds |
|---|---|---|---|
| COG0033 | Phosphoglucomutase/phosphomannomutase | Carbohydrate transport and metabolism [G] | 0.87 |
| COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 0.87 |
| COG1109 | Phosphomannomutase | Carbohydrate transport and metabolism [G] | 0.87 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.87 |
| COG1505 | Prolyl endopeptidase PreP, S9A serine peptidase family | Amino acid transport and metabolism [E] | 0.87 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.87 |
| COG1770 | Protease II | Amino acid transport and metabolism [E] | 0.87 |
| COG2340 | Spore germination protein YkwD and related proteins with CAP (CSP/antigen 5/PR1) domain | Cell cycle control, cell division, chromosome partitioning [D] | 0.87 |
| COG3436 | Transposase | Mobilome: prophages, transposons [X] | 0.87 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 88.70 % |
| Unclassified | root | N/A | 11.30 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001182|JGI12668J13544_1009165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 43-37 | 540 | Open in IMG/M |
| 3300001593|JGI12635J15846_10520225 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 43-37 | 700 | Open in IMG/M |
| 3300005538|Ga0070731_10017408 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5054 | Open in IMG/M |
| 3300005538|Ga0070731_10134351 | All Organisms → cellular organisms → Bacteria | 1640 | Open in IMG/M |
| 3300005541|Ga0070733_10109378 | All Organisms → cellular organisms → Bacteria | 1770 | Open in IMG/M |
| 3300005541|Ga0070733_10712950 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300005541|Ga0070733_11002401 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300005542|Ga0070732_10143639 | All Organisms → cellular organisms → Bacteria | 1419 | Open in IMG/M |
| 3300005542|Ga0070732_10724635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 43-37 | 606 | Open in IMG/M |
| 3300005591|Ga0070761_10183515 | All Organisms → cellular organisms → Bacteria | 1235 | Open in IMG/M |
| 3300005591|Ga0070761_10561626 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 43-37 | 708 | Open in IMG/M |
| 3300006050|Ga0075028_100257805 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 959 | Open in IMG/M |
| 3300006162|Ga0075030_101066697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 43-37 | 636 | Open in IMG/M |
| 3300006162|Ga0075030_101429927 | Not Available | 542 | Open in IMG/M |
| 3300006638|Ga0075522_10473219 | Not Available | 583 | Open in IMG/M |
| 3300007255|Ga0099791_10278837 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 43-37 | 795 | Open in IMG/M |
| 3300007265|Ga0099794_10041888 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2181 | Open in IMG/M |
| 3300007265|Ga0099794_10318198 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
| 3300007265|Ga0099794_10662639 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 43-37 | 555 | Open in IMG/M |
| 3300009090|Ga0099827_11547723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 43-37 | 577 | Open in IMG/M |
| 3300009143|Ga0099792_10495174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 43-37 | 764 | Open in IMG/M |
| 3300009645|Ga0116106_1064682 | All Organisms → cellular organisms → Bacteria | 1205 | Open in IMG/M |
| 3300009762|Ga0116130_1130634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 43-37 | 790 | Open in IMG/M |
| 3300010396|Ga0134126_11057947 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300011270|Ga0137391_10725611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 43-37 | 824 | Open in IMG/M |
| 3300011271|Ga0137393_10709614 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 43-37 | 861 | Open in IMG/M |
| 3300012189|Ga0137388_11680388 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300012205|Ga0137362_11282359 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 43-37 | 618 | Open in IMG/M |
| 3300012210|Ga0137378_10206716 | All Organisms → cellular organisms → Bacteria | 1828 | Open in IMG/M |
| 3300012363|Ga0137390_11036319 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 43-37 | 771 | Open in IMG/M |
| 3300012582|Ga0137358_10470002 | Not Available | 848 | Open in IMG/M |
| 3300012683|Ga0137398_10107394 | All Organisms → cellular organisms → Bacteria | 1764 | Open in IMG/M |
| 3300012683|Ga0137398_11204149 | Not Available | 517 | Open in IMG/M |
| 3300012917|Ga0137395_10066959 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2308 | Open in IMG/M |
| 3300012917|Ga0137395_10150197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 1595 | Open in IMG/M |
| 3300012917|Ga0137395_10384868 | Not Available | 1003 | Open in IMG/M |
| 3300012925|Ga0137419_10344084 | Not Available | 1152 | Open in IMG/M |
| 3300012930|Ga0137407_12097468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 43-37 | 540 | Open in IMG/M |
| 3300012944|Ga0137410_10223383 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1467 | Open in IMG/M |
| 3300014164|Ga0181532_10302090 | Not Available | 906 | Open in IMG/M |
| 3300014489|Ga0182018_10084862 | All Organisms → cellular organisms → Bacteria | 1875 | Open in IMG/M |
| 3300014489|Ga0182018_10664093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 43-37 | 544 | Open in IMG/M |
| 3300014501|Ga0182024_12005394 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300014654|Ga0181525_10081116 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1805 | Open in IMG/M |
| 3300014657|Ga0181522_11070672 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 501 | Open in IMG/M |
| 3300017927|Ga0187824_10171485 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 43-37 | 727 | Open in IMG/M |
| 3300017930|Ga0187825_10319703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 43-37 | 582 | Open in IMG/M |
| 3300017946|Ga0187879_10150336 | All Organisms → cellular organisms → Bacteria | 1318 | Open in IMG/M |
| 3300017995|Ga0187816_10208472 | Not Available | 850 | Open in IMG/M |
| 3300018035|Ga0187875_10309694 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 853 | Open in IMG/M |
| 3300018042|Ga0187871_10618183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 601 | Open in IMG/M |
| 3300018044|Ga0187890_10067565 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2105 | Open in IMG/M |
| 3300020579|Ga0210407_10992764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 43-37 | 640 | Open in IMG/M |
| 3300020579|Ga0210407_11288263 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300020580|Ga0210403_11475637 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 43-37 | 512 | Open in IMG/M |
| 3300020581|Ga0210399_10786219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 43-37 | 778 | Open in IMG/M |
| 3300021086|Ga0179596_10414481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 43-37 | 680 | Open in IMG/M |
| 3300021086|Ga0179596_10651035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 43-37 | 534 | Open in IMG/M |
| 3300021168|Ga0210406_10011444 | All Organisms → cellular organisms → Bacteria | 8656 | Open in IMG/M |
| 3300021168|Ga0210406_10317352 | All Organisms → cellular organisms → Bacteria | 1264 | Open in IMG/M |
| 3300021170|Ga0210400_10005203 | All Organisms → cellular organisms → Bacteria | 11088 | Open in IMG/M |
| 3300021178|Ga0210408_10481422 | Not Available | 987 | Open in IMG/M |
| 3300021180|Ga0210396_10636080 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 925 | Open in IMG/M |
| 3300021401|Ga0210393_10223623 | All Organisms → cellular organisms → Bacteria | 1525 | Open in IMG/M |
| 3300021406|Ga0210386_10544051 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1004 | Open in IMG/M |
| 3300021432|Ga0210384_10824261 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 43-37 | 826 | Open in IMG/M |
| 3300021433|Ga0210391_10202643 | All Organisms → cellular organisms → Bacteria | 1560 | Open in IMG/M |
| 3300021433|Ga0210391_10574714 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 885 | Open in IMG/M |
| 3300021479|Ga0210410_10015379 | All Organisms → cellular organisms → Bacteria | 6601 | Open in IMG/M |
| 3300021559|Ga0210409_10901368 | Not Available | 758 | Open in IMG/M |
| 3300024227|Ga0228598_1002275 | All Organisms → cellular organisms → Bacteria | 4202 | Open in IMG/M |
| 3300025500|Ga0208686_1081826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 43-37 | 705 | Open in IMG/M |
| 3300025862|Ga0209483_1383227 | Not Available | 508 | Open in IMG/M |
| 3300025898|Ga0207692_10236720 | All Organisms → cellular organisms → Bacteria | 1089 | Open in IMG/M |
| 3300025916|Ga0207663_10723339 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 43-37 | 789 | Open in IMG/M |
| 3300025922|Ga0207646_11053043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 43-37 | 717 | Open in IMG/M |
| 3300025929|Ga0207664_11825152 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300026557|Ga0179587_10081205 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1928 | Open in IMG/M |
| 3300026557|Ga0179587_10171368 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1362 | Open in IMG/M |
| 3300027047|Ga0208730_1028030 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 43-37 | 649 | Open in IMG/M |
| 3300027635|Ga0209625_1018355 | All Organisms → cellular organisms → Bacteria | 1544 | Open in IMG/M |
| 3300027645|Ga0209117_1040287 | All Organisms → cellular organisms → Bacteria | 1422 | Open in IMG/M |
| 3300027684|Ga0209626_1012601 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1952 | Open in IMG/M |
| 3300027842|Ga0209580_10190275 | Not Available | 1016 | Open in IMG/M |
| 3300027842|Ga0209580_10684231 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 43-37 | 507 | Open in IMG/M |
| 3300027853|Ga0209274_10375332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 734 | Open in IMG/M |
| 3300027867|Ga0209167_10175941 | All Organisms → cellular organisms → Bacteria | 1133 | Open in IMG/M |
| 3300027869|Ga0209579_10015339 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4467 | Open in IMG/M |
| 3300027869|Ga0209579_10239608 | All Organisms → cellular organisms → Bacteria | 974 | Open in IMG/M |
| 3300027869|Ga0209579_10613940 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 590 | Open in IMG/M |
| 3300027903|Ga0209488_10032887 | All Organisms → cellular organisms → Bacteria | 3781 | Open in IMG/M |
| 3300027908|Ga0209006_11486178 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300027911|Ga0209698_10125293 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2125 | Open in IMG/M |
| 3300028536|Ga0137415_10195871 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1841 | Open in IMG/M |
| 3300028577|Ga0265318_10047255 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1623 | Open in IMG/M |
| 3300029636|Ga0222749_10111156 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1298 | Open in IMG/M |
| 3300029882|Ga0311368_10264707 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1321 | Open in IMG/M |
| 3300030580|Ga0311355_10344033 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1480 | Open in IMG/M |
| 3300031057|Ga0170834_103045147 | All Organisms → cellular organisms → Bacteria | 1114 | Open in IMG/M |
| 3300031231|Ga0170824_111670659 | All Organisms → cellular organisms → Bacteria | 1712 | Open in IMG/M |
| 3300031234|Ga0302325_11155814 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1036 | Open in IMG/M |
| 3300031236|Ga0302324_100768044 | All Organisms → cellular organisms → Bacteria | 1347 | Open in IMG/M |
| 3300031446|Ga0170820_11533787 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 43-37 | 556 | Open in IMG/M |
| 3300031524|Ga0302320_11364346 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 43-37 | 709 | Open in IMG/M |
| 3300031708|Ga0310686_103749463 | Not Available | 648 | Open in IMG/M |
| 3300031708|Ga0310686_112681479 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 43-37 | 565 | Open in IMG/M |
| 3300031708|Ga0310686_118524225 | All Organisms → cellular organisms → Bacteria | 8815 | Open in IMG/M |
| 3300031715|Ga0307476_10071606 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2405 | Open in IMG/M |
| 3300031720|Ga0307469_10181434 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1619 | Open in IMG/M |
| 3300031754|Ga0307475_11584111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 43-37 | 501 | Open in IMG/M |
| 3300031962|Ga0307479_10295476 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1601 | Open in IMG/M |
| 3300031962|Ga0307479_11646261 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300032770|Ga0335085_10409447 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1571 | Open in IMG/M |
| 3300032955|Ga0335076_10285180 | All Organisms → cellular organisms → Bacteria | 1542 | Open in IMG/M |
| 3300033004|Ga0335084_10257967 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1805 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 23.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.78% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 11.30% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.09% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.35% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.48% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.48% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.48% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.61% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.61% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.61% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.61% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.61% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.61% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.61% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.74% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 1.74% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.87% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.87% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.87% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.87% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.87% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.87% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001182 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006638 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
| 3300009762 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Host-Associated | Open in IMG/M |
| 3300025500 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025862 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027047 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF042 (SPAdes) | Environmental | Open in IMG/M |
| 3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Host-Associated | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12668J13544_10091651 | 3300001182 | Forest Soil | LNKIAFLHAIVVDFCVQRLQGFGVVSAEILQFYLEEKG* |
| JGI12635J15846_105202251 | 3300001593 | Forest Soil | LDKIAFLRAIIVDFCVERLQGFGVVSAEILQFYFGEKG* |
| Ga0070731_100174086 | 3300005538 | Surface Soil | LNKIAFLYAIVVDFSVERFQGFGMLSAEILQFYFEEKG* |
| Ga0070731_101343512 | 3300005538 | Surface Soil | LDKAAFFLSIFIYFYLERLQGFGMLSAEILQFYFGEQG* |
| Ga0070733_101093782 | 3300005541 | Surface Soil | LDKSAFFLSIIVDFYLEKLQGFGMWSAEILQFYFGEQG* |
| Ga0070733_107129502 | 3300005541 | Surface Soil | LNKSAFFLSIFIDFYLEKLQGFGMLSAEILQFYFGEQG* |
| Ga0070733_110024012 | 3300005541 | Surface Soil | LNKVAFLGVIVVDFYVEKLQGFGMLSAETLQFYFGEKG* |
| Ga0070732_101436392 | 3300005542 | Surface Soil | LNKIAFFRAIVVDFCVEKLQGFGMVSAETLQFYFGEQG* |
| Ga0070732_107246352 | 3300005542 | Surface Soil | LNKSAFFLSIFVDFYLEKLQGFGMLSAEILQFYFGEQG* |
| Ga0070761_101835152 | 3300005591 | Soil | LNKFAFFLSIVVDFSVEKLQGFGMLSAEILQFYFGEKG* |
| Ga0070761_105616261 | 3300005591 | Soil | LNKIAFLHAIVVDFCWEKLQGFGVVSAEILQFYFGDKG* |
| Ga0075028_1002578052 | 3300006050 | Watersheds | LNKSAFSVSIVVDFYLEKLQGFGRLSAEILQFYFGEQG* |
| Ga0075030_1010666972 | 3300006162 | Watersheds | LDKAAFFLSIVVDFYLERLQGFGMLSAEILQFYFGEKG* |
| Ga0075030_1014299272 | 3300006162 | Watersheds | LIKSLFLHAIVVDFFVERLQGFGMESAEILQFYFGEQG* |
| Ga0075522_104732192 | 3300006638 | Arctic Peat Soil | LNKTAFLLAIVVDFCVEKLQGFGMLSAKILQFYFGEKG* |
| Ga0099791_102788372 | 3300007255 | Vadose Zone Soil | LNKTAFLQAIVVDFCVEKLQGFGVLSAEILQFYLGEKG* |
| Ga0099794_100418882 | 3300007265 | Vadose Zone Soil | LNKIAFLQAIVVDFCVEKLQGFGVLSAEILQFYLGEKG* |
| Ga0099794_103181982 | 3300007265 | Vadose Zone Soil | LNKISFLDAIVVDFSVERLQGFGMVSAEILQFYFGEQG* |
| Ga0099794_106626392 | 3300007265 | Vadose Zone Soil | KISFLDAIVVDFSVERLQGFGMVSAEILQFYFGEKG* |
| Ga0099827_115477232 | 3300009090 | Vadose Zone Soil | LNKSAFLQAIVVDFCVEKLQGFGVLSAEILQFYLGEKG* |
| Ga0099792_104951742 | 3300009143 | Vadose Zone Soil | LNKIAFLRAIVVDFCAEKLQGFGVVSAEILQFYFGEKG* |
| Ga0116106_10646822 | 3300009645 | Peatland | LNKIAILRVIVVDFCVERLQGFGVVSAEILQFYFGEKE* |
| Ga0116130_11306342 | 3300009762 | Peatland | LNKVAFLQAIVVDFCVERLQGFGVVSAEILQFYFGEKE* |
| Ga0134126_110579472 | 3300010396 | Terrestrial Soil | LNKSAFFLSIIVDFYLEKLQGFGMWSAEILQFYLGEKG* |
| Ga0137391_107256112 | 3300011270 | Vadose Zone Soil | LNKIAFLHAIVVDFCVERLQGFGMVSAEILQFYFGEKG* |
| Ga0137393_107096142 | 3300011271 | Vadose Zone Soil | LNKIAFLHAIVVDFCVERLQGFGMVSAEILQFYFGEQG* |
| Ga0137388_116803882 | 3300012189 | Vadose Zone Soil | LNKIAFLQAIVVDFCVEKLQGFGVLSAEILQFYFGEQG* |
| Ga0137362_112823592 | 3300012205 | Vadose Zone Soil | LNKTAFLQAIVVDFCVEKLQGFGVLSAEILQFYWGEKG* |
| Ga0137378_102067162 | 3300012210 | Vadose Zone Soil | LNEIAFLHAIVVDFCVERLQGFGMVSAEILQFYFGEQG* |
| Ga0137390_110363192 | 3300012363 | Vadose Zone Soil | LNKAVFLLSIFVDFCLERLQGFGMESAEILQFYLGEKG* |
| Ga0137358_104700021 | 3300012582 | Vadose Zone Soil | KIAFLRGIVVDFCAEKLQGFGVVSAEILQFYFGEKG* |
| Ga0137398_101073943 | 3300012683 | Vadose Zone Soil | LNKIAFLHVIVVDFCDERLQGFGMVSAEILQFYFGE* |
| Ga0137398_112041491 | 3300012683 | Vadose Zone Soil | LNKIAFLHVIVVDFCDERLQGFGMVSAEILQFYFG |
| Ga0137395_100669593 | 3300012917 | Vadose Zone Soil | LNKIAFLPAIVVDFCAEKLQGFGVVSAEILEFYFGEKG* |
| Ga0137395_101501971 | 3300012917 | Vadose Zone Soil | LNKIAFLQAIVVDFCVEKLQGFGVLSAEILQFYFG |
| Ga0137395_103848682 | 3300012917 | Vadose Zone Soil | MNKIAFLQAIVVDFCVEKLQGFGVLSAEILQFYLGEKG* |
| Ga0137419_103440842 | 3300012925 | Vadose Zone Soil | LNKIAFLHAIVVDFCMEKLQGFGVLSAEILQFYLGEKG* |
| Ga0137407_120974682 | 3300012930 | Vadose Zone Soil | LNKISFLQAIVVDFCVKKLQGFGVLSAEILQFYLGEKG* |
| Ga0137410_102233831 | 3300012944 | Vadose Zone Soil | AFLHTISVDFCVERLQGFGVRSAEILQFYFGEKG* |
| Ga0181532_103020902 | 3300014164 | Bog | LNNIAFLQAIVVDFCVERLQGFGVVSAEILQFYFGEKE* |
| Ga0182018_100848623 | 3300014489 | Palsa | VNKIAFLHAIVIDFCVERLQGFSVVSAEILQFFF* |
| Ga0182018_106640932 | 3300014489 | Palsa | LNKIAFLRAIVVDFCGEKLQGFGMESAEILQFYFGEKG* |
| Ga0182024_120053942 | 3300014501 | Permafrost | LNKFAFFLSIFVDFCVERLQGFGMMSAEILQFYFGEQG* |
| Ga0181525_100811163 | 3300014654 | Bog | LHKIAFLLSIFIDFCVGKLQGFGMVDAEILQFYFRENG* |
| Ga0181522_110706722 | 3300014657 | Bog | LNKFAFLHAIVVDFCAERLQGFGMWSAEILQFYFG |
| Ga0187824_101714852 | 3300017927 | Freshwater Sediment | LNKIAFLHAIFVDFCVEKLQGFGVLSAEILQFYFGEKG |
| Ga0187825_103197032 | 3300017930 | Freshwater Sediment | LNKIVFLLAIFVDFCVERLQGFDVLSAEILQFYLGEKG |
| Ga0187879_101503361 | 3300017946 | Peatland | LNKVAFLQAIVVDFCVERLQGFGVESAEILQFYFGEKE |
| Ga0187816_102084721 | 3300017995 | Freshwater Sediment | IVFLLAIFLDFCLERLQGFGVVSAEILQFYFGEKG |
| Ga0187875_103096943 | 3300018035 | Peatland | LNKVAFLQAIVVDFCVERLQGFGVESAEILQFYFGEKG |
| Ga0187871_106181832 | 3300018042 | Peatland | LNKFAFLHAIVVDFCVERLQGFGMMSAEILQFYFGEQG |
| Ga0187890_100675653 | 3300018044 | Peatland | LNKVAFLQAIVVDFCVERLQGFGVVSAEILQFYFGEKE |
| Ga0210407_109927642 | 3300020579 | Soil | LNKFVFLRAIVVDFCAQRLQGFGVVSAEILQFYFGEQG |
| Ga0210407_112882632 | 3300020579 | Soil | LNKFAFLHANVVDFCVEKLQGFGMLSAEILQFYFGEQG |
| Ga0210403_114756372 | 3300020580 | Soil | LNKIAFLRAIVVDFCVERLQGFDVVSAEILQFYFGEKG |
| Ga0210399_107862192 | 3300020581 | Soil | LNKILFLHAIVVDFPVKSLQGFGMVNAEILQFYFGEQG |
| Ga0179596_104144811 | 3300021086 | Vadose Zone Soil | LNKIAFLRAIVVDFCVEKLQGFGMVSAEILQFYFGEQG |
| Ga0179596_106510352 | 3300021086 | Vadose Zone Soil | LNKAVFLLSIFVDFCLERLQGFGMESAEILQFYLGEKG |
| Ga0210406_100114446 | 3300021168 | Soil | LNEIAFLHPIVVDFCVEKLRGFGVVSAETLQFYFGEQG |
| Ga0210406_103173522 | 3300021168 | Soil | LNKFVFLRAIVVDFCAQRLQGFGVVSAEILQFYFGE |
| Ga0210400_100052033 | 3300021170 | Soil | LNEIAFLHPIVVDFCVEKLRGFGVVSAETLQFYFGEQR |
| Ga0210408_104814221 | 3300021178 | Soil | NKSAFVLSIFVDFCVERLQGFGRMSAEILQFYFGEQG |
| Ga0210396_106360802 | 3300021180 | Soil | LNKAAFFLSIFVDFYLQRLQGFGMLNAEILQFYFGEKG |
| Ga0210393_102236232 | 3300021401 | Soil | LNKIAFLHANVVDFCVEKLQGFGMLSAEILQFYFGEQG |
| Ga0210386_105440512 | 3300021406 | Soil | LDKAAFFLSIFVYFYLERLQGFGMLSAEILQFYFGEQG |
| Ga0210384_108242612 | 3300021432 | Soil | LNKIAFSRAIVVDFSVERFQGFGVVSAEILQFYFGEKG |
| Ga0210391_102026432 | 3300021433 | Soil | LNKSAFLFAIVVDFSVERLQGFGMLSVEILQFYFGEKG |
| Ga0210391_105747141 | 3300021433 | Soil | LNKSAFLFAIVVDFSVERLQGFGMLSVEILQFYFGE |
| Ga0210410_1001537910 | 3300021479 | Soil | LNKIAFLRAIVVDFCVERLQGFGVVSAEILQFYFGGEGMKPRPKPQD |
| Ga0210409_109013681 | 3300021559 | Soil | LNKFAFLHANVVDFCVEKLQGFGMLSAEILQFYFGEQ |
| Ga0228598_10022752 | 3300024227 | Rhizosphere | LNKFAFLHAIVVDFCVEKLQGFGMLSAEILQFYFGEQG |
| Ga0208686_10818261 | 3300025500 | Peatland | LNKIAILRVIVVDFCVERLQGFGVVSAEILQFYFGEKE |
| Ga0209483_13832272 | 3300025862 | Arctic Peat Soil | LNKTAFLLAIVVDFCVEKLQGFGMLSAKILQFYFGEKG |
| Ga0207692_102367202 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | LNKFVFLRAIVVDFCEERLQGFGVVSAEILQFYFGVQG |
| Ga0207663_107233392 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | LNKSAFFLSIIVDFYLEKLQGFGMWSAEILQFYLGEKG |
| Ga0207646_110530432 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | LNKIAFLLTIFVDFCVEKLQGFGVLSTEILQFYFGEKG |
| Ga0207664_118251522 | 3300025929 | Agricultural Soil | LNKSAFFLSIIVDFYLEKLQGFGMWSAEILQFYLGE |
| Ga0179587_100812051 | 3300026557 | Vadose Zone Soil | LNKIAFLHAIVVDFCVKKLQGFGVLSAEILQFYLGE |
| Ga0179587_101713682 | 3300026557 | Vadose Zone Soil | LNKIAFLQAIVVDFCVKKLQGFGVLSAEILQFYSGEKG |
| Ga0208730_10280301 | 3300027047 | Forest Soil | KLNKSAFVLSIFVDFCVERLQGFGRMSAEILQFYFGEQG |
| Ga0209625_10183551 | 3300027635 | Forest Soil | LNKIAFLHAIVVDFCVQRLQGFGVVSAEILQFYLEEKG |
| Ga0209117_10402872 | 3300027645 | Forest Soil | LDKIAFLRAIIVDFCVERLQGFGVVSAEILQFYFGEKG |
| Ga0209626_10126012 | 3300027684 | Forest Soil | LNKIAFLHAIVVDFCVLRLQGFGVVSAEILQFYLEEKG |
| Ga0209580_101902752 | 3300027842 | Surface Soil | LNKIAFSRAIVVDFCVEKLQGFGMVSAETLQFYFGEQG |
| Ga0209580_106842312 | 3300027842 | Surface Soil | LNKSAFFLSIFVDFYLEKLQGFGMLSAEILQFYFGEQG |
| Ga0209274_103753322 | 3300027853 | Soil | KLNKIAFLHAIVVDFCWEKLQGFGVVSAEILQFYFGDKG |
| Ga0209167_101759412 | 3300027867 | Surface Soil | LDKSAFFLSIIVDFYLEKLQGFGMWSAEILQFYFGEQG |
| Ga0209579_100153391 | 3300027869 | Surface Soil | LNKIAFLYAIVVDFSVERLQGFGMLSAEILQFYFGE |
| Ga0209579_102396081 | 3300027869 | Surface Soil | LDKAAFFLSIFIYFYLERLQGFGMLSAEILQFYFGEQG |
| Ga0209579_106139402 | 3300027869 | Surface Soil | LNKIAFLYAIVVDFSVERFQGFGMLSAEILQFYFEEKG |
| Ga0209488_100328872 | 3300027903 | Vadose Zone Soil | LNKIAFLRAIVVDFCAEKLQGFGVVSAEILQFYFGEKG |
| Ga0209006_114861781 | 3300027908 | Forest Soil | LNKFAFLHAIVVDFCVERLQGFGVVSAEILQFYFGEKG |
| Ga0209698_101252933 | 3300027911 | Watersheds | LIKSLFLHAIVVDFCVERLQGFDVVSAEILQFYFGEQG |
| Ga0137415_101958713 | 3300028536 | Vadose Zone Soil | LNKIAFLHAIVVDFCMEKLQGFGVLSAEILQFYFGEKG |
| Ga0265318_100472552 | 3300028577 | Rhizosphere | LNKSAFLHAIAVDFCVEKLQGFGMMSAEILQFYFGEQG |
| Ga0222749_101111562 | 3300029636 | Soil | LNKFVFLRAIVVDFREGRLQGFGVMSAEILQFYFGVKG |
| Ga0311368_102647072 | 3300029882 | Palsa | IAFLQSIFIDFCVGKLQGFGIVGAEILQFYFRENG |
| Ga0311355_103440331 | 3300030580 | Palsa | IAFLLSIFIDFCVGKLQGFGIVGAEILQFYFRENG |
| Ga0170834_1030451472 | 3300031057 | Forest Soil | LKKIAFLHAIVVDFCAERLQGFGMVSAEILQFYFGEPG |
| Ga0170824_1116706592 | 3300031231 | Forest Soil | LNKFAFLHAIFVDFCVERLQGFGMMSAEILQFYFGEQG |
| Ga0302325_111558141 | 3300031234 | Palsa | LNKIAFLCAIVVDFCVERLQGFGVVSAEILQFYFGEN |
| Ga0302324_1007680442 | 3300031236 | Palsa | LNKIAFSHAIVVDFCVERLQGFGVVSAEILQFYFGEKG |
| Ga0170820_115337872 | 3300031446 | Forest Soil | LNKIAFLHAIFVDFCVERLQGFGMVSAEILQFYLGEQG |
| Ga0302320_113643462 | 3300031524 | Bog | ISELFVVICIDFCVERLQGFGVVSAEILQFYFGENG |
| Ga0310686_1037494632 | 3300031708 | Soil | LNKAAFFPSIFVDFYLWRLQGFGMLSVEILQFYFGEKG |
| Ga0310686_1126814791 | 3300031708 | Soil | LNKIAFLHAIVVDICVEKLQGFGVVSAKILQFYFGGKG |
| Ga0310686_1185242251 | 3300031708 | Soil | MNNFACLHAIVVDFCVERLQGFGMVSAEILQFYFGE |
| Ga0307476_100716061 | 3300031715 | Hardwood Forest Soil | LNKSAFFLSIVVDFSVERLQGFGMWSAEILQFYFGEQG |
| Ga0307469_101814341 | 3300031720 | Hardwood Forest Soil | SRVFLSIFVDFYLERLQGFGMLSAEILQFYFGEQG |
| Ga0307475_115841112 | 3300031754 | Hardwood Forest Soil | LNKIAFLRAIVVDFYVKRLQGFSMMCAEILQFYFGEQG |
| Ga0307479_102954761 | 3300031962 | Hardwood Forest Soil | LNKIAFLHAIVVDFCVQRLQGFGVVSAEILHFYFEEKG |
| Ga0307479_116462611 | 3300031962 | Hardwood Forest Soil | LNKAAFFLSIFVDFYLQRLQGFGMLNAEILQFYFGE |
| Ga0335085_104094471 | 3300032770 | Soil | NKVAFLHGIVVDFCMERLQGFGMKSAEILQFYFGEKG |
| Ga0335076_102851801 | 3300032955 | Soil | SKYAFLRAIVVDFCAGKLQGFGLIIVEILQFYFGEKG |
| Ga0335084_102579671 | 3300033004 | Soil | LNKIVFLLTIFVDFCVERLQGFGVVSVEILQFYFGEKG |
| ⦗Top⦘ |