


| Basic Information | |
|---|---|
| Family ID | F079925 |
| Family Type | Metagenome |
| Number of Sequences | 115 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MAVTWTIANMERDLVQGDNTDIVTILHWRASDEDSDGNTG |
| Number of Associated Samples | 86 |
| Number of Associated Scaffolds | 115 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 72.17 % |
| % of genes near scaffold ends (potentially truncated) | 98.26 % |
| % of genes from short scaffolds (< 2000 bps) | 89.57 % |
| Associated GOLD sequencing projects | 69 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Predicted Viral (35.652 % of family members) |
| NCBI Taxonomy ID | 10239 (predicted) |
| Taxonomy | All Organisms → Viruses → Predicted Viral |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (43.478 % of family members) |
| Environment Ontology (ENVO) | Unclassified (58.261 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (86.087 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 27.50% Coil/Unstructured: 72.50% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 115 Family Scaffolds |
|---|---|---|
| PF13884 | Peptidase_S74 | 67.83 |
| PF11962 | Peptidase_G2 | 2.61 |
| PF16778 | Phage_tail_APC | 0.87 |
| PF00386 | C1q | 0.87 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 66.09 % |
| Unclassified | root | N/A | 33.04 % |
| unclassified Hyphomonas | no rank | unclassified Hyphomonas | 0.87 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000116|DelMOSpr2010_c10215200 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 606 | Open in IMG/M |
| 3300005512|Ga0074648_1062779 | All Organisms → Viruses → Predicted Viral | 1512 | Open in IMG/M |
| 3300005821|Ga0078746_1087200 | Not Available | 709 | Open in IMG/M |
| 3300006025|Ga0075474_10052168 | Not Available | 1382 | Open in IMG/M |
| 3300006026|Ga0075478_10005258 | All Organisms → Viruses → Predicted Viral | 4514 | Open in IMG/M |
| 3300006026|Ga0075478_10106707 | All Organisms → Viruses | 891 | Open in IMG/M |
| 3300006029|Ga0075466_1026044 | All Organisms → Viruses → Predicted Viral | 1856 | Open in IMG/M |
| 3300006029|Ga0075466_1114651 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 719 | Open in IMG/M |
| 3300006752|Ga0098048_1228682 | Not Available | 546 | Open in IMG/M |
| 3300006793|Ga0098055_1109544 | All Organisms → Viruses → Predicted Viral | 1076 | Open in IMG/M |
| 3300006802|Ga0070749_10272857 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 953 | Open in IMG/M |
| 3300006802|Ga0070749_10386391 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 774 | Open in IMG/M |
| 3300006810|Ga0070754_10096058 | All Organisms → Viruses → Predicted Viral | 1470 | Open in IMG/M |
| 3300006867|Ga0075476_10024974 | All Organisms → Viruses → Predicted Viral | 2547 | Open in IMG/M |
| 3300006867|Ga0075476_10096657 | Not Available | 1139 | Open in IMG/M |
| 3300006868|Ga0075481_10031445 | All Organisms → Viruses → Predicted Viral | 2068 | Open in IMG/M |
| 3300006869|Ga0075477_10170693 | Not Available | 901 | Open in IMG/M |
| 3300006916|Ga0070750_10065007 | All Organisms → Viruses → Predicted Viral | 1738 | Open in IMG/M |
| 3300006919|Ga0070746_10193607 | Not Available | 971 | Open in IMG/M |
| 3300006920|Ga0070748_1100985 | All Organisms → Viruses → Predicted Viral | 1099 | Open in IMG/M |
| 3300007344|Ga0070745_1083806 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1263 | Open in IMG/M |
| 3300007345|Ga0070752_1133138 | All Organisms → Viruses → Predicted Viral | 1035 | Open in IMG/M |
| 3300007538|Ga0099851_1054517 | All Organisms → Viruses → Predicted Viral | 1567 | Open in IMG/M |
| 3300007538|Ga0099851_1173714 | Not Available | 794 | Open in IMG/M |
| 3300007539|Ga0099849_1293034 | All Organisms → Viruses | 589 | Open in IMG/M |
| 3300007540|Ga0099847_1033686 | All Organisms → Viruses → Predicted Viral | 1640 | Open in IMG/M |
| 3300007540|Ga0099847_1070024 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1086 | Open in IMG/M |
| 3300007540|Ga0099847_1092597 | Not Available | 924 | Open in IMG/M |
| 3300007542|Ga0099846_1214789 | All Organisms → Viruses | 675 | Open in IMG/M |
| 3300007640|Ga0070751_1380796 | Not Available | 511 | Open in IMG/M |
| 3300007778|Ga0102954_1207173 | All Organisms → Viruses | 577 | Open in IMG/M |
| 3300007960|Ga0099850_1226963 | Not Available | 726 | Open in IMG/M |
| 3300008012|Ga0075480_10516142 | Not Available | 574 | Open in IMG/M |
| 3300009000|Ga0102960_1074122 | All Organisms → Viruses → Predicted Viral | 1246 | Open in IMG/M |
| 3300009001|Ga0102963_1009260 | All Organisms → Viruses → Predicted Viral | 4222 | Open in IMG/M |
| 3300009001|Ga0102963_1040941 | All Organisms → Viruses → Predicted Viral | 1925 | Open in IMG/M |
| 3300009001|Ga0102963_1069035 | All Organisms → Viruses → Predicted Viral | 1452 | Open in IMG/M |
| 3300009027|Ga0102957_1264865 | Not Available | 624 | Open in IMG/M |
| 3300009124|Ga0118687_10092830 | Not Available | 1039 | Open in IMG/M |
| 3300009418|Ga0114908_1240903 | Not Available | 551 | Open in IMG/M |
| 3300009435|Ga0115546_1352848 | All Organisms → Viruses | 500 | Open in IMG/M |
| 3300010149|Ga0098049_1237806 | Not Available | 554 | Open in IMG/M |
| 3300010150|Ga0098056_1098704 | All Organisms → cellular organisms → Bacteria | 997 | Open in IMG/M |
| 3300010299|Ga0129342_1126684 | Not Available | 944 | Open in IMG/M |
| 3300010318|Ga0136656_1177583 | Not Available | 720 | Open in IMG/M |
| 3300010368|Ga0129324_10411002 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300017710|Ga0181403_1067610 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300017824|Ga0181552_10085378 | All Organisms → Viruses → Predicted Viral | 1777 | Open in IMG/M |
| 3300017985|Ga0181576_10099193 | All Organisms → Viruses → Predicted Viral | 1959 | Open in IMG/M |
| 3300018036|Ga0181600_10385109 | Not Available | 684 | Open in IMG/M |
| 3300018041|Ga0181601_10708823 | Not Available | 506 | Open in IMG/M |
| 3300018048|Ga0181606_10121632 | All Organisms → Viruses → Predicted Viral | 1609 | Open in IMG/M |
| 3300018416|Ga0181553_10150646 | All Organisms → Viruses → Predicted Viral | 1384 | Open in IMG/M |
| 3300018416|Ga0181553_10243334 | All Organisms → Viruses → Predicted Viral | 1021 | Open in IMG/M |
| 3300018416|Ga0181553_10323280 | Not Available | 853 | Open in IMG/M |
| 3300018420|Ga0181563_10071747 | All Organisms → Viruses → Predicted Viral | 2348 | Open in IMG/M |
| 3300018420|Ga0181563_10309481 | Not Available | 921 | Open in IMG/M |
| 3300018876|Ga0181564_10776262 | Not Available | 502 | Open in IMG/M |
| 3300019765|Ga0194024_1077965 | Not Available | 748 | Open in IMG/M |
| 3300019765|Ga0194024_1164408 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 524 | Open in IMG/M |
| 3300020053|Ga0181595_10171249 | Not Available | 979 | Open in IMG/M |
| 3300020173|Ga0181602_10349989 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 595 | Open in IMG/M |
| 3300020191|Ga0181604_10157508 | All Organisms → Viruses → Predicted Viral | 1144 | Open in IMG/M |
| 3300020194|Ga0181597_10093164 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1691 | Open in IMG/M |
| 3300021368|Ga0213860_10402316 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300021373|Ga0213865_10426732 | Not Available | 582 | Open in IMG/M |
| 3300021373|Ga0213865_10453101 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 557 | Open in IMG/M |
| 3300021379|Ga0213864_10192581 | All Organisms → cellular organisms → Bacteria | 1035 | Open in IMG/M |
| 3300021957|Ga0222717_10043177 | All Organisms → Viruses → Predicted Viral | 2941 | Open in IMG/M |
| 3300021957|Ga0222717_10401468 | unclassified Hyphomonas → Hyphomonas sp. | 758 | Open in IMG/M |
| 3300021958|Ga0222718_10045830 | All Organisms → Viruses → Predicted Viral | 2812 | Open in IMG/M |
| 3300021958|Ga0222718_10151418 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae | 1309 | Open in IMG/M |
| 3300021958|Ga0222718_10156176 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1283 | Open in IMG/M |
| 3300021959|Ga0222716_10190793 | All Organisms → Viruses → Predicted Viral | 1305 | Open in IMG/M |
| 3300021959|Ga0222716_10552080 | Not Available | 638 | Open in IMG/M |
| 3300021964|Ga0222719_10113934 | All Organisms → Viruses | 1958 | Open in IMG/M |
| 3300021964|Ga0222719_10178737 | All Organisms → Viruses → Predicted Viral | 1471 | Open in IMG/M |
| 3300021964|Ga0222719_10270741 | All Organisms → Viruses → Predicted Viral | 1117 | Open in IMG/M |
| 3300021964|Ga0222719_10372807 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 897 | Open in IMG/M |
| 3300022168|Ga0212027_1051351 | Not Available | 516 | Open in IMG/M |
| 3300022178|Ga0196887_1052834 | Not Available | 1030 | Open in IMG/M |
| 3300022183|Ga0196891_1015476 | All Organisms → Viruses → Predicted Viral | 1474 | Open in IMG/M |
| 3300022183|Ga0196891_1027240 | Not Available | 1079 | Open in IMG/M |
| 3300022187|Ga0196899_1063286 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1173 | Open in IMG/M |
| 3300022200|Ga0196901_1035849 | All Organisms → Viruses | 1914 | Open in IMG/M |
| 3300022923|Ga0255783_10078501 | All Organisms → Viruses → Predicted Viral | 1836 | Open in IMG/M |
| 3300022928|Ga0255758_10021481 | All Organisms → Viruses → Predicted Viral | 4294 | Open in IMG/M |
| 3300022929|Ga0255752_10215185 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
| (restricted) 3300024059|Ga0255040_10299960 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae | 671 | Open in IMG/M |
| 3300024262|Ga0210003_1192544 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 842 | Open in IMG/M |
| 3300024301|Ga0233451_10126434 | All Organisms → Viruses → Predicted Viral | 1213 | Open in IMG/M |
| 3300025084|Ga0208298_1042064 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
| 3300025098|Ga0208434_1017967 | All Organisms → Viruses → Predicted Viral | 1810 | Open in IMG/M |
| 3300025098|Ga0208434_1057307 | Not Available | 838 | Open in IMG/M |
| 3300025108|Ga0208793_1117249 | All Organisms → Viruses | 730 | Open in IMG/M |
| 3300025543|Ga0208303_1113391 | Not Available | 556 | Open in IMG/M |
| 3300025645|Ga0208643_1013967 | All Organisms → Viruses → Predicted Viral | 2972 | Open in IMG/M |
| 3300025652|Ga0208134_1064060 | All Organisms → Viruses → Predicted Viral | 1115 | Open in IMG/M |
| 3300025671|Ga0208898_1041655 | All Organisms → Viruses → Predicted Viral | 1752 | Open in IMG/M |
| 3300025671|Ga0208898_1064779 | Not Available | 1245 | Open in IMG/M |
| 3300025687|Ga0208019_1008098 | All Organisms → Viruses → Predicted Viral | 4648 | Open in IMG/M |
| 3300025687|Ga0208019_1078628 | Not Available | 1060 | Open in IMG/M |
| 3300025759|Ga0208899_1042073 | All Organisms → Viruses → Predicted Viral | 2027 | Open in IMG/M |
| 3300025759|Ga0208899_1057196 | All Organisms → Viruses → Predicted Viral | 1634 | Open in IMG/M |
| 3300025759|Ga0208899_1098867 | Not Available | 1094 | Open in IMG/M |
| 3300025769|Ga0208767_1036027 | All Organisms → Viruses → Predicted Viral | 2480 | Open in IMG/M |
| 3300025769|Ga0208767_1114862 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1046 | Open in IMG/M |
| 3300025828|Ga0208547_1101466 | Not Available | 885 | Open in IMG/M |
| 3300025840|Ga0208917_1160458 | Not Available | 775 | Open in IMG/M |
| 3300025853|Ga0208645_1104419 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1165 | Open in IMG/M |
| 3300025853|Ga0208645_1117404 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1068 | Open in IMG/M |
| 3300025870|Ga0209666_1302328 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 632 | Open in IMG/M |
| 3300031565|Ga0307379_11535335 | Not Available | 529 | Open in IMG/M |
| 3300032257|Ga0316205_10338894 | Not Available | 519 | Open in IMG/M |
| 3300034418|Ga0348337_040602 | All Organisms → Viruses → Predicted Viral | 1995 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 43.48% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 16.52% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 9.57% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 6.96% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 4.35% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 3.48% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.61% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.74% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 1.74% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 0.87% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.87% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 0.87% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 0.87% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.87% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 0.87% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.87% |
| Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water | 0.87% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment | 0.87% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.87% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.87% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300005512 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_water | Environmental | Open in IMG/M |
| 3300005821 | Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 25 cmbsf, PM1 | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006867 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006868 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006869 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
| 3300007778 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_H2O_MG | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300009000 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009027 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG | Environmental | Open in IMG/M |
| 3300009124 | Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsf | Environmental | Open in IMG/M |
| 3300009418 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s17 | Environmental | Open in IMG/M |
| 3300009435 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010318 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300017710 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28 | Environmental | Open in IMG/M |
| 3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017985 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018036 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041406US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018041 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041407BS metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018048 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018876 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019765 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW13Sep16_MG | Environmental | Open in IMG/M |
| 3300020053 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041401AS metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020173 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041408US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020191 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041410US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020194 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041403US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300021368 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550 | Environmental | Open in IMG/M |
| 3300021373 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282 | Environmental | Open in IMG/M |
| 3300021379 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO247 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022168 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v2) | Environmental | Open in IMG/M |
| 3300022178 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3) | Environmental | Open in IMG/M |
| 3300022183 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3) | Environmental | Open in IMG/M |
| 3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022923 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG | Environmental | Open in IMG/M |
| 3300022928 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG | Environmental | Open in IMG/M |
| 3300022929 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG | Environmental | Open in IMG/M |
| 3300024059 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_2 | Environmental | Open in IMG/M |
| 3300024262 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024301 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011504CT (spades assembly) | Environmental | Open in IMG/M |
| 3300025084 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025098 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025652 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes) | Environmental | Open in IMG/M |
| 3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
| 3300025687 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025828 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025840 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300025870 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_125m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
| 3300032257 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrite | Environmental | Open in IMG/M |
| 3300034418 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSpr2010_102152002 | 3300000116 | Marine | MAVTWTIANMERDLVQGDNTDIVTILHWRASDEDXXW* |
| Ga0074648_10627792 | 3300005512 | Saline Water And Sediment | MENKMAVTWTIANMERDLVQGDNTDIVTILHWRATDEDAD |
| Ga0078746_10872001 | 3300005821 | Marine Sediment | MAVTWTIGTMERDLVQGDNTDIVTILHWRASDEDDNGN |
| Ga0075474_100521681 | 3300006025 | Aqueous | MAVTWTIANMERDLVQGDNTDIVTILHWRASDEDSDGNTGSAYGTVGV |
| Ga0075478_100052583 | 3300006026 | Aqueous | MAVTWTIANMERDLVQGDNTDIVTILHWRASDEDSDGNTGSAYGTVG |
| Ga0075478_101067071 | 3300006026 | Aqueous | MAITWAIANMERDLVQGDNTDIVTILHWRASDEDSDGNTGSAYGT |
| Ga0075466_10260443 | 3300006029 | Aqueous | MAVTWTIANMERDLVQGDNTDIVTILHWRASDEDDNGNTGSAYG |
| Ga0075466_11146512 | 3300006029 | Aqueous | MAVTWTIGTMERDLVQGDNTDIVTILHWRASDEDDNGNTGSAYGT |
| Ga0098048_12286822 | 3300006752 | Marine | MAVTWTIGNMERDLVQGDNTDIVTILHWRASDEDADGNTGSAYGTVGV |
| Ga0098055_11095442 | 3300006793 | Marine | MAVTWTIGTMERDLVQGDNTDIVTILHWRASDEDADGNTGSAYGTVGV |
| Ga0070749_102728573 | 3300006802 | Aqueous | MAVTWTITNMERDLVQGDNTDIVTILHWRASDEDSDGNT |
| Ga0070749_103863911 | 3300006802 | Aqueous | MAITWTIANMERDLVQGDNTDIVTILHWRASDEDSDGNTGSAY |
| Ga0070754_100960582 | 3300006810 | Aqueous | MAVTWTIANMERDLVQGDNTDIVTILHWRASDEDS |
| Ga0075476_100249742 | 3300006867 | Aqueous | MAVTWTIGTMERDLVQGDNTDIVTILHWRASDEDSDGNTGSAYGTVGVT |
| Ga0075476_100966572 | 3300006867 | Aqueous | MENKMAVTWTIANMERDLVQGDNTDIVTILHWRASDEDDN |
| Ga0075481_100314452 | 3300006868 | Aqueous | MENKMAVTWTIGTMERDLVQGDNTDIVTILHWRASDEDDNGNTGSAYGTV |
| Ga0075477_101706932 | 3300006869 | Aqueous | MENKMAVTWTIANMERDLVQGDNTDIVTILHWRASDEDSD |
| Ga0070750_100650072 | 3300006916 | Aqueous | MENKMAVTWTIGTMERDLVQGDNTDIVTTLHWRAS |
| Ga0070746_101936072 | 3300006919 | Aqueous | MAVTWTIANMERDLVQGDNTDIVTILHWRATDEDDNGNIGSAYGTVGVT |
| Ga0070748_11009851 | 3300006920 | Aqueous | MAVTWTIGTMERDLVQGDNTDIVTILHWRASDEDDN |
| Ga0070745_10838064 | 3300007344 | Aqueous | MAVTWTIANMERDLVQGDNTDIVTILHWRASDEDAN |
| Ga0070752_11331382 | 3300007345 | Aqueous | MASQIKENKMAVTWTIANMERDLVQGDNTDIVTILHWRASDEDSDG |
| Ga0099851_10545171 | 3300007538 | Aqueous | MEYKMAVTWTIANMERDLVQGDNTDIVTILHWRASDEDSDGNTG |
| Ga0099851_11737142 | 3300007538 | Aqueous | MEYKMAVTWTIANMERDLVQGDNTDIVTILHWRASD |
| Ga0099849_12930342 | 3300007539 | Aqueous | MENKMAVTWTIANMERDLVQGDNTDIVTILHWRASDEDADGNTG |
| Ga0099847_10336862 | 3300007540 | Aqueous | MAVTWTIANMERDLVQGDNTDIVTILHWRASDEDADGNTGSAYG |
| Ga0099847_10700242 | 3300007540 | Aqueous | MEYKMAVTWTIANMERDLVQGDNTDIVTILHWRASDE |
| Ga0099847_10925971 | 3300007540 | Aqueous | MENKMAVTWTIANMERDLVQGDNTDIVTILHWRASD |
| Ga0099846_12147892 | 3300007542 | Aqueous | MEYKMAVTWTIANMERDLVQGDNTDIVTILHWRASDEDDNGNTGSAYGT |
| Ga0070751_13807961 | 3300007640 | Aqueous | MAVTWTITNMERDLVQGDNTDIVTILHWRASDEDSDG |
| Ga0102954_12071731 | 3300007778 | Water | MAVTWTIGTMERDLVQGDNTDIVTILHWRASDEDSDGNTGSAYGTV |
| Ga0099850_12269631 | 3300007960 | Aqueous | MAVTWTIANMERDLVQGDNTDIVTILHWRASDEDSDGNTGSA |
| Ga0075480_105161423 | 3300008012 | Aqueous | MAITWAIANMERDLVQGDNTDIVTILHWRASDEDSDGNTGSAYGTV |
| Ga0102960_10741221 | 3300009000 | Pond Water | MAVTWTIGTMERDLVQGDNTDIVTILHWRATDSDADGNTG |
| Ga0102963_10092601 | 3300009001 | Pond Water | MAVTWTIGTMERDLVQGDNTDIVTILHWRASDEDAD |
| Ga0102963_10409412 | 3300009001 | Pond Water | MEYKMAVTWTIANMERDLVQGDNTDIVTILHWRAS |
| Ga0102963_10690352 | 3300009001 | Pond Water | MASQIKENKMAVTWTIGTMERDLVQGDNTDIVTILHWRASDEDSDG |
| Ga0102957_12648651 | 3300009027 | Pond Water | MAVTWTIGTMERDLVQGDNTDIVTILHWRASDEDADGNTGS |
| Ga0118687_100928301 | 3300009124 | Sediment | MAVTWTIGTMERDLVQGDNTDIVTVLHWRATDEDADGN |
| Ga0114908_12409032 | 3300009418 | Deep Ocean | MENKMAVTWTIANMERDLVQGDNTDIVTILHWRASDEDLDGN |
| Ga0115546_13528481 | 3300009435 | Pelagic Marine | MAVTWKIENMERDLVQGDNTDIVTILHWRASDEDSDGNTGSAYGTVGVT |
| Ga0098049_12378062 | 3300010149 | Marine | MAVTWTIGTMERDLVQGDNTDIVTILHWRASDEDADGNTGSAY |
| Ga0098056_10987042 | 3300010150 | Marine | MENKMAVTWTIGTMERDLVQGDNTDIVTTLHWRATDSDADGNTGSA* |
| Ga0129342_11266842 | 3300010299 | Freshwater To Marine Saline Gradient | MAVTWTIVNMERDLVQGDNTDIVTILHWRASDEDSDGNTGSAY |
| Ga0136656_11775832 | 3300010318 | Freshwater To Marine Saline Gradient | MAVTWTIANMERDLVQGDNTDIVTILHWRASDEDSDGNTGSAYG |
| Ga0129324_104110021 | 3300010368 | Freshwater To Marine Saline Gradient | MENKMAVTWTIANMERDLVQGDNTDIVTVLHWTASDEDSD |
| Ga0181403_10676102 | 3300017710 | Seawater | MAVTWTIGTMERDLVQGDNTDIVTILHWRASDEDSDGNT |
| Ga0181552_100853781 | 3300017824 | Salt Marsh | MAVTWTIANMERDLVQGDNTDIVTILHWRASDEDAD |
| Ga0181576_100991931 | 3300017985 | Salt Marsh | MENKMAVTWTIANMERDLVQGDNTDIVTILHWRAS |
| Ga0181600_103851091 | 3300018036 | Salt Marsh | MENKMAVTWTIANMERDLVQGDNTDIVTILHWRASDEDAD |
| Ga0181601_107088231 | 3300018041 | Salt Marsh | MENKMAVTWTIANMERDLMQGDNTDIVTILHWRASDEDSDGNTGSAY |
| Ga0181606_101216321 | 3300018048 | Salt Marsh | MENKMAVTWTIANMERDLVQGDNTDIVTILHWRASDEDSDGNTGSA |
| Ga0181553_101506461 | 3300018416 | Salt Marsh | MAVTWTIANMERDLVQGDNTDIVTILHWRASDEDSDGNTG |
| Ga0181553_102433342 | 3300018416 | Salt Marsh | MENKMAVTWTIANMERDLVQGDNTDIVTILHWRASDEDSDG |
| Ga0181553_103232802 | 3300018416 | Salt Marsh | MAVTWTIANMERDLVQGDNTDIVTILHWRASDEDSDG |
| Ga0181563_100717472 | 3300018420 | Salt Marsh | MAVTWTIANMERDLVQGDNTDIVTILHWRASDEDADG |
| Ga0181563_103094811 | 3300018420 | Salt Marsh | MAVTWTIANMERDLVQGDNTDIVTILHWRASDEDSD |
| Ga0181564_107762622 | 3300018876 | Salt Marsh | MVVTWTIANMERDLVQGDNTDIVTILHWRASDEDSDGNTGSA |
| Ga0194024_10779652 | 3300019765 | Freshwater | MAVTWNIVNMERDLVQGDNTDIVTILHWTAKDEDADGNTGSNYGTVSVTLV |
| Ga0194024_11644081 | 3300019765 | Freshwater | MAVTWTITNMERDLVQGDNTDIVTILHWRASDEDSDGNTGAS |
| Ga0181595_101712492 | 3300020053 | Salt Marsh | MENKMAVTWTIANMERDLVQGDNTDIVTILHWRASDEDADGNTGSAYGTVGV |
| Ga0181602_103499891 | 3300020173 | Salt Marsh | MENKMAVTWTIANMERDLMQGDNTDIVTILHWRASDEDSDGNTGSAYGT |
| Ga0181604_101575081 | 3300020191 | Salt Marsh | MAVTWTIGTMERDLVQGDNTDIVTILHWRASDEDSDGNTGS |
| Ga0181597_100931641 | 3300020194 | Salt Marsh | MAVTWTIANMERDLMQGDNTDIVTILHWRASDEDS |
| Ga0213860_104023162 | 3300021368 | Seawater | MAVTWTIANMERDLVQGDHTDIVTILHWRASDEDADGNTGS |
| Ga0213865_104267322 | 3300021373 | Seawater | MAVTWTIANMERDLVQGDNTDIVTILHWRASDEDDDGNTG |
| Ga0213865_104531011 | 3300021373 | Seawater | MAVTWTIGTMERDLVQGDNTDIVTILHWRASDEDSDGNTGSAYG |
| Ga0213864_101925811 | 3300021379 | Seawater | MAVTWTIANMERDLVQGDHTDIVTILHWRASDEDADGNTGSAYG |
| Ga0222717_100431772 | 3300021957 | Estuarine Water | MENKMAVTWTIGTMERDLVQGDNTDIVTILHWRASDEDADGN |
| Ga0222717_104014682 | 3300021957 | Estuarine Water | MAVTWTIGTMERDLVQGDNTDIVTILHWRASDEDSDG |
| Ga0222718_100458301 | 3300021958 | Estuarine Water | MAVTWTIGTMERDLVQGDNTDIVTILHWTAKDEDA |
| Ga0222718_101514182 | 3300021958 | Estuarine Water | MAVTWTIANMERDLVQGDNTDIVTILHWRASDEDADGNTGSAYGTV |
| Ga0222718_101561761 | 3300021958 | Estuarine Water | MAVTWTIANMERDLVQGDNTDIVTILHWRASDEDSDGNTGSAYGT |
| Ga0222716_101907931 | 3300021959 | Estuarine Water | MAVTWTIGTMERDLVQGDNTDIVTILHWRASDEDADGN |
| Ga0222716_105520802 | 3300021959 | Estuarine Water | MAVTWTITNMERDLVQGDNTDIVTILHWRASDEDSDGNTGASY |
| Ga0222719_101139343 | 3300021964 | Estuarine Water | MAVTWTIGTMERDLVQGDNTDIVTILHWRASDEDADGNT |
| Ga0222719_101787372 | 3300021964 | Estuarine Water | MAVTWTIGTMERDLVQGDNTDIVTILHWRASDEDSD |
| Ga0222719_102707412 | 3300021964 | Estuarine Water | MAVTWTIGTMERDLVQGDNTDIVTILHWRASDEDADGNTGSA |
| Ga0222719_103728071 | 3300021964 | Estuarine Water | MAVTWTIANMERDLVQGDNTDIVTILHWRASDEDADGNTGSAYGTVGAT |
| Ga0212027_10513511 | 3300022168 | Aqueous | MAVTWTIANMERDLVQGDNTDIVTILHWRASDEDDNG |
| Ga0196887_10528341 | 3300022178 | Aqueous | MENKMAVTWTIANMERDLVQGDNTDIVTILHWRASDEDADGNT |
| Ga0196891_10154761 | 3300022183 | Aqueous | MAVTWTIANMERDLVQGDNTDIVTILHWRASDEDDNGNT |
| Ga0196891_10272401 | 3300022183 | Aqueous | MENKMAVTWTIANMERDLVQGDNTDIVTILHWRASDEDSDGN |
| Ga0196899_10632862 | 3300022187 | Aqueous | MAVTWTIANMERDLVQGDNTDIVTILHWRASDEDDNGNTGSAYGTVGVT |
| Ga0196901_10358491 | 3300022200 | Aqueous | MAVTWTIANMERDLVQGDNTDIVTILHWRASDEDDN |
| Ga0255783_100785011 | 3300022923 | Salt Marsh | MAVTWTIANMERDLVQGDNTDIVTILHWRASDEDADGNTGSAYGTVGV |
| Ga0255758_100214814 | 3300022928 | Salt Marsh | MAVTWTIANMERDLVQGDNTDIVTILHWRASDEDADGN |
| Ga0255752_102151851 | 3300022929 | Salt Marsh | MAVTWTIANMERDLVQGDNTDIVTILHWRASDEDADGNTGSAYGTVGVT |
| (restricted) Ga0255040_102999602 | 3300024059 | Seawater | MAVTWTIGTMERDLVQGDNTDIVTILHWRASDEDADGNTGSAYGTVGVTLV |
| Ga0210003_11925441 | 3300024262 | Deep Subsurface | MAVTWTIANMERDLVQGDNTDIVTILHWRASDEDSDGNTGSAYGTVGVT |
| Ga0233451_101264341 | 3300024301 | Salt Marsh | MAVTWTIANMERDLVQGDNTDIVTILHWRASDEDADGNTGSAYGTVGVTL |
| Ga0208298_10420641 | 3300025084 | Marine | MAVTWTIGTMERDLVQGDNTDIVTILHWRASDEDADGNTGSAYGTVGVT |
| Ga0208434_10179671 | 3300025098 | Marine | MAVTWTIGNMERDLVQGDNTDIVTILHWRASDEDADGNT |
| Ga0208434_10573072 | 3300025098 | Marine | MAVTWTIGTMERDLVQGDNTDIVTILHWRASDEDADGNTG |
| Ga0208793_11172492 | 3300025108 | Marine | MAVTWTIGTMERDLVQGDNTDIVTILHWRASDEDA |
| Ga0208303_11133911 | 3300025543 | Aqueous | MAVTWTIANMERDLVQGDNTDIVTILHWRASDEDSDGNTGSAY |
| Ga0208643_10139671 | 3300025645 | Aqueous | MAVTWTIANMERDLVQGDNTDIVTILHWRASDEDSDGNTGS |
| Ga0208134_10640602 | 3300025652 | Aqueous | MAVTWTIGTMERDLVQGDNTDIVTILHWRASDEDDNGNTG |
| Ga0208898_10416551 | 3300025671 | Aqueous | MENKMAVTWTIANMERDLVQGDNTDIVTILHWRASDEDSDGNT |
| Ga0208898_10647793 | 3300025671 | Aqueous | MAVTWNIATMERDLVQGDNTDIVTILHWTAKDEDADGNTGSAYGAVG |
| Ga0208019_10080981 | 3300025687 | Aqueous | MENKMAVTWTIANMERDLVQGDNTDIVTILHWRASDEDSDGNAGSAYGTV |
| Ga0208019_10786281 | 3300025687 | Aqueous | MAVTWTIANMERDLVQGDNTDIVTILHWRASDEDA |
| Ga0208899_10420732 | 3300025759 | Aqueous | MAVTWTIANMERDLVQGDNTDIVTILHWRASDEDSDGN |
| Ga0208899_10571961 | 3300025759 | Aqueous | MENKMAVTWTIANMERDLVQGDNTDIVTILHWRASDEDDNGNT |
| Ga0208899_10988671 | 3300025759 | Aqueous | MENKMAVTWTIANMERDLVQGDNTDIVTILHWRAT |
| Ga0208767_10360271 | 3300025769 | Aqueous | MENKMAVTWTIANMERDLVQGDNTDIVTILHWRASDE |
| Ga0208767_11148622 | 3300025769 | Aqueous | MAVTWTIANMERDLVQGDNTDIVTILHWRASDEDDNGN |
| Ga0208547_11014663 | 3300025828 | Aqueous | MAITWAIANMERDLVQGDNTDIVTILHWRASDEDSDGNTGSAY |
| Ga0208917_11604581 | 3300025840 | Aqueous | MAVTWTIANMERDLVQGDNTDIVTILHWRASDEDD |
| Ga0208645_11044191 | 3300025853 | Aqueous | MAVTWTIANMERDLVQGDNTDIVTILHWRASDEDSDGNT |
| Ga0208645_11174041 | 3300025853 | Aqueous | MAVTWTIANMERDLVQGDNTDIVTILHWRASDEDDNGNTGS |
| Ga0209666_13023281 | 3300025870 | Marine | MAVTWTIGTMERDLVQGDNTDIVTTLHWRASDEDSD |
| Ga0307379_115353352 | 3300031565 | Soil | MENKMAVTWTIANMERDLVQGDNTDIVTILHWRASDEDDNGNTGS |
| Ga0316205_103388942 | 3300032257 | Microbial Mat | MENKMAVTWTIGTMERDLVQGDNTDIVTILHWRASDEDDNGNT |
| Ga0348337_040602_1868_1993 | 3300034418 | Aqueous | MAVTWTIGTMERDLVQGDNTDIVTILHWRASDEDSDGNTGSA |
| ⦗Top⦘ |