


| Basic Information | |
|---|---|
| Family ID | F079826 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 115 |
| Average Sequence Length | 39 residues |
| Representative Sequence | VAAIIEGKIMNLSVEAKVAIAVATSFVVLIVGAMAQG |
| Number of Associated Samples | 98 |
| Number of Associated Scaffolds | 115 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 36.52 % |
| % of genes near scaffold ends (potentially truncated) | 46.09 % |
| % of genes from short scaffolds (< 2000 bps) | 86.96 % |
| Associated GOLD sequencing projects | 95 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.58 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (71.304 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (23.478 % of family members) |
| Environment Ontology (ENVO) | Unclassified (38.261 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.652 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.69% β-sheet: 0.00% Coil/Unstructured: 52.31% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.58 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 115 Family Scaffolds |
|---|---|---|
| PF01471 | PG_binding_1 | 6.09 |
| PF01192 | RNA_pol_Rpb6 | 3.48 |
| PF13602 | ADH_zinc_N_2 | 2.61 |
| PF09720 | Unstab_antitox | 2.61 |
| PF10543 | ORF6N | 1.74 |
| PF15919 | HicB_lk_antitox | 1.74 |
| PF08240 | ADH_N | 1.74 |
| PF08734 | GYD | 1.74 |
| PF06250 | YhcG_C | 1.74 |
| PF04255 | DUF433 | 0.87 |
| PF06736 | TMEM175 | 0.87 |
| PF04055 | Radical_SAM | 0.87 |
| PF00107 | ADH_zinc_N | 0.87 |
| PF00902 | TatC | 0.87 |
| PF15937 | PrlF_antitoxin | 0.87 |
| PF09907 | HigB_toxin | 0.87 |
| PF00561 | Abhydrolase_1 | 0.87 |
| PF02661 | Fic | 0.87 |
| PF00128 | Alpha-amylase | 0.87 |
| PF10049 | DUF2283 | 0.87 |
| PF13560 | HTH_31 | 0.87 |
| PF02452 | PemK_toxin | 0.87 |
| PF07676 | PD40 | 0.87 |
| PF07690 | MFS_1 | 0.87 |
| PF07927 | HicA_toxin | 0.87 |
| PF08378 | NERD | 0.87 |
| COG ID | Name | Functional Category | % Frequency in 115 Family Scaffolds |
|---|---|---|---|
| COG1758 | DNA-directed RNA polymerase, subunit K/omega | Transcription [K] | 3.48 |
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 1.74 |
| COG4804 | Predicted nuclease of restriction endonuclease-like (RecB) superfamily, DUF1016 family | General function prediction only [R] | 1.74 |
| COG0296 | 1,4-alpha-glucan branching enzyme | Carbohydrate transport and metabolism [G] | 0.87 |
| COG0366 | Glycosidase/amylase (phosphorylase) | Carbohydrate transport and metabolism [G] | 0.87 |
| COG0805 | Twin-arginine protein secretion pathway component TatC | Intracellular trafficking, secretion, and vesicular transport [U] | 0.87 |
| COG1523 | Pullulanase/glycogen debranching enzyme | Carbohydrate transport and metabolism [G] | 0.87 |
| COG1724 | Predicted RNA binding protein YcfA, dsRBD-like fold, HicA-like mRNA interferase family | General function prediction only [R] | 0.87 |
| COG2337 | mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin module | Defense mechanisms [V] | 0.87 |
| COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 0.87 |
| COG3280 | Maltooligosyltrehalose synthase | Carbohydrate transport and metabolism [G] | 0.87 |
| COG3548 | Uncharacterized membrane protein | Function unknown [S] | 0.87 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 71.30 % |
| Unclassified | root | N/A | 28.70 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090014|GPIPI_16709101 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 7523 | Open in IMG/M |
| 2170459005|F1BAP7Q02FS9VD | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 2170459005|F1BAP7Q02JGE7K | Not Available | 504 | Open in IMG/M |
| 2189573005|GZGK9D402JNHHP | Not Available | 510 | Open in IMG/M |
| 3300000559|F14TC_101694780 | All Organisms → cellular organisms → Bacteria | 1332 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10000424 | All Organisms → cellular organisms → Bacteria | 9438 | Open in IMG/M |
| 3300000955|JGI1027J12803_101802510 | Not Available | 909 | Open in IMG/M |
| 3300005179|Ga0066684_10161585 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1428 | Open in IMG/M |
| 3300005180|Ga0066685_11090831 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 522 | Open in IMG/M |
| 3300005186|Ga0066676_10918478 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 586 | Open in IMG/M |
| 3300005186|Ga0066676_11176342 | Not Available | 502 | Open in IMG/M |
| 3300005340|Ga0070689_100391797 | Not Available | 1172 | Open in IMG/M |
| 3300005440|Ga0070705_100589135 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300005450|Ga0066682_10482924 | Not Available | 785 | Open in IMG/M |
| 3300005529|Ga0070741_10040503 | All Organisms → cellular organisms → Bacteria | 6028 | Open in IMG/M |
| 3300005540|Ga0066697_10171782 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1285 | Open in IMG/M |
| 3300005540|Ga0066697_10291818 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
| 3300005540|Ga0066697_10807552 | Not Available | 509 | Open in IMG/M |
| 3300005552|Ga0066701_10125676 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1523 | Open in IMG/M |
| 3300005553|Ga0066695_10041808 | All Organisms → cellular organisms → Bacteria | 2696 | Open in IMG/M |
| 3300005556|Ga0066707_10554726 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300005558|Ga0066698_10892582 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 569 | Open in IMG/M |
| 3300005558|Ga0066698_11104246 | Not Available | 501 | Open in IMG/M |
| 3300005574|Ga0066694_10232631 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
| 3300005617|Ga0068859_101427200 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 764 | Open in IMG/M |
| 3300005764|Ga0066903_100017971 | All Organisms → cellular organisms → Bacteria | 7346 | Open in IMG/M |
| 3300005764|Ga0066903_100525039 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2018 | Open in IMG/M |
| 3300005764|Ga0066903_102545076 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 991 | Open in IMG/M |
| 3300006032|Ga0066696_10732440 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 634 | Open in IMG/M |
| 3300006800|Ga0066660_10876562 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 731 | Open in IMG/M |
| 3300009012|Ga0066710_100909679 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1355 | Open in IMG/M |
| 3300009012|Ga0066710_104019959 | Not Available | 550 | Open in IMG/M |
| 3300009093|Ga0105240_12169210 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 576 | Open in IMG/M |
| 3300009137|Ga0066709_102459011 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 705 | Open in IMG/M |
| 3300009137|Ga0066709_102468355 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 703 | Open in IMG/M |
| 3300009174|Ga0105241_10394284 | All Organisms → cellular organisms → Bacteria | 1213 | Open in IMG/M |
| 3300009545|Ga0105237_12234858 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 557 | Open in IMG/M |
| 3300009792|Ga0126374_10649192 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Puniceicoccales → Puniceicoccaceae → unclassified Puniceicoccaceae → Puniceicoccaceae bacterium | 786 | Open in IMG/M |
| 3300010043|Ga0126380_11303203 | Not Available | 632 | Open in IMG/M |
| 3300010048|Ga0126373_11031279 | Not Available | 888 | Open in IMG/M |
| 3300010301|Ga0134070_10434483 | Not Available | 523 | Open in IMG/M |
| 3300010304|Ga0134088_10384096 | Not Available | 684 | Open in IMG/M |
| 3300010320|Ga0134109_10488418 | Not Available | 506 | Open in IMG/M |
| 3300010335|Ga0134063_10699804 | Not Available | 524 | Open in IMG/M |
| 3300010364|Ga0134066_10031152 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1261 | Open in IMG/M |
| 3300010366|Ga0126379_12220017 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 650 | Open in IMG/M |
| 3300010373|Ga0134128_12540853 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 564 | Open in IMG/M |
| 3300010376|Ga0126381_102268886 | Not Available | 780 | Open in IMG/M |
| 3300010397|Ga0134124_10117626 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2335 | Open in IMG/M |
| 3300012201|Ga0137365_10049001 | All Organisms → cellular organisms → Bacteria | 3204 | Open in IMG/M |
| 3300012202|Ga0137363_11043480 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 694 | Open in IMG/M |
| 3300012204|Ga0137374_10383896 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1122 | Open in IMG/M |
| 3300012208|Ga0137376_10186981 | All Organisms → cellular organisms → Bacteria | 1790 | Open in IMG/M |
| 3300012209|Ga0137379_11824389 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 502 | Open in IMG/M |
| 3300012211|Ga0137377_10117168 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2536 | Open in IMG/M |
| 3300012212|Ga0150985_105343835 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 591 | Open in IMG/M |
| 3300012212|Ga0150985_114159715 | Not Available | 584 | Open in IMG/M |
| 3300012350|Ga0137372_10058154 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 3380 | Open in IMG/M |
| 3300012353|Ga0137367_10114592 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1981 | Open in IMG/M |
| 3300012354|Ga0137366_10015592 | All Organisms → cellular organisms → Bacteria | 5961 | Open in IMG/M |
| 3300012354|Ga0137366_10265119 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1271 | Open in IMG/M |
| 3300012356|Ga0137371_10667695 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 796 | Open in IMG/M |
| 3300012925|Ga0137419_11170207 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 643 | Open in IMG/M |
| 3300012929|Ga0137404_10352425 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1288 | Open in IMG/M |
| 3300012929|Ga0137404_11903824 | Not Available | 554 | Open in IMG/M |
| 3300012957|Ga0164303_10697140 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 684 | Open in IMG/M |
| 3300012957|Ga0164303_11072900 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula | 579 | Open in IMG/M |
| 3300012960|Ga0164301_11624157 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 537 | Open in IMG/M |
| 3300012977|Ga0134087_10777810 | Not Available | 516 | Open in IMG/M |
| 3300014969|Ga0157376_12372980 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 570 | Open in IMG/M |
| 3300015371|Ga0132258_10755464 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2450 | Open in IMG/M |
| 3300017654|Ga0134069_1115670 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 881 | Open in IMG/M |
| 3300017657|Ga0134074_1073121 | Not Available | 1166 | Open in IMG/M |
| 3300017997|Ga0184610_1233542 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 613 | Open in IMG/M |
| 3300018028|Ga0184608_10376353 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 620 | Open in IMG/M |
| 3300018071|Ga0184618_10200480 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 834 | Open in IMG/M |
| 3300018073|Ga0184624_10226531 | Not Available | 836 | Open in IMG/M |
| 3300018431|Ga0066655_10774429 | Not Available | 652 | Open in IMG/M |
| 3300018482|Ga0066669_11005384 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300018482|Ga0066669_11192405 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 687 | Open in IMG/M |
| 3300019767|Ga0190267_11229146 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 552 | Open in IMG/M |
| 3300019877|Ga0193722_1000429 | All Organisms → cellular organisms → Bacteria | 9264 | Open in IMG/M |
| 3300019887|Ga0193729_1043851 | All Organisms → cellular organisms → Bacteria | 1839 | Open in IMG/M |
| 3300019996|Ga0193693_1065875 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium 13_1_40CM_4_54_4 | 540 | Open in IMG/M |
| 3300020004|Ga0193755_1038766 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1568 | Open in IMG/M |
| 3300020015|Ga0193734_1072025 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 606 | Open in IMG/M |
| 3300020062|Ga0193724_1057851 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 816 | Open in IMG/M |
| 3300021344|Ga0193719_10014414 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 3345 | Open in IMG/M |
| 3300021344|Ga0193719_10046459 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1881 | Open in IMG/M |
| 3300021344|Ga0193719_10053101 | All Organisms → cellular organisms → Bacteria | 1756 | Open in IMG/M |
| 3300021510|Ga0222621_1145744 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300022467|Ga0224712_10385030 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 667 | Open in IMG/M |
| 3300025901|Ga0207688_10876828 | Not Available | 568 | Open in IMG/M |
| 3300025986|Ga0207658_10196786 | All Organisms → cellular organisms → Bacteria | 1679 | Open in IMG/M |
| 3300026067|Ga0207678_10863432 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 800 | Open in IMG/M |
| 3300026306|Ga0209468_1083543 | Not Available | 1061 | Open in IMG/M |
| 3300026308|Ga0209265_1091881 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300026310|Ga0209239_1127282 | Not Available | 1048 | Open in IMG/M |
| 3300026323|Ga0209472_1095460 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1192 | Open in IMG/M |
| 3300026326|Ga0209801_1288166 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 591 | Open in IMG/M |
| 3300026327|Ga0209266_1183933 | Not Available | 785 | Open in IMG/M |
| 3300026334|Ga0209377_1127241 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1012 | Open in IMG/M |
| 3300026528|Ga0209378_1114635 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1168 | Open in IMG/M |
| 3300026538|Ga0209056_10575889 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 570 | Open in IMG/M |
| 3300026550|Ga0209474_10166083 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1428 | Open in IMG/M |
| 3300027671|Ga0209588_1207974 | Not Available | 608 | Open in IMG/M |
| 3300028381|Ga0268264_11437109 | Not Available | 700 | Open in IMG/M |
| 3300028824|Ga0307310_10359892 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 717 | Open in IMG/M |
| 3300028884|Ga0307308_10334197 | Not Available | 726 | Open in IMG/M |
| 3300031057|Ga0170834_108805705 | Not Available | 640 | Open in IMG/M |
| 3300031231|Ga0170824_113335892 | Not Available | 1174 | Open in IMG/M |
| 3300031231|Ga0170824_122286920 | Not Available | 644 | Open in IMG/M |
| 3300031720|Ga0307469_10089359 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 2120 | Open in IMG/M |
| 3300031820|Ga0307473_10217570 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1147 | Open in IMG/M |
| 3300031938|Ga0308175_102825236 | Not Available | 542 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 23.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 13.04% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 13.04% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 6.96% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 6.96% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.35% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.48% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.48% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.61% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.61% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.74% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 1.74% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.74% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.74% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.74% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.87% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.87% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.87% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.87% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.87% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.87% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.87% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.87% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.87% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.87% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.87% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.87% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 2189573005 | Grass soil microbial communities from Rothamsted Park, UK - FG3 (Nitrogen) | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
| 3300019877 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1 | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300019996 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a2 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300020015 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m1 | Environmental | Open in IMG/M |
| 3300020062 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1 | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021510 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coex | Environmental | Open in IMG/M |
| 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPIPI_03040290 | 2088090014 | Soil | VSVAVMEGKIMELSIEMKVAIAVATGFVVLVVGAMAQG |
| E41_06904700 | 2170459005 | Grass Soil | KNGGQSGCGRQIEGRIMNLSVEAKVAIAVATSLVVLIVGAMAQG |
| E41_01410290 | 2170459005 | Grass Soil | AIIEGEIMKLSIELKVAIAVAAGFVALTIGAMAQGG |
| FG3_08954450 | 2189573005 | Grass Soil | VAAIIEGRIMNLSVETKVAIAVATSFVVLMVGAMAQG |
| F14TC_1016947804 | 3300000559 | Soil | VAAIIEGKIMNLSVEAKVAIAVTTGFVVLIVGAMAQG* |
| AF_2010_repII_A1DRAFT_100004242 | 3300000597 | Forest Soil | MTAIIKWKIMNLSVETKVAIAVATSFVVLMVGAMASQG* |
| JGI1027J12803_1018025103 | 3300000955 | Soil | LAAIIEGKIMNLSVEAKVAIAVATSFLVLIVGAMAQG* |
| Ga0066684_101615851 | 3300005179 | Soil | MQSQVAARIEGKIVSLSIDIKMAIAVATGFVMLMGAMAQG* |
| Ga0066685_110908311 | 3300005180 | Soil | GIGVAAIIEGKIMNLSVEAKVAIAVATSFVVLIVGAMAQA* |
| Ga0066676_109184781 | 3300005186 | Soil | KKRGQRVAAIIEGKIMNLSIEAKVAIAVATGLVVLIVGAMAQG* |
| Ga0066676_111763421 | 3300005186 | Soil | GKIQKQGGIGVAAIIEGKIMNLSVEAKVAIAVATSFVVLIVGAMAQG* |
| Ga0070689_1003917972 | 3300005340 | Switchgrass Rhizosphere | KSGGDVSVAVMEGKIMELSIETKVAIAVATGFVVLVVGAMAQG* |
| Ga0070705_1005891351 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | QKRGVIGMAAIIAGKIMILSVEAKVAIAVATGFVVLIVGAMAQG* |
| Ga0066682_104829242 | 3300005450 | Soil | SKKGKIQKRGGIGVAAIIEGKIMNLSVEAKVAIAVATGFVVLILGAMAQG* |
| Ga0070741_100405036 | 3300005529 | Surface Soil | MKEGKIVSLSIETKVAIAVATGFVLMVVGAMAQG* |
| Ga0066697_101717824 | 3300005540 | Soil | MAAIIAGKIMSLSVEAKVAIAVATSFVLLIVGAMAQG* |
| Ga0066697_102918182 | 3300005540 | Soil | VAAIIEGKIMNLSVEAKVAIAVATGFVVLILGAMAQG* |
| Ga0066697_108075521 | 3300005540 | Soil | GGIGVAAIIEGKIMNLSVEAKVAIAVATSFVVLIVGAMAQG* |
| Ga0066701_101256763 | 3300005552 | Soil | RVAAIIEGKIMNLSIEAKVAIAVATGLVVLIVGAMAQG* |
| Ga0066695_100418084 | 3300005553 | Soil | VAAIIEGKIMNLSVEAKVAIAVATGFVVLIVGAMAQG* |
| Ga0066707_105547261 | 3300005556 | Soil | MIEGKIMNLSVEAKVAIAVATSFVVLIVGAMAQG* |
| Ga0066698_108925821 | 3300005558 | Soil | GGIGVAAIIEGKIMNLSVEAKVAIAVATSFVVLIVGAMAQA* |
| Ga0066698_111042461 | 3300005558 | Soil | KKGKIQKQGGIGVAAIIEGKIMNLSVEAKVAIAVATGFVVLILGAMAQG* |
| Ga0066694_102326311 | 3300005574 | Soil | VAAIIEGKIMNLSVEAKVAIAVATSFVVLIVGAMAQG* |
| Ga0068859_1014272002 | 3300005617 | Switchgrass Rhizosphere | LPPNKREQEGKIVSLTIEIKVAIAVATGFALMVVGAMAQG* |
| Ga0066903_1000179713 | 3300005764 | Tropical Forest Soil | MTAKIKGKIMNLSVETKVAIAVATSFVVLMVGAMASQG* |
| Ga0066903_1005250391 | 3300005764 | Tropical Forest Soil | MITIIKGKIMNLSVETKVAIAVATSFVVLIVGAMAQG* |
| Ga0066903_1025450761 | 3300005764 | Tropical Forest Soil | MTATIKGKIMNLSVETKVAMAVATSFVLLVVGAMAQG* |
| Ga0066696_107324402 | 3300006032 | Soil | AIIEGKIMNLSVEAKVAIAVATGFVLLIVGAMAQG* |
| Ga0066660_108765623 | 3300006800 | Soil | MQSQVAARIEGKIVSLSIEIKMAIAVATGFVMLIMGAMAQG* |
| Ga0066710_1009096792 | 3300009012 | Grasslands Soil | VAAIIEGKIMNLSVEAKVAIAVATSFVVVIVGAMAQG |
| Ga0066710_1040199591 | 3300009012 | Grasslands Soil | GGIGVAAIIEGKIMNLSVEAKVAIAVATGFVVLILGAMAQG |
| Ga0105240_121692102 | 3300009093 | Corn Rhizosphere | VSVAVMEGKIMELSIETKVAIAVATGFVVLVVGAMAQG* |
| Ga0066709_1024590111 | 3300009137 | Grasslands Soil | RGDVVATIIEGKIMDLSIETKVAIAVAMGFIVVIVGAIAQG* |
| Ga0066709_1024683551 | 3300009137 | Grasslands Soil | KTGVIGMAAIIAGKIMSLSVEAKVAIAVATGFVVLIVGAMAQG* |
| Ga0105241_103942843 | 3300009174 | Corn Rhizosphere | MTAMIEERIMNLSVETKVAIAVATSFVVLMVGAMAAQG* |
| Ga0105237_122348581 | 3300009545 | Corn Rhizosphere | HTVTPGTKGGLMNLSVETKVAIAVATSFVVLMVGAMAQG* |
| Ga0126374_106491921 | 3300009792 | Tropical Forest Soil | VAAIIEGKIMNLSVEMKVAIAVATSFVVLLVGAMAQG* |
| Ga0126380_113032031 | 3300010043 | Tropical Forest Soil | MTDIIKGKIMNLSVETKVAIAVATSFVVLIVGAMAQG* |
| Ga0126373_110312791 | 3300010048 | Tropical Forest Soil | MTDITKGKIMNLSVETKVAIAVATSFVVLMVGAMAQG* |
| Ga0134070_104344832 | 3300010301 | Grasslands Soil | MAAIIAGKMMNLSVEAKVAIAVATGFVMLIVGAMAQG* |
| Ga0134088_103840962 | 3300010304 | Grasslands Soil | VSVAVMEGKIMELSIETKVAIAVATGFVVLIVGAMAQG* |
| Ga0134109_104884181 | 3300010320 | Grasslands Soil | MAAIIAGKIMSLSVEAKVAIAVATGFIVLIVGAMAQG* |
| Ga0134063_106998041 | 3300010335 | Grasslands Soil | MNAKVEGRIMNLSVEAKIAIAVATVFVVLIVGAMARG* |
| Ga0134066_100311521 | 3300010364 | Grasslands Soil | MTAKVEGRIMNLSVEAKIAIAVATVFVVLIVGAMARW* |
| Ga0126379_122200172 | 3300010366 | Tropical Forest Soil | GGHRMTAIIKWKIMNLSVETKVAIAVATSFVVLMVGAMAQG* |
| Ga0134128_125408531 | 3300010373 | Terrestrial Soil | LTKQSQVAGIIEGKIVSLSIEIKVAIAVATGFVLMVVGAMAQR* |
| Ga0126381_1022688862 | 3300010376 | Tropical Forest Soil | MTAIIKGKIMNLSVEAKVAIAVATSFVVFMVGAMAQG* |
| Ga0134124_101176262 | 3300010397 | Terrestrial Soil | LPPNKREQEGKIVSLTIEIKVAIAVATGFALMLVGAMAQG* |
| Ga0137365_100490013 | 3300012201 | Vadose Zone Soil | VVATIIEGKIMDLSIETKVAIAVATGFVVLIVGAMAQG* |
| Ga0137363_110434802 | 3300012202 | Vadose Zone Soil | MQSQVAGKIEGEIVSLSIEIKVAIAVATGFVMLIMGAMAQE* |
| Ga0137374_103838961 | 3300012204 | Vadose Zone Soil | VAAIIEGKIMNLSVEAKVAIAVATIFVVLIVGAMAQG* |
| Ga0137376_101869817 | 3300012208 | Vadose Zone Soil | MIEGKIMNLSVEAKVAIAVATSFILLIVGAMAQG* |
| Ga0137379_118243891 | 3300012209 | Vadose Zone Soil | KRGGIGVAAIIEGKIMNLSVEAKVAIAVATSFVVLIVGAMAQG* |
| Ga0137377_101171682 | 3300012211 | Vadose Zone Soil | MIEGKIMNLSVEMKVAIVVATSFILLVVGAMAQG* |
| Ga0150985_1053438351 | 3300012212 | Avena Fatua Rhizosphere | SGVAAIIEGKIMNLSVEAKVAIAVETSFVLLIVGAMAQG* |
| Ga0150985_1141597152 | 3300012212 | Avena Fatua Rhizosphere | KDSKRGGRLATIIEEDIMSLSVEAKVAIAVATSFLMLIVGAMAQG* |
| Ga0137372_100581541 | 3300012350 | Vadose Zone Soil | KIKNGGDVVATIIEGKIMDLSIETKVAIAVAMGFIVVIVGAMAQG* |
| Ga0137367_101145924 | 3300012353 | Vadose Zone Soil | MGAIIAGKIMNLSVEAKVAIAVATGFIVLIVGAMAQG* |
| Ga0137366_100155929 | 3300012354 | Vadose Zone Soil | MIEGKIMNSSVEMKVAIVVATSFILLVVGAMAQG* |
| Ga0137366_102651192 | 3300012354 | Vadose Zone Soil | VAAIIEGKIMNLSVEAKVAIAVATIFVVLIVGAMGQG* |
| Ga0137371_106676951 | 3300012356 | Vadose Zone Soil | IQKRGGIGVAAIIEGKIMNLSVEAKVAIAVATSFVVLIVGAMAQG* |
| Ga0137419_111702071 | 3300012925 | Vadose Zone Soil | AIIEGKNMNLSVETKVAIAVATGFVVLIVGAMAQG* |
| Ga0137404_103524252 | 3300012929 | Vadose Zone Soil | MAAIIAGKIMSLSVEAKVAIAVATSFILLIVGAMAQG* |
| Ga0137404_119038241 | 3300012929 | Vadose Zone Soil | MGAIIAGKIMNLSVEAKVAIAVTTGFVLLIVGAMAQG* |
| Ga0164303_106971401 | 3300012957 | Soil | AKARLPGLIEGKIVSLSIEIKVAIAVATSFLLMLVGAMAQG* |
| Ga0164303_110729003 | 3300012957 | Soil | TGITEGRIVSLSIEIKVAIAVATGFLLMFVGAMAQG* |
| Ga0164301_116241571 | 3300012960 | Soil | HNLKGEIMNLSVETKVAIAVATSLVALIVGAMAQA* |
| Ga0134087_107778102 | 3300012977 | Grasslands Soil | VAAIIEGKIMNLSVEAKVAIAVATSFVVLIVGAMAQA* |
| Ga0157376_123729802 | 3300014969 | Miscanthus Rhizosphere | VAEFVAIIEGKMMNLSVETKVAIVVATSFILLVVGAMAQG* |
| Ga0132258_107554641 | 3300015371 | Arabidopsis Rhizosphere | MEGRIMNLSVEAKVAIAVATSFVVLMMGAMAGQG* |
| Ga0134069_11156702 | 3300017654 | Grasslands Soil | SKTEDKTRAQGVSAIIEGKIMNLSVETKVAIAVATSLVALIVGAMAQG |
| Ga0134074_10731211 | 3300017657 | Grasslands Soil | VAAIIEGKIMNLSVETKVAIAVATSFVVLIVGAMAQG |
| Ga0184610_12335421 | 3300017997 | Groundwater Sediment | IKEGQRVAAMIEGKIMNLSVETKVAIVVATSFILLIVGVMAQG |
| Ga0184608_103763531 | 3300018028 | Groundwater Sediment | SKRGQRVAAIIEGKIMNLSVETKVAIAVATSFILLVVGAMAQG |
| Ga0184618_102004801 | 3300018071 | Groundwater Sediment | ELAAIIEGKIVGLSIEIKVAIAVASGFVLMLVGAMAQG |
| Ga0184624_102265311 | 3300018073 | Groundwater Sediment | VAAIIEGKIMNLSVETKVAIAVATSFVVVIVGAMAQG |
| Ga0066655_107744292 | 3300018431 | Grasslands Soil | VAAIIEGKIMNLSVEAKVAIAVATGFVVLILGAMAQG |
| Ga0066669_110053842 | 3300018482 | Grasslands Soil | VAAIIEGKIMNLSVEAKVAIAVATGFVVLIVGAMAQG |
| Ga0066669_111924051 | 3300018482 | Grasslands Soil | VAAIIEGKIMNLSVEAKVAIAVATSFVVLIVGAMAQ |
| Ga0190267_112291462 | 3300019767 | Soil | VAGIIEGKIVSVSIEIKVAIAVATGFALMVVGAMAQG |
| Ga0193722_10004296 | 3300019877 | Soil | MATIVEGENFMNLSVETKVAIAVATSFVVLMVGAMAQV |
| Ga0193729_10438515 | 3300019887 | Soil | MAAIIAGKIMSLSVEAKVAIAVATSFVLLIVGAMAQG |
| Ga0193693_10658752 | 3300019996 | Soil | GVIGIAAVIEGKIMNLSVETKVAIVVATSFVLLIVGAMAQG |
| Ga0193755_10387661 | 3300020004 | Soil | SKTGVIGIAAVIEGKIMNLSVETKVAIVVATSFVLLIVGAMAQG |
| Ga0193734_10720251 | 3300020015 | Soil | RSDLQKRENSKTGVIGVAAMIEGKIMNLSVEAKVAIAVATSFILLIVGAMAQG |
| Ga0193724_10578513 | 3300020062 | Soil | KKRGDGVATIIKGEIVSLSIETKVAIAVATGFVLMVIGAMAQG |
| Ga0193719_100144141 | 3300021344 | Soil | VVATIIEEKLVSLSIETKVAIAVATGFVLMVVGAMAQG |
| Ga0193719_100464591 | 3300021344 | Soil | AVIEGKIMNLSVETKVAIVVATSFVLLIVGAMAQG |
| Ga0193719_100531015 | 3300021344 | Soil | MAAIIAGKIMSLSVEAKVAIAVATGFVVLIVGAMAQG |
| Ga0222621_11457442 | 3300021510 | Groundwater Sediment | NRRVEGKIVSLSIEIKVAIAVATGFALMVVGAMAQR |
| Ga0224712_103850302 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | TPGTKGGLMNLSVETKVAIAVATSFVVLMVGAMAQG |
| Ga0207688_108768282 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | VSVAVMEGKIMELSIETKVAIAVATGFVVLVVGAMAQG |
| Ga0207658_101967861 | 3300025986 | Switchgrass Rhizosphere | QKKKKVKSGGDVSVAVMEGKIMELSIETKVAIAVATGFVVLVVGAMAQG |
| Ga0207678_108634321 | 3300026067 | Corn Rhizosphere | VTIVEGKMMNLSVETKVAIVVATSFILLVVGAMAQG |
| Ga0209468_10835432 | 3300026306 | Soil | KGKIQKQGGIGVAAIIEGKIMNLSVEAKVAIAVATGFVVLILGAMAQG |
| Ga0209265_10918811 | 3300026308 | Soil | IGVAAIIEGKIMNLSVEAKVAIAVATSFVVLIVGAMAQG |
| Ga0209239_11272822 | 3300026310 | Grasslands Soil | VAAIIEGKIMNLSVEAKVAIAVATSFVVLIVGAMAQG |
| Ga0209472_10954603 | 3300026323 | Soil | MNAKVEGRIMNLSVEAKIAIAVATVFVVLIVGAMARG |
| Ga0209801_12881661 | 3300026326 | Soil | QRVAAIIEGKIMNLSIEAKVAIAVATGLVVLIVGAMAQG |
| Ga0209266_11839333 | 3300026327 | Soil | IQKQGGIGVAAIIEGKIMNLSVEAKVAIAVATGFVVLILGAMAQG |
| Ga0209377_11272411 | 3300026334 | Soil | MWQRVAAIIEGKIMNLSIEAKVAIAVATGLVVLIVGAMAQG |
| Ga0209378_11146352 | 3300026528 | Soil | SKKRGQQVAAIIEGKIMNLSIEAKVAIAVATGLVVLIVGAMAQG |
| Ga0209056_105758892 | 3300026538 | Soil | GGGIGVAAIIEGKIMNLSVEAKVAIAVATSFIVLIVGAMAQG |
| Ga0209474_101660831 | 3300026550 | Soil | PAIIEGKIMNLSVEAKVAIAVATGFVLLIVGAMAQG |
| Ga0209588_12079741 | 3300027671 | Vadose Zone Soil | AIIEGEIMNLSIEAKVAIAVATGFVVFILGAMAQG |
| Ga0268264_114371091 | 3300028381 | Switchgrass Rhizosphere | KWGDVSVAVMEGKIMELSIETKVAIAVATGFVVLVVGAMAQG |
| Ga0307310_103598922 | 3300028824 | Soil | VIGIAAVIEGKIMNLTVETKVAIVVATSFILLIVGAMAQG |
| Ga0307308_103341971 | 3300028884 | Soil | KNSKTGVIGMAAIIAGKIMSLSVEAKVAIAVATSFVVLIVGAMAQG |
| Ga0170834_1088057051 | 3300031057 | Forest Soil | VVIEVATIVERENIFMNLSVETKVAIAVATSFVVLMVGAMAQG |
| Ga0170824_1133358922 | 3300031231 | Forest Soil | VCGRQIEGKIMNLSIEAKVVIAVATSLVALIVGAMAQG |
| Ga0170824_1222869202 | 3300031231 | Forest Soil | AAIIEGKIMNLSVETKVAIAVATSFVILIVGAMAQG |
| Ga0307469_100893592 | 3300031720 | Hardwood Forest Soil | MTAIIKGKIMNLSVEAKVAIAVATGFLVVIVGAMAQG |
| Ga0307473_102175702 | 3300031820 | Hardwood Forest Soil | MTAIIKGKIMNLSIETKVAIAVATGFLVVIVGAMAQG |
| Ga0308175_1028252362 | 3300031938 | Soil | VAAIIEGKIMNLSIEAKVAIAVATSLVLLTVGAMAQG |
| ⦗Top⦘ |