


| Basic Information | |
|---|---|
| Family ID | F079920 |
| Family Type | Metagenome |
| Number of Sequences | 115 |
| Average Sequence Length | 46 residues |
| Representative Sequence | LLPKRIAYTDDNLNILSYLLSLDNLLSKNVTGKVNHFSDYVIAW |
| Number of Associated Samples | 96 |
| Number of Associated Scaffolds | 115 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.88 % |
| % of genes near scaffold ends (potentially truncated) | 97.39 % |
| % of genes from short scaffolds (< 2000 bps) | 87.83 % |
| Associated GOLD sequencing projects | 85 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.28 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.391 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (27.826 % of family members) |
| Environment Ontology (ENVO) | Unclassified (40.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (41.739 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 30.56% β-sheet: 0.00% Coil/Unstructured: 69.44% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.28 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 115 Family Scaffolds |
|---|---|---|
| PF13424 | TPR_12 | 66.09 |
| PF13432 | TPR_16 | 6.96 |
| PF00515 | TPR_1 | 1.74 |
| PF01120 | Alpha_L_fucos | 0.87 |
| PF05698 | Trigger_C | 0.87 |
| PF00317 | Ribonuc_red_lgN | 0.87 |
| PF04185 | Phosphoesterase | 0.87 |
| PF00326 | Peptidase_S9 | 0.87 |
| PF07719 | TPR_2 | 0.87 |
| PF13298 | LigD_N | 0.87 |
| PF06452 | CBM9_1 | 0.87 |
| PF13361 | UvrD_C | 0.87 |
| COG ID | Name | Functional Category | % Frequency in 115 Family Scaffolds |
|---|---|---|---|
| COG0209 | Ribonucleotide reductase alpha subunit | Nucleotide transport and metabolism [F] | 0.87 |
| COG0544 | FKBP-type peptidyl-prolyl cis-trans isomerase (trigger factor) | Posttranslational modification, protein turnover, chaperones [O] | 0.87 |
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.87 |
| COG3669 | Alpha-L-fucosidase | Carbohydrate transport and metabolism [G] | 0.87 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.39 % |
| Unclassified | root | N/A | 2.61 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300003319|soilL2_10073890 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1493 | Open in IMG/M |
| 3300004114|Ga0062593_101069140 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300005171|Ga0066677_10735278 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 550 | Open in IMG/M |
| 3300005172|Ga0066683_10860677 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300005186|Ga0066676_10245278 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1168 | Open in IMG/M |
| 3300005467|Ga0070706_102102484 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300005471|Ga0070698_101567462 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300005518|Ga0070699_101107837 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300005559|Ga0066700_10198973 | All Organisms → cellular organisms → Bacteria | 1383 | Open in IMG/M |
| 3300005559|Ga0066700_10971606 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300005561|Ga0066699_10084669 | All Organisms → cellular organisms → Bacteria | 2054 | Open in IMG/M |
| 3300005561|Ga0066699_10437000 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 937 | Open in IMG/M |
| 3300005561|Ga0066699_10631121 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 769 | Open in IMG/M |
| 3300005569|Ga0066705_10545939 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 719 | Open in IMG/M |
| 3300005574|Ga0066694_10379767 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 666 | Open in IMG/M |
| 3300005574|Ga0066694_10540887 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300006755|Ga0079222_10268975 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1087 | Open in IMG/M |
| 3300006794|Ga0066658_10244190 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 959 | Open in IMG/M |
| 3300006806|Ga0079220_10001485 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 7152 | Open in IMG/M |
| 3300006852|Ga0075433_10167154 | All Organisms → cellular organisms → Bacteria | 1957 | Open in IMG/M |
| 3300006854|Ga0075425_100418539 | All Organisms → cellular organisms → Bacteria | 1543 | Open in IMG/M |
| 3300006854|Ga0075425_101680549 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 714 | Open in IMG/M |
| 3300006871|Ga0075434_100944923 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
| 3300007076|Ga0075435_101282063 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 641 | Open in IMG/M |
| 3300009090|Ga0099827_10086648 | All Organisms → cellular organisms → Bacteria | 2460 | Open in IMG/M |
| 3300009092|Ga0105250_10228219 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 791 | Open in IMG/M |
| 3300009143|Ga0099792_10891900 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300009143|Ga0099792_11231833 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 509 | Open in IMG/M |
| 3300009147|Ga0114129_10122473 | All Organisms → cellular organisms → Bacteria | 3578 | Open in IMG/M |
| 3300009147|Ga0114129_11284995 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
| 3300009147|Ga0114129_13266784 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 525 | Open in IMG/M |
| 3300009162|Ga0075423_11181169 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
| 3300009678|Ga0105252_10283730 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300010303|Ga0134082_10569095 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300010304|Ga0134088_10096704 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1387 | Open in IMG/M |
| 3300010304|Ga0134088_10234199 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
| 3300010326|Ga0134065_10115098 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 907 | Open in IMG/M |
| 3300010329|Ga0134111_10312677 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 657 | Open in IMG/M |
| 3300010333|Ga0134080_10007123 | All Organisms → cellular organisms → Bacteria | 3896 | Open in IMG/M |
| 3300010335|Ga0134063_10481484 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300010337|Ga0134062_10075787 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1410 | Open in IMG/M |
| 3300011269|Ga0137392_10858070 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300011271|Ga0137393_10147290 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1963 | Open in IMG/M |
| 3300012034|Ga0137453_1040674 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 817 | Open in IMG/M |
| 3300012096|Ga0137389_10457346 | All Organisms → cellular organisms → Bacteria | 1093 | Open in IMG/M |
| 3300012179|Ga0137334_1123325 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 586 | Open in IMG/M |
| 3300012200|Ga0137382_10333201 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
| 3300012203|Ga0137399_10714123 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 844 | Open in IMG/M |
| 3300012211|Ga0137377_10682145 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 962 | Open in IMG/M |
| 3300012357|Ga0137384_10945747 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300012363|Ga0137390_11630143 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300012685|Ga0137397_11195479 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 548 | Open in IMG/M |
| 3300012918|Ga0137396_10042621 | All Organisms → cellular organisms → Bacteria | 3075 | Open in IMG/M |
| 3300012924|Ga0137413_10337606 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1065 | Open in IMG/M |
| 3300012925|Ga0137419_11266443 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 619 | Open in IMG/M |
| 3300012927|Ga0137416_10073315 | All Organisms → cellular organisms → Bacteria | 2491 | Open in IMG/M |
| 3300012927|Ga0137416_11515109 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 609 | Open in IMG/M |
| 3300012944|Ga0137410_11829854 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300012957|Ga0164303_10531055 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 760 | Open in IMG/M |
| 3300012972|Ga0134077_10595164 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 500 | Open in IMG/M |
| 3300012975|Ga0134110_10432017 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300014154|Ga0134075_10054290 | All Organisms → cellular organisms → Bacteria | 1659 | Open in IMG/M |
| 3300014154|Ga0134075_10377162 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300014157|Ga0134078_10610421 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300015054|Ga0137420_1143285 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 708 | Open in IMG/M |
| 3300015054|Ga0137420_1446298 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 808 | Open in IMG/M |
| 3300015241|Ga0137418_10449682 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1041 | Open in IMG/M |
| 3300015241|Ga0137418_10500674 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 971 | Open in IMG/M |
| 3300015245|Ga0137409_10330379 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1333 | Open in IMG/M |
| 3300015245|Ga0137409_10391567 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1204 | Open in IMG/M |
| 3300015245|Ga0137409_10398068 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1192 | Open in IMG/M |
| 3300017966|Ga0187776_10770395 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 687 | Open in IMG/M |
| 3300018000|Ga0184604_10319382 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300018053|Ga0184626_10300319 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300018071|Ga0184618_10320216 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300018433|Ga0066667_11337999 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300018468|Ga0066662_11236729 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300018468|Ga0066662_12058929 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300019883|Ga0193725_1003896 | All Organisms → cellular organisms → Bacteria | 4326 | Open in IMG/M |
| 3300019997|Ga0193711_1008615 | All Organisms → cellular organisms → Bacteria | 1284 | Open in IMG/M |
| 3300020170|Ga0179594_10291262 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 618 | Open in IMG/M |
| 3300021046|Ga0215015_10178816 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300021081|Ga0210379_10057036 | All Organisms → cellular organisms → Bacteria | 1567 | Open in IMG/M |
| 3300022534|Ga0224452_1161833 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300022756|Ga0222622_10538029 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 838 | Open in IMG/M |
| 3300024330|Ga0137417_1477235 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1138 | Open in IMG/M |
| 3300025910|Ga0207684_11471714 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300026314|Ga0209268_1021504 | All Organisms → cellular organisms → Bacteria | 2346 | Open in IMG/M |
| 3300026314|Ga0209268_1122579 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 653 | Open in IMG/M |
| 3300026319|Ga0209647_1221172 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300026325|Ga0209152_10070801 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1263 | Open in IMG/M |
| 3300026326|Ga0209801_1336112 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 532 | Open in IMG/M |
| 3300026537|Ga0209157_1169676 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
| 3300026538|Ga0209056_10114146 | All Organisms → cellular organisms → Bacteria | 2164 | Open in IMG/M |
| 3300026540|Ga0209376_1359776 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 548 | Open in IMG/M |
| 3300027573|Ga0208454_1131390 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300027643|Ga0209076_1095914 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 842 | Open in IMG/M |
| 3300027765|Ga0209073_10504839 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300027787|Ga0209074_10101833 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 972 | Open in IMG/M |
| 3300027846|Ga0209180_10199765 | All Organisms → cellular organisms → Bacteria | 1153 | Open in IMG/M |
| 3300027875|Ga0209283_10217063 | All Organisms → cellular organisms → Bacteria | 1270 | Open in IMG/M |
| 3300027903|Ga0209488_10138254 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1838 | Open in IMG/M |
| 3300027903|Ga0209488_11054741 | Not Available | 558 | Open in IMG/M |
| 3300028718|Ga0307307_10160150 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 705 | Open in IMG/M |
| 3300028792|Ga0307504_10433332 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300028811|Ga0307292_10160506 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 912 | Open in IMG/M |
| 3300032205|Ga0307472_100327146 | All Organisms → cellular organisms → Bacteria | 1246 | Open in IMG/M |
| 3300032770|Ga0335085_10204570 | All Organisms → cellular organisms → Bacteria | 2415 | Open in IMG/M |
| 3300032892|Ga0335081_12678483 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 509 | Open in IMG/M |
| 3300032897|Ga0335071_10006096 | All Organisms → cellular organisms → Bacteria | 12471 | Open in IMG/M |
| 3300032897|Ga0335071_10492544 | All Organisms → cellular organisms → Bacteria | 1178 | Open in IMG/M |
| 3300032954|Ga0335083_10526559 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
| 3300033812|Ga0364926_146138 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 506 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 27.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 15.65% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 11.30% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.09% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.35% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 3.48% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.48% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.48% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.48% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.61% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.74% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.87% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.87% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.87% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.87% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.87% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.87% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.87% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.87% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.87% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009678 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012034 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT526_2 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012179 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT262_2 | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019883 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2 | Environmental | Open in IMG/M |
| 3300019997 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3m2 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300027573 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033812 | Sediment microbial communities from East River floodplain, Colorado, United States - 65_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| soilL2_100738901 | 3300003319 | Sugarcane Root And Bulk Soil | SLLGNLLPKRIAYTNDDHSSILYWLLSLDNIFTRKVTGKLDHFSDYVVGW* |
| Ga0062593_1010691402 | 3300004114 | Soil | GKLLPKRIAYIDANENILEYLLSLDLLNLRNVTGQLRHFSAYAVAW* |
| Ga0066677_107352781 | 3300005171 | Soil | RLLSVYAMRFGSSLLGKLLPKRIAYTDNNLNIISYLLSLDNLLSKYVSGKVNHFSDYVVAW* |
| Ga0066683_108606772 | 3300005172 | Soil | LPKRIAYTSDLLDILEYLLSVDNLLGKKVTGQVKHFSEYVIAW* |
| Ga0066676_102452781 | 3300005186 | Soil | AALTMSYSNCSLLGKLLPKRIAYTDDNLNILSYLLSLDNLLSKNVTGKVNHFSDYVIAW* |
| Ga0070706_1021024841 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | IAYTTDALQILYYLLSLDNLLSKYVTGQVNHFSSYVIAW* |
| Ga0070698_1015674621 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | LLPKRIAYTTDALQILYYLLSLDNLFGKYVTGEVNHFSSYVIAW* |
| Ga0070699_1011078372 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | IAYTDDNLNILSYLISLDNLFSKRVTGKLDHFSRYAVAW* |
| Ga0066700_101989731 | 3300005559 | Soil | KRIAYTDDALNILSFLLSVDNIFARKVTGKVNHFSNYAVAW* |
| Ga0066700_109716061 | 3300005559 | Soil | YTDDNLNIISYLLSLDNLLSSRVTGKLNHFSEYAVAG* |
| Ga0066699_100846691 | 3300005561 | Soil | PKRIAYTDDNLNIISYLLSLDNLLSKRVTGKVNHFSEYAVAW* |
| Ga0066699_104370001 | 3300005561 | Soil | YANCSLLGKLLPKRIAYTDDNLNIISYLLSLDNLLGKNVTGKVNHFSDYVIAW* |
| Ga0066699_106311211 | 3300005561 | Soil | DNLNIISYLLSLDNLLSKYVTGKVNHFSDYVVAW* |
| Ga0066705_105459391 | 3300005569 | Soil | DDNLNIISYLLSLDNLLSKRVTGKVNHFSEYAVAW* |
| Ga0066694_103797672 | 3300005574 | Soil | CSLLGKLLPKRIAYTDDNLNILSYLLSLDNLLSKNVTGKVNHFSDYVIAW* |
| Ga0066694_105408871 | 3300005574 | Soil | LPKRVAYVSDALNILSYLLSLDNLFAKQVTGRVNHFSNYAVAW* |
| Ga0079222_102689752 | 3300006755 | Agricultural Soil | LPKRIAYTDDNLNILSYLLSLDNLLSKRVTGKVNHFSDYVVGW* |
| Ga0066658_102441901 | 3300006794 | Soil | YANCSLLGKILPKRIAYTDDNLNIISYLLSLDNLLSKYVTGKVNHFSDYVIAW* |
| Ga0079220_100014851 | 3300006806 | Agricultural Soil | SLLGKLLPKQIAYTTDDLQILYYLLSLDNLLGKYVTGQVNHFSSYVVAW* |
| Ga0075433_101671543 | 3300006852 | Populus Rhizosphere | RIAYTTDGLQILYYLLSLDNLFSKYVTGKVNHFSSYVIAW* |
| Ga0075425_1004185392 | 3300006854 | Populus Rhizosphere | KLLPKRIAYTTDGLQILYYLLSLDNLFSKYVTGKVNHFSSYVIAW* |
| Ga0075425_1016805491 | 3300006854 | Populus Rhizosphere | SLLGKILPKRIAYTDDNLNILTYLLSLDNLLSKRVTGKVSHFSDYVIAW* |
| Ga0075434_1009449231 | 3300006871 | Populus Rhizosphere | TTDGLQILYYLLSLDNLFSKYVTGKVNHFSSYVIAW* |
| Ga0075435_1012820631 | 3300007076 | Populus Rhizosphere | LPKRIAYTDDNLNILTYLLSLDNLLSKRVTGKVNHFSDYVIAW* |
| Ga0099827_100866483 | 3300009090 | Vadose Zone Soil | PKRIAYTDDNLNIISYLLSLDNILSKSVTGKVNHFSDYVIAW* |
| Ga0105250_102282191 | 3300009092 | Switchgrass Rhizosphere | LLGKILPKRIAYTDDNLNIITYLLSLDNLLSKLVTGKVNHFSDYVVAW* |
| Ga0099792_108919001 | 3300009143 | Vadose Zone Soil | AYTTDKLQILSFLASLDNVLSKTVTGQVNHFSRYAVAW* |
| Ga0099792_112318331 | 3300009143 | Vadose Zone Soil | DNLNILSYLLSLDNLLSKNVTGKVNHFSDYVVAW* |
| Ga0114129_101224731 | 3300009147 | Populus Rhizosphere | ILPKRIAYTDDNLNIITYLLSLDNLLSKRVTGKVNHFSDYVVAW* |
| Ga0114129_112849952 | 3300009147 | Populus Rhizosphere | YTTEGLQILSYLLSLDNLLQKNVTGQLRHFSRYAVAW* |
| Ga0114129_132667841 | 3300009147 | Populus Rhizosphere | TDERLNILYYLLSLDNIFAKRVTSRVDHFSDYVIAW* |
| Ga0075423_111811692 | 3300009162 | Populus Rhizosphere | VLGKLLPKRIAYTTDGLQILYYLLSLDNLFSKYVTGKVNHFSSYVIAW* |
| Ga0105252_102837301 | 3300009678 | Soil | LLGRLLPKRIAYTNNLLDILYYILSLDNVWTRQVIGKVDHFSKYAVSW* |
| Ga0134082_105690951 | 3300010303 | Grasslands Soil | KILPKRIAYTDDALSILSYLLSFDNLFAKDVTGRLNHFSNYAIAW* |
| Ga0134088_100967042 | 3300010304 | Grasslands Soil | YTDDNLNILSYLLSLDNLLSKNVTGKVNHFSDYVIAW* |
| Ga0134088_102341991 | 3300010304 | Grasslands Soil | KILPKRIAYTSDALTILSYVLSLDNLFGKYVTGRLNHFSNYAIAW* |
| Ga0134065_101150982 | 3300010326 | Grasslands Soil | VTPAVLKMSYSNCSLLGILLPKRIAYTDNNLNIISYLLSLDNLLSKYVTGKVNHFSDYVVGW* |
| Ga0134111_103126772 | 3300010329 | Grasslands Soil | VTPAALTMSYSNCSLLGKILPKRIAYTDDNLSIISYLLSLDNLFSKNVTGKVNHFSAYVVAW* |
| Ga0134080_100071231 | 3300010333 | Grasslands Soil | LLGTLLPKRIAYTDDALDILSYLLSLDNLFAKKVTGKLYHFSNYAIAW* |
| Ga0134063_104814841 | 3300010335 | Grasslands Soil | LLGKILPKRIAYTNDALTILSYVLSLDNLFSKYVTGRLNHFSNYAIAW* |
| Ga0134062_100757871 | 3300010337 | Grasslands Soil | RPASLSMGYANCSLLGKLAPKRIAYTSDDLDILYFVLSLDNIFAKRVTGQVNHFSDYVVGW* |
| Ga0137392_108580702 | 3300011269 | Vadose Zone Soil | GDNLNILSYLLSFDNLFASKVTGQVHHFSNYAVAW* |
| Ga0137393_101472901 | 3300011271 | Vadose Zone Soil | PKRIAYTDDNLNIISYLLSLDNLLTQKVTGKVNHFSEYAVAW* |
| Ga0137453_10406742 | 3300012034 | Soil | LLGKLLPKRIAYTDNNLNILYYLLSLDNLLSKRVTGKVNHFSDYVVAW* |
| Ga0137389_104573461 | 3300012096 | Vadose Zone Soil | NCSLLGKLLPKRIAYTTDGLQILYYLLSLDNLFSKYVTGKVNHFSSYVIAW* |
| Ga0137334_11233251 | 3300012179 | Soil | TDDALNIITYLLSLDNLWGKRVTSNLDHFSDYVVAW* |
| Ga0137382_103332011 | 3300012200 | Vadose Zone Soil | KILPKRIAYTNDALAILSYVLSLDNLFGKYVTGRLNHFSNYAIAW* |
| Ga0137399_107141232 | 3300012203 | Vadose Zone Soil | SNCSLLGKLLPKRIAYTDDNLNILSYLLSLDNLVSKNVTGKVNHFSDYVVAW* |
| Ga0137377_106821451 | 3300012211 | Vadose Zone Soil | DNLNILAYLLSLDNLLSKNVTGKVNHFSDYVIAW* |
| Ga0137384_109457472 | 3300012357 | Vadose Zone Soil | ANLSILYYLLSIDNLFSRKVTGQVNHFSEYAMAW* |
| Ga0137390_116301431 | 3300012363 | Vadose Zone Soil | DNLNILSYLLSLDNLLSKNVTGKVNHFSDYVIAW* |
| Ga0137397_111954792 | 3300012685 | Vadose Zone Soil | IAYTDNNLNIISYLLSLDNLFSKNVTGKVNHFSDYVVAW* |
| Ga0137396_100426211 | 3300012918 | Vadose Zone Soil | KLLPKRIAYTTDNLQILYYLLSLDNLFSKYVTGKVNHFSSYVIAW* |
| Ga0137413_103376062 | 3300012924 | Vadose Zone Soil | LTMSYSNCSLLGKLLPKRIAYTDNALNILSYLLSLDNLFSKRVTGKVNHFSDYVIAW* |
| Ga0137419_112664431 | 3300012925 | Vadose Zone Soil | LPKRIAYTDDNLNIISYLLSLDNLFSKNVTGKVSHFSDYVIAW* |
| Ga0137416_100733153 | 3300012927 | Vadose Zone Soil | MSYSNCSLLGKLLPKRIAYTDDNLNIISYLLSLDNLFSKYVTGKVNHFSDYVIAW* |
| Ga0137416_115151091 | 3300012927 | Vadose Zone Soil | PKRIAYTDNNLNIISYLLSLDNLFSKYVTGKVNHFSDYVVAW* |
| Ga0137410_118298542 | 3300012944 | Vadose Zone Soil | LLPKRIAYTTDNLQILYYLLSLDNLFSKYVTGKLSHFSSYAIAW* |
| Ga0164303_105310552 | 3300012957 | Soil | NCSLLGKILPKRIAYTDDRLNILYYLLSLDNLLSKYVTGKVNHFSDYVVAW* |
| Ga0134077_105951642 | 3300012972 | Grasslands Soil | CSLLGKLLPKRIAYTDDNLNILSYLLSLDNLLSKRVTGKVNHFSDYVIAW* |
| Ga0134110_104320171 | 3300012975 | Grasslands Soil | LLGKILPKRIAYTDDALNILSYLLSLDNLFAKNVTGKLNHFSNYAIAW* |
| Ga0157369_107576681 | 3300013105 | Corn Rhizosphere | KRIAYTDNSLNILSYLLSIDNLFTRRVTGQVHHFSRYAIAW* |
| Ga0134075_100542901 | 3300014154 | Grasslands Soil | CNLLGKILPKRIAYTNDALAILSYVPSLDNLFAQNVTGKLNHFSNYAIAW* |
| Ga0134075_103771622 | 3300014154 | Grasslands Soil | NLLGKLLPKRIVYTDDALNILSYLLSLDNLFAKAVTGKLSHFSNYAIAW* |
| Ga0134078_106104212 | 3300014157 | Grasslands Soil | LPKRIVYTDDALNVLSYLLSLDNLFAKTVTGKLNHFSNYAIAW* |
| Ga0137420_11432851 | 3300015054 | Vadose Zone Soil | IAYTDDNLNIISYLLSLDNLFSKYVTGKVNHFSDYVIAW* |
| Ga0137420_14462981 | 3300015054 | Vadose Zone Soil | PKRIAYTDDNLNIISYLLSLDNLFSKYVTGKVNHFSDYVIAW* |
| Ga0137418_104496822 | 3300015241 | Vadose Zone Soil | SYSNCSLLGKLLPKRIAYTDDNLNILSYLLSLDNLFSKNVTGKVNHFSDYVVAW* |
| Ga0137418_105006741 | 3300015241 | Vadose Zone Soil | LTMSYSNCSLLGKLLPKRIAYTDDNLNIISYLLSLDNLFSKYVTGKVNHFSDYVIAW* |
| Ga0137409_103303791 | 3300015245 | Vadose Zone Soil | LLPKRIAYTDDNLNIISYLLSLDNLLSKYVTGKVNHFSDYVIAW* |
| Ga0137409_103915671 | 3300015245 | Vadose Zone Soil | APAALTMSYSNCSLLGKLLPKRIAYTDDNLNILSYLLSLDNLFSKNVTGKVSHFSDYVVAW* |
| Ga0137409_103980681 | 3300015245 | Vadose Zone Soil | APAALTMSYSNCSLLGKLLPKRIAYTDNNLNIISYLLSLDNLFSKNVTGKVNHFSDYVVAW* |
| Ga0187776_107703951 | 3300017966 | Tropical Peatland | LLGKLLPKRIAYTSDNLEILEYILSLDNILAKRVTGQVRHFSDYVVAW |
| Ga0184604_103193821 | 3300018000 | Groundwater Sediment | YTTDDLEILEYLLSFGNLFSKYVTGQISHFSSYVIAW |
| Ga0184626_103003192 | 3300018053 | Groundwater Sediment | LLGKLLPKRIAYTSNLLDIVEYLLSLDNLWTKKVTGRVNHFSEYVIAW |
| Ga0184618_103202162 | 3300018071 | Groundwater Sediment | LPKRIAYTTNLLDVVEYLLSLDNLFTKKVTGRVPHFSEYVIAW |
| Ga0066667_113379992 | 3300018433 | Grasslands Soil | LPKRIAYTTNNLQILYYLLSLDNLFSKYVTGKVNHFSSYVIAW |
| Ga0066662_112367291 | 3300018468 | Grasslands Soil | KLLPKRIVYTDDALNILSYLLSLDNLFAKAVTGKLSHFSNYAIAW |
| Ga0066662_120589292 | 3300018468 | Grasslands Soil | GKLLPKRIAYTTDNLQILYYLLSLDNLLSKYVTGQVKHFSDYVVAW |
| Ga0193725_10038961 | 3300019883 | Soil | KRIAYTNNLLGILEYLLSLDNLFGRNVTGQVKHFSEYVIAW |
| Ga0193711_10086152 | 3300019997 | Soil | KRIAYTSNLLQVLEYLLSIDNLFSKKVTGQVRHFSEYVISW |
| Ga0179594_102912622 | 3300020170 | Vadose Zone Soil | RPAALSMSYSNCSLLGRLLPKRIAYTDNALNIVSYLLSLDNLFGKRVTGKVNHFSDYVIA |
| Ga0215015_101788161 | 3300021046 | Soil | TDNLQILYYLLSLDNLLSNTVTGQVNHFSAYVIAW |
| Ga0210379_100570361 | 3300021081 | Groundwater Sediment | YTTDDLTILSYLLSLDNLFQKQVTGQLQHFSRYALAW |
| Ga0224452_11618331 | 3300022534 | Groundwater Sediment | LGKLLTKRIAYTSSLLQILEYLLSVDNLFSKKVTGQVRHFSEYVIAW |
| Ga0222622_105380291 | 3300022756 | Groundwater Sediment | YSNCSLLGKLLPKRIAYTDDNLNILSYLLSLDNLLSKNVTGKVNHFSDYVIAW |
| Ga0137417_14772351 | 3300024330 | Vadose Zone Soil | LPKRIAYTDDNLNIISYLLSLDNILSKRVTGKVNHFSDYVIAW |
| Ga0207684_114717142 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | IAYTTDNLQILYYLLSLDNLLSKYVTGQVNHFSTYVVAW |
| Ga0207660_103070131 | 3300025917 | Corn Rhizosphere | PKRIAYTDSKLNILSYLLSIDNLLTRRVTGQVHHFSRYAIAW |
| Ga0209268_10215041 | 3300026314 | Soil | NCSLLGKILPKRIAYTNDALAILSYVLSLDNLFGKYVTGRLNHFSNYAIAW |
| Ga0209268_11225792 | 3300026314 | Soil | GKLLPKRIAYTDDNLNILSYLLSLDNLLSKNVTGKVNHFSDYVIAW |
| Ga0209647_12211721 | 3300026319 | Grasslands Soil | LGSLLPKRIAYTSNLLDILEYLLSVDNLFSKKVTGQVKHFSEYVIAW |
| Ga0209152_100708011 | 3300026325 | Soil | YANCSLLGKILPKRIAYTDDNLNIISYLLSLDNLLSKYVTGKVNHFSDYVIAW |
| Ga0209801_13361122 | 3300026326 | Soil | ILLPKRIAYTDNNLNIISYLLSLDNVLSKYVTGKVNHFSDYVIAW |
| Ga0209157_11696761 | 3300026537 | Soil | LPKRIAYTDDALSILSYLLSFDNLFAKDVTGRLNHFSNYAIAW |
| Ga0209056_101141461 | 3300026538 | Soil | LLGKLLPKRIAYTTDNLQILYYLLSLDNLLSKYVTGQVKHFSDYVVAW |
| Ga0209376_13597761 | 3300026540 | Soil | DDNLNIISYLLSLDNLLSKYVTGKVNHFSDYVIAW |
| Ga0208454_11313902 | 3300027573 | Soil | LLGRLLPKRIAYTNNLLDILYYILSLDNVWTRQVIGKVDHFSKYAVSW |
| Ga0209076_10959141 | 3300027643 | Vadose Zone Soil | AVLKMSYSNCSLLGKLLPKRIAYTDNNLNIISYLLSLDNLFSKNVTGKVNHFSDYVVAW |
| Ga0209073_105048391 | 3300027765 | Agricultural Soil | SLLGKLLPKQIAYTTDDLQILYYLLSLDNLLGKYVTGQVNHFSSYVVAW |
| Ga0209074_101018332 | 3300027787 | Agricultural Soil | MSYSNCSLLGKILPKRIAYTDDNLNILSYLLSLDNLLSKRVTGKVNHFSDYVVGW |
| Ga0209180_101997652 | 3300027846 | Vadose Zone Soil | IAYTTDNLQILYYLLTLGSNLLSQTVTAQVNHFSAYVIAW |
| Ga0209283_102170631 | 3300027875 | Vadose Zone Soil | ANCSLLGNLLPKRIAYTTNNLQILYYLLSLDNLFSKYVTGKVNHFSSYVVAW |
| Ga0209488_101382543 | 3300027903 | Vadose Zone Soil | TTNSLQILYYLLSLDNLFSKYVTGKVNHFSSYVIAW |
| Ga0209488_110547411 | 3300027903 | Vadose Zone Soil | YTNDALDIVEALLSLDNLFGKKVTGQVRHFSGYAVAY |
| Ga0307307_101601502 | 3300028718 | Soil | GKILPKRIAYTDDNLNILSYLLSLDNLLSKRVTGKVNHFSDYVIAW |
| Ga0307504_104333322 | 3300028792 | Soil | NCSLLGRLLPKRIAYTNNLLDILSYLLSVDNLFTKKVTGQVRHFSEYVIAW |
| Ga0307292_101605062 | 3300028811 | Soil | LLPKRIAYTDDNLNILSYLLSLDNLLSKNVTGKVNHFSDYVIAW |
| Ga0307472_1003271462 | 3300032205 | Hardwood Forest Soil | LPKRIAYTTDALQILYYLLSLDNLFSKYVTGKVNHFSSYVIAW |
| Ga0335085_102045701 | 3300032770 | Soil | RLLPKRVAYTTDAYQILEYLLSLDNLFAKQVTGQVHHFSHYAVAW |
| Ga0335081_126784832 | 3300032892 | Soil | AYTNDAYQILEYLLSLDNLFSKHVTGQVHHFSHYAVAW |
| Ga0335071_100060961 | 3300032897 | Soil | RLLPKRVAYTNDAYQILEYLLSLDNLFAKQVTGQVHHFSHYAVAW |
| Ga0335071_104925442 | 3300032897 | Soil | RLLPKRVAYTNDAYQILEYLLSLDNLFAKQVTGQVHHFSHYAIAW |
| Ga0335083_105265591 | 3300032954 | Soil | YTTDAYQILEYLLSLDNLFAKQVTGQVHHFSHYAVAW |
| Ga0364926_146138_3_152 | 3300033812 | Sediment | NLLGKLLPKRIAYTDRNLNILYYLLSLDNLLSKRVTGKVDHFSDYVVAW |
| ⦗Top⦘ |