


| Basic Information | |
|---|---|
| Family ID | F079729 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 115 |
| Average Sequence Length | 45 residues |
| Representative Sequence | PYTVRFMFPEPDGGALAKLTAMHIGNRQFYREFGWGEKSW |
| Number of Associated Samples | 88 |
| Number of Associated Scaffolds | 115 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.63 % |
| % of genes near scaffold ends (potentially truncated) | 92.17 % |
| % of genes from short scaffolds (< 2000 bps) | 93.04 % |
| Associated GOLD sequencing projects | 85 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.29 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.261 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (20.870 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.217 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (44.348 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 27.94% β-sheet: 0.00% Coil/Unstructured: 72.06% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.29 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 115 Family Scaffolds |
|---|---|---|
| PF00496 | SBP_bac_5 | 86.96 |
| PF00989 | PAS | 0.87 |
| PF07883 | Cupin_2 | 0.87 |
| PF00672 | HAMP | 0.87 |
| PF01494 | FAD_binding_3 | 0.87 |
| PF13442 | Cytochrome_CBB3 | 0.87 |
| PF00117 | GATase | 0.87 |
| PF01609 | DDE_Tnp_1 | 0.87 |
| PF07310 | PAS_5 | 0.87 |
| PF13700 | DUF4158 | 0.87 |
| COG ID | Name | Functional Category | % Frequency in 115 Family Scaffolds |
|---|---|---|---|
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.74 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.87 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.87 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.87 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.87 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.87 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.87 |
| COG5388 | Uncharacterized conserved protein | Function unknown [S] | 0.87 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.87 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.87 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.87 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.26 % |
| Unclassified | root | N/A | 1.74 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2189573000|GPBTN7E01DJ7SH | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300002561|JGI25384J37096_10062494 | All Organisms → cellular organisms → Bacteria | 1385 | Open in IMG/M |
| 3300003373|JGI25407J50210_10134757 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300003999|Ga0055469_10034563 | All Organisms → cellular organisms → Bacteria | 1255 | Open in IMG/M |
| 3300005330|Ga0070690_101543124 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300005332|Ga0066388_100581128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1746 | Open in IMG/M |
| 3300005332|Ga0066388_103996296 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300005332|Ga0066388_107937212 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 531 | Open in IMG/M |
| 3300005336|Ga0070680_101946088 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300005445|Ga0070708_100495960 | All Organisms → cellular organisms → Bacteria | 1152 | Open in IMG/M |
| 3300005468|Ga0070707_100605607 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Bacillus → Bacillus infantis | 1058 | Open in IMG/M |
| 3300005544|Ga0070686_100288795 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → Rubrobacter → Rubrobacter xylanophilus | 1212 | Open in IMG/M |
| 3300005557|Ga0066704_10903699 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300005576|Ga0066708_10776961 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300005764|Ga0066903_100307686 | All Organisms → cellular organisms → Bacteria | 2515 | Open in IMG/M |
| 3300005842|Ga0068858_102460824 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300005937|Ga0081455_10164690 | All Organisms → cellular organisms → Bacteria | 1695 | Open in IMG/M |
| 3300006852|Ga0075433_10891368 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300006853|Ga0075420_101539336 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300006854|Ga0075425_102062847 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300006854|Ga0075425_103088516 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300006880|Ga0075429_101956056 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300006904|Ga0075424_101361679 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300006904|Ga0075424_102319300 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300006969|Ga0075419_10153816 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1506 | Open in IMG/M |
| 3300006969|Ga0075419_11420669 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300007076|Ga0075435_101530407 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300009090|Ga0099827_10222207 | All Organisms → cellular organisms → Bacteria | 1578 | Open in IMG/M |
| 3300009090|Ga0099827_10428595 | All Organisms → cellular organisms → Bacteria | 1132 | Open in IMG/M |
| 3300009137|Ga0066709_102323617 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300009147|Ga0114129_10439731 | All Organisms → cellular organisms → Bacteria | 1712 | Open in IMG/M |
| 3300009147|Ga0114129_10598218 | All Organisms → cellular organisms → Bacteria | 1429 | Open in IMG/M |
| 3300009147|Ga0114129_12328503 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300009162|Ga0075423_12178793 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300009168|Ga0105104_10638561 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300009444|Ga0114945_10448894 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300010043|Ga0126380_10489760 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
| 3300010043|Ga0126380_10696730 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
| 3300010043|Ga0126380_12154170 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300010046|Ga0126384_11540177 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300010047|Ga0126382_10729702 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300010336|Ga0134071_10063359 | All Organisms → cellular organisms → Bacteria | 1702 | Open in IMG/M |
| 3300010359|Ga0126376_11728087 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300010359|Ga0126376_12813920 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300010359|Ga0126376_12840914 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300010360|Ga0126372_11212869 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300010360|Ga0126372_11973985 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300010360|Ga0126372_13305208 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300010361|Ga0126378_11892003 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300010362|Ga0126377_11128033 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 853 | Open in IMG/M |
| 3300010362|Ga0126377_11566036 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300010366|Ga0126379_13311103 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300010398|Ga0126383_11794554 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300010398|Ga0126383_12743770 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300010398|Ga0126383_12792134 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300010398|Ga0126383_12836475 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300012189|Ga0137388_10781356 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
| 3300012202|Ga0137363_11265964 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300012204|Ga0137374_10252158 | All Organisms → cellular organisms → Bacteria | 1479 | Open in IMG/M |
| 3300012205|Ga0137362_10970327 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300012207|Ga0137381_10575604 | All Organisms → cellular organisms → Bacteria | 981 | Open in IMG/M |
| 3300012207|Ga0137381_11765608 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300012354|Ga0137366_10296371 | All Organisms → cellular organisms → Bacteria | 1191 | Open in IMG/M |
| 3300012356|Ga0137371_11397511 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300012359|Ga0137385_11258206 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300012361|Ga0137360_11329630 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300012361|Ga0137360_11415008 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300012362|Ga0137361_10217815 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1731 | Open in IMG/M |
| 3300012582|Ga0137358_10838107 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300012925|Ga0137419_10233060 | All Organisms → cellular organisms → Bacteria | 1379 | Open in IMG/M |
| 3300012927|Ga0137416_10802485 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300012927|Ga0137416_11077870 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300012929|Ga0137404_11783232 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300012948|Ga0126375_10448594 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
| 3300012971|Ga0126369_11339429 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
| 3300012977|Ga0134087_10060645 | All Organisms → cellular organisms → Bacteria | 1512 | Open in IMG/M |
| 3300014150|Ga0134081_10031535 | All Organisms → cellular organisms → Bacteria | 1536 | Open in IMG/M |
| 3300014263|Ga0075324_1075246 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300014302|Ga0075310_1069599 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300014310|Ga0075331_1097317 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300015374|Ga0132255_103845485 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300018074|Ga0184640_10391834 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300018079|Ga0184627_10125974 | All Organisms → cellular organisms → Bacteria | 1356 | Open in IMG/M |
| 3300018082|Ga0184639_10218786 | All Organisms → cellular organisms → Bacteria | 1009 | Open in IMG/M |
| 3300018082|Ga0184639_10286098 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
| 3300018082|Ga0184639_10353784 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300018433|Ga0066667_11443053 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300018466|Ga0190268_11732600 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300019233|Ga0184645_1117174 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
| 3300022563|Ga0212128_10072148 | All Organisms → cellular organisms → Bacteria | 2226 | Open in IMG/M |
| 3300025149|Ga0209827_10332347 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300025149|Ga0209827_10924088 | All Organisms → cellular organisms → Bacteria | 2834 | Open in IMG/M |
| 3300025149|Ga0209827_11285285 | All Organisms → cellular organisms → Bacteria | 1328 | Open in IMG/M |
| 3300025927|Ga0207687_10892927 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300026324|Ga0209470_1024718 | All Organisms → cellular organisms → Bacteria | 3177 | Open in IMG/M |
| 3300026534|Ga0256841_1211119 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300027647|Ga0214468_1015433 | All Organisms → cellular organisms → Bacteria | 2121 | Open in IMG/M |
| 3300027835|Ga0209515_10333179 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300027846|Ga0209180_10693477 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| (restricted) 3300027872|Ga0255058_10417872 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300027882|Ga0209590_10626303 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300027903|Ga0209488_10099294 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2180 | Open in IMG/M |
| 3300027903|Ga0209488_10744293 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300027907|Ga0207428_10297222 | All Organisms → cellular organisms → Bacteria | 1195 | Open in IMG/M |
| 3300027950|Ga0209885_1042030 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300028536|Ga0137415_10683342 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 839 | Open in IMG/M |
| 3300030904|Ga0308198_1053009 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300031114|Ga0308187_10051259 | All Organisms → cellular organisms → Bacteria | 1138 | Open in IMG/M |
| 3300031114|Ga0308187_10430149 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300031229|Ga0299913_10945889 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300031421|Ga0308194_10141185 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 734 | Open in IMG/M |
| 3300031879|Ga0306919_10102029 | Not Available | 2020 | Open in IMG/M |
| 3300032180|Ga0307471_100588524 | All Organisms → cellular organisms → Bacteria | 1271 | Open in IMG/M |
| 3300033417|Ga0214471_10613289 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 20.87% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 18.26% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 13.04% |
| Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 4.35% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.35% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.48% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.61% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 2.61% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 2.61% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.61% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.74% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.87% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.87% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.87% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.87% |
| Hydrothermal Vents | Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vents | 0.87% |
| Seawater | Environmental → Aquatic → Marine → Gulf → Unclassified → Seawater | 0.87% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.87% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.87% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.87% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.87% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.87% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.87% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.87% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.87% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.87% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2189573000 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis 0-21cm (T0 for microcosms) | Environmental | Open in IMG/M |
| 3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
| 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300003999 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009444 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014263 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D1 | Environmental | Open in IMG/M |
| 3300014302 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailA_D2 | Environmental | Open in IMG/M |
| 3300014310 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_TuleA_D1 | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300019233 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022563 | OV2_combined assembly | Environmental | Open in IMG/M |
| 3300025149 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026534 | Hydrothermal vent microbial communities from Mid Atlantic Ridge, Atlantic Ocean - 356-308 | Environmental | Open in IMG/M |
| 3300027647 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 HiSeq | Environmental | Open in IMG/M |
| 3300027835 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW60B uncontaminated upgradient, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027872 (restricted) | Seawater microbial communities from Amundsen Gulf, Northwest Territories, Canada - Cases_109_9 | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027950 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_40_50 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300030904 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_202 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033417 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| N55_05444540 | 2189573000 | Grass Soil | QTVRSFPEPDGGALAKLSVMHIANRQFYRDVGWGETHW |
| JGI25384J37096_100624941 | 3300002561 | Grasslands Soil | IVDPQTIRFVFSEPDGGVLVKLSVMHIGNRQFYREVGWGEEHW* |
| JGI25407J50210_101347572 | 3300003373 | Tabebuia Heterophylla Rhizosphere | VSPQIVRFIFPEPDGMALAKLSVMHIANRQFYREFGWDEKSW* |
| Ga0055469_100345632 | 3300003999 | Natural And Restored Wetlands | FKPGSRLEVLDAYTVRFVFPEPDGGALARLTLMHIGNRQFYREFGWDEKSW* |
| Ga0070690_1015431242 | 3300005330 | Switchgrass Rhizosphere | RNTVRFRFPEPDGVALVKLSVMHMASREFYRKAGWGEKHW* |
| Ga0066388_1005811283 | 3300005332 | Tropical Forest Soil | QTVRFIFPEPDGGVLVKLNGLHIGNRQFHTELGWGEKHW* |
| Ga0066388_1039962962 | 3300005332 | Tropical Forest Soil | NFQPGSRLEILDAQTVRFHFPQPDGAALIRLASLHIGNRQFYAELGWGEEHW* |
| Ga0066388_1079372121 | 3300005332 | Tropical Forest Soil | IGPYTVRFVFPEPDGGALAKISFMHMGNRQFYRDVGWGTKDW* |
| Ga0070680_1019460881 | 3300005336 | Corn Rhizosphere | LLEQPHILGNFMNFKPGSKLEILNPYTVRFVFPELDGGALAKLTAMHIGNRQFYREFGWREKSW* |
| Ga0070708_1004959602 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | EIIDPHTVRFVFPEPDGGAMARLVVMHMANRQFHSELGWGEKSW* |
| Ga0070707_1006056072 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | LDPYLVRFVFSEPDGGALVKLSYMHIANRHFYRDLGWGEKSW* |
| Ga0070686_1002887952 | 3300005544 | Switchgrass Rhizosphere | RLEIVDPYTVRFVFPEPDGVALAKISIMHMANRQFYRDVGWGTEHW* |
| Ga0066704_109036992 | 3300005557 | Soil | TMDPYTVRFIFPEPDGGAMAKLASMHMANRQFYREVGWGEAHW* |
| Ga0066708_107769612 | 3300005576 | Soil | QFHFPEPDGAALVRLSALHIGNRQFHTELGWGEAHW* |
| Ga0066903_1003076865 | 3300005764 | Tropical Forest Soil | TVQFHFPEPDGAALMRFAMLHMGNRQFHTELGWGEAHW* |
| Ga0068858_1024608242 | 3300005842 | Switchgrass Rhizosphere | PHILGNFMNFKPGSKLEILNPYTVRFVFPELDGGALAKLTAMHIGNRQFYREFGWREKSW |
| Ga0081455_101646901 | 3300005937 | Tabebuia Heterophylla Rhizosphere | HQSGPHWNFKPGSRLEIHDPYTVRFVFPEPDSGAMARFVLMHMANRQFHRELGWGERNW* |
| Ga0075433_108913682 | 3300006852 | Populus Rhizosphere | LNPYTVRFRFPEPDGGALAKLSIMHIANRQFYREQGWGEKDW* |
| Ga0075420_1015393361 | 3300006853 | Populus Rhizosphere | FIFPEPDGGALVKLALAHIANRQFYRELGWGEKSW* |
| Ga0075425_1020628472 | 3300006854 | Populus Rhizosphere | PYTVRFRFPEPDGGALAKLSIMHIANRQFYREQGWGEKDW* |
| Ga0075425_1030885161 | 3300006854 | Populus Rhizosphere | EIVDPYTVRFVFPEPDGAALIKLSSMHMGNRQFYAEHGWGEKHW* |
| Ga0075429_1019560561 | 3300006880 | Populus Rhizosphere | GARLETIDPYTVRFVFPEPDGGAVAKLTIMHIGNRQFYRESRWGEKSW* |
| Ga0075424_1013616792 | 3300006904 | Populus Rhizosphere | EIVDRQTVRFHFPEPDGVALLKISLLHMASREFYQKVGWGEQHW* |
| Ga0075424_1023193002 | 3300006904 | Populus Rhizosphere | PYTVRFRFPELDGAALAKLSVMHIANRQFYREQGWGEKD* |
| Ga0075419_101538161 | 3300006969 | Populus Rhizosphere | NWDESTRLEQPHRPGPYWNFTPGSRLEILDPYTVRFVFLEPDGGVMARLVLMHIGNRQFYHEFGWGEQSW* |
| Ga0075419_114206692 | 3300006969 | Populus Rhizosphere | VRFVFPEPDGGALARLTLMHIGNRQFYREFGWDEKSW* |
| Ga0075435_1015304072 | 3300007076 | Populus Rhizosphere | GSRLEIIDPQTVRFVFPEPDGGALARLTLMHIGNRQFYSEFGWDEKSW* |
| Ga0099827_102222073 | 3300009090 | Vadose Zone Soil | NFPAGSKLEIITPQTVRFLFPAPDGGALAKLSIMHIANRQFYRDVGWGEAHW* |
| Ga0099827_104285952 | 3300009090 | Vadose Zone Soil | PGSRLEIVDPSTVRFVFPEPDGGALEKISIMHMANRQFYRDVGWGTEHW* |
| Ga0066709_1023236172 | 3300009137 | Grasslands Soil | IDPYMVRFVFPEPDGGALHKLTHMHIANRQFYREFGWGEKRW* |
| Ga0114129_104397313 | 3300009147 | Populus Rhizosphere | RHTVRFSFLEPDGAALVKLSTLHLGNRQFHRELGWGEKHW* |
| Ga0114129_105982181 | 3300009147 | Populus Rhizosphere | NYMNFKPGSRLEILDPYTVRFVLPEPDGGAMAKLTSMHIGNRQFYGEFGWGEKSW* |
| Ga0114129_123285032 | 3300009147 | Populus Rhizosphere | RIEIIDPYTVRFVFSEPDGMALGKLYWMHIANRQFYREFGWGEKHW* |
| Ga0075423_121787932 | 3300009162 | Populus Rhizosphere | YMNFKPGSRLEILDPYTVRFVLPEPDGGAMAKLTSMHIGNRQFYGELGWGEKSW* |
| Ga0105104_106385611 | 3300009168 | Freshwater Sediment | TPQIVRFIFPEPDGGALEKLRAMHIGNRQFYRELGWGEKSW* |
| Ga0114945_104488942 | 3300009444 | Thermal Springs | EIIDRYTVRFSFPEPDGAALVKLSIVHMGNRQFYRELGWGEKGW* |
| Ga0126380_104897601 | 3300010043 | Tropical Forest Soil | QRQPHISGQYMNFPAGSTLEILTPQTVRFRFAEPDGGALAKLSVMHIANRQFYRDVGWGETHW* |
| Ga0126380_106967301 | 3300010043 | Tropical Forest Soil | TVRFVLPEPDGGAMARLVQMHMPNRQFHREFGWGEKSW* |
| Ga0126380_121541702 | 3300010043 | Tropical Forest Soil | VFPEPDGGALARLTLMHIGNRQFYSEFGWDEKSW* |
| Ga0126384_115401772 | 3300010046 | Tropical Forest Soil | YFKPGSRVEIIGPYAVRFVFPEPDGGALAKISFMHMGNRQFYRDVGWGTRDW* |
| Ga0126382_107297021 | 3300010047 | Tropical Forest Soil | LEIIDPYTVRFVLPEPDGAAMARLVLTHMANRQFHRELGWEEKSW* |
| Ga0134071_100633591 | 3300010336 | Grasslands Soil | PHILGQYMNFKPGSKLEIVDPQTIRFVFSEPDGGVLVKLSVMHIGNRQFYREVGWGEEHW |
| Ga0126376_117280871 | 3300010359 | Tropical Forest Soil | GSRLEILDAHTVRFVFPAPDGGALHKLAHMHIANRQFYQEFGWGEKRW* |
| Ga0126376_128139202 | 3300010359 | Tropical Forest Soil | VRFHFPEPDGGALVRLSILHIGNRQFYRELGWGEAHW* |
| Ga0126376_128409141 | 3300010359 | Tropical Forest Soil | VRFIFPEPDGGALAKISLMHLGNRQFYRDVGWGTRDW* |
| Ga0126372_112128691 | 3300010360 | Tropical Forest Soil | VRFVFPEPDGGAVAKLTIMHVGNRQFYREVGWGEKSW* |
| Ga0126372_119739851 | 3300010360 | Tropical Forest Soil | MNFPAGSTLEVLTPQTVRFRFAVPDGGALAKLSVMHIANRQFYRDVGWGETHW* |
| Ga0126372_133052082 | 3300010360 | Tropical Forest Soil | VFGLEIIDAYTVRFVFPEPDGGALARLTLMHLGNRQFYREFGWGEKSW* |
| Ga0126378_118920032 | 3300010361 | Tropical Forest Soil | YTVRFVFPEPDGAALIKLSSMHMGNRQFYAEHGWGEKHW* |
| Ga0126377_111280333 | 3300010362 | Tropical Forest Soil | LEILDAQTVRFIFPTPDGAALAKLSAMHLGNRQFYRDMGWGEKHW* |
| Ga0126377_115660361 | 3300010362 | Tropical Forest Soil | RSGDYWNFKPGSRLEILDAHTVRFVLPEPDGGAMARLVQMHMPNRQFHREFGWGETSW* |
| Ga0126379_133111032 | 3300010366 | Tropical Forest Soil | RFVFPEPDGGVMAKLTIMHMANRQFYREVGWGEKSW* |
| Ga0126383_117945542 | 3300010398 | Tropical Forest Soil | QTLRFVFPEPDGGVLAKLSLLHIGNRQFYRDAGWG* |
| Ga0126383_127437702 | 3300010398 | Tropical Forest Soil | EIIDPYTVRFVFPEPDGCVLAKLTLMHMANRQFYRDVGWGEAHW* |
| Ga0126383_127921342 | 3300010398 | Tropical Forest Soil | HTVRFVFPEPDGGALVKLSILHIGNRQFYRELGWGEKHW* |
| Ga0126383_128364752 | 3300010398 | Tropical Forest Soil | MNFTPGSRLEILDAHTVRLVFPAPDGGALHKLAHMHIANRQFYQEFGWGEKRW* |
| Ga0137388_107813561 | 3300012189 | Vadose Zone Soil | IITPQTVRFLFPAPDGGALSKLSVMHIANRQFYRDVGWGETHW* |
| Ga0137363_112659642 | 3300012202 | Vadose Zone Soil | ETIDPYTVRFVFPEPDGGAVAKLTIMHIGNRQFYGEFGWGEKSW* |
| Ga0137374_102521583 | 3300012204 | Vadose Zone Soil | FKSGSRLEIRDAQTVRFHFPEPDGAALVRLSILHMGNRQFYTELGWGEEHW* |
| Ga0137362_109703272 | 3300012205 | Vadose Zone Soil | TVRFVFPEPDGGALAKISIMHMANRQFYRDVGWGTEHW* |
| Ga0137381_105756042 | 3300012207 | Vadose Zone Soil | VDRYTVRILFPAPDGAALSKLAALHMANRQFYREHGWGEKQW* |
| Ga0137381_117656082 | 3300012207 | Vadose Zone Soil | LNAQTVRFHFPEPDGAALIRLASLHIGNRQFYAELGWGEEHW* |
| Ga0137366_102963712 | 3300012354 | Vadose Zone Soil | SHLEIIDPYTVRFVFPEPDGGALHKLTHMHIANRQFYREFGWGEKRW* |
| Ga0137371_113975111 | 3300012356 | Vadose Zone Soil | PYTVRFVFPEPDGGAMARLVIMHMANRQFHRELGWGEKSW* |
| Ga0137385_112582062 | 3300012359 | Vadose Zone Soil | FVFPEPDGAALIKLSSMHMGNRQFYAEHGWGEKHW* |
| Ga0137360_113296302 | 3300012361 | Vadose Zone Soil | GPYWNFKPGSRLEILDPHTVRFVFSEPDGGAMARLVLMHIGNRQFLHELGWGEKSW* |
| Ga0137360_114150082 | 3300012361 | Vadose Zone Soil | DPHTVRFVFPEPDGAALARLTLMHIGNRQFYHELGWGEASW* |
| Ga0137361_102178151 | 3300012362 | Vadose Zone Soil | VDPYTVRFVFPEPDGAALIKLSSMHMGNRQFYAEHGWGEKHW* |
| Ga0137358_108381072 | 3300012582 | Vadose Zone Soil | GSKLEIITPQTVRFLFSAADGGALAKLSLMHIANRQFYRDVGWGEKHW* |
| Ga0137419_102330603 | 3300012925 | Vadose Zone Soil | MNFKLGSLLEILDAQTVRFHFPEPDGAALVRLSMLHIGNRQFYTELGWGEAHW* |
| Ga0137416_108024852 | 3300012927 | Vadose Zone Soil | FIFPEPDGAALTKLSAMHLGNRQFYRDVGWGEKHW* |
| Ga0137416_110778702 | 3300012927 | Vadose Zone Soil | YTVRFIFPEPDGAVLTKFSIMHIGNRQFYREVGWGEKRW* |
| Ga0137404_117832321 | 3300012929 | Vadose Zone Soil | TIRFHFPEPDGAALARLSYIHIANRQFFREFGWGEKHW* |
| Ga0126375_104485941 | 3300012948 | Tropical Forest Soil | LTPQTVRFRFAAPDSGALAKFSLMHIANRQFYRDVGWGETHW* |
| Ga0126369_113394292 | 3300012971 | Tropical Forest Soil | MPGAYLNFQPGSRLEIVNAQTVRFHFREPDGGVLAKLVYLHIGNRQFYSEFGWGEESW* |
| Ga0134087_100606451 | 3300012977 | Grasslands Soil | TIRFHFAEPDGAALARLSYMHIANRQFFREFGWGEKHW* |
| Ga0134081_100315351 | 3300014150 | Grasslands Soil | RFHFAEPDGAALARLSYMHIANRQFFREFGWGEKHW* |
| Ga0075324_10752461 | 3300014263 | Natural And Restored Wetlands | PYTVRFVFAEPDGGALAKLTIMHIGNREFYREFGWGEKSW* |
| Ga0075310_10695992 | 3300014302 | Natural And Restored Wetlands | SRMEIIGSHTVRFIFPEPDGGALAKLTIMHIANRQFYQDVGWGTEHW* |
| Ga0075331_10973171 | 3300014310 | Natural And Restored Wetlands | VRFIFPQPDGAALLKLSSMHIGNRQFYAEHGWGEKHW* |
| Ga0132255_1038454851 | 3300015374 | Arabidopsis Rhizosphere | PYTVRFHFLEPDGGVLAKLVYMHIGNRQFLREFDWEEKGW* |
| Ga0184640_103918341 | 3300018074 | Groundwater Sediment | MNFKPGSRIEILDPYTVRFLFSEPDGAALIKIGWMHIGNREFYQKLGWGEKSW |
| Ga0184627_101259741 | 3300018079 | Groundwater Sediment | EILDPHTVRLVFPEPDGGALAKLSSVHIANRQFYRDFGWGEKSW |
| Ga0184639_102187861 | 3300018082 | Groundwater Sediment | PRTVRFVFSEPDGAALIKIAWMHIANRQFYREFGWGEKHW |
| Ga0184639_102860982 | 3300018082 | Groundwater Sediment | DPQTVRFVFPEPDGGALSKITFMHMTNRQFYRDVGWGTENW |
| Ga0184639_103537842 | 3300018082 | Groundwater Sediment | EIVDPQTIRFSFPAPDGGALVKIAVMHIANRQFYREVGWGEEHW |
| Ga0066667_114430532 | 3300018433 | Grasslands Soil | VNFKLGSRLEIRDAQTVRFHFPAPDGAALVRLSILHMGNRQFYTELGWGEEHW |
| Ga0190268_117326001 | 3300018466 | Soil | PYTVSFVFPETDGGALAKISMMHLANRQFYRDVGWGTEHW |
| Ga0184645_11171742 | 3300019233 | Groundwater Sediment | MTFKPGSRLEIVTPQSVRFIFPEPDGGALAKLVVMHLGNRQFYRELGWGEKSW |
| Ga0212128_100721484 | 3300022563 | Thermal Springs | MNFKPESRLEIRDPQTVRFVFSEPDGAALVKLMRMHLGNRQFYRDLGWREKGW |
| Ga0209827_103323472 | 3300025149 | Thermal Springs | EVLDPYTVRFVFPEPDGAALAKLSLMHIANRQFYRDVGWGEKRW |
| Ga0209827_109240881 | 3300025149 | Thermal Springs | RFVFPEPDGRALTKFRAMHMANRQFYREFGWGEKSW |
| Ga0209827_112852851 | 3300025149 | Thermal Springs | PYTVRFMFPEPDGGALAKLTAMHIGNRQFYREFGWGEKSW |
| Ga0207684_114281451 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | RLKQPHIPGEFLNFKPGSKLEILDPYLVRFVFSEPDGGALVKLSYMHIANRHFYRDLGWGEKSW |
| Ga0207687_108929271 | 3300025927 | Miscanthus Rhizosphere | GSKLEILNPYTVRFVFPELDGGALAKLTAMHIGNRQFYREFGWREKSW |
| Ga0209470_10247182 | 3300026324 | Soil | MEIRDPYTIRFHFAEPDGAALARLSYMHIANRQFFREFGWGEKHW |
| Ga0256841_12111192 | 3300026534 | Hydrothermal Vents | LQIIDPYTVRFRFPEPDGGALAKLTIMHMANRQFYHELGWGEKHW |
| Ga0214468_10154333 | 3300027647 | Soil | NFKPGSKLEILDPYTVRFVFAEPDGGALAKLTIMHIGNREFYREFGWGEKSW |
| Ga0209515_103331791 | 3300027835 | Groundwater | RLELIDPYTVRFVFPEPDGGALAKLTAMHIGNRQFYREFGWGEKSW |
| Ga0209180_106934772 | 3300027846 | Vadose Zone Soil | SRLEIIDPQTVRFIFPESDGAVLAKLSIMHIGNRQFYQELGWGERSW |
| (restricted) Ga0255058_104178721 | 3300027872 | Seawater | QPHMLGSYMNFKPGSRLEIVDPYTIRFFFSEPDGGVIAKLIAMHIGNRQFYRELGWGEEH |
| Ga0209590_106263032 | 3300027882 | Vadose Zone Soil | RVEVIDPYTVRFVFPEPDGGALAKISFIHMGNRQFYRDVGWGTRDW |
| Ga0209488_100992943 | 3300027903 | Vadose Zone Soil | FHFPTPDGMALVKLSSMHIGSRQFWAEHGWGEQSW |
| Ga0209488_107442932 | 3300027903 | Vadose Zone Soil | GDYWNFKPGSRLEILDPHTVRFVLPEPDGGAMARLVQMHMPNRQFHREFGWGEKSW |
| Ga0207428_102972221 | 3300027907 | Populus Rhizosphere | LGQPHISGAFMNFTPGSRLEILDAQTVRFIFPAPDGAALAKLSAMHLGNRQFYRDMGWGEKHW |
| Ga0209885_10420301 | 3300027950 | Groundwater Sand | DAHTVRFVFPEPDGAALARISFMHIGSRQFYRELGWGDKHW |
| Ga0137415_106833422 | 3300028536 | Vadose Zone Soil | FVFPEPDGAALARLTLMHIGNRQFYHELGWGEASW |
| Ga0308198_10530091 | 3300030904 | Soil | DLYTVRFVFPEPDGGALAKISMMHMGNRQFYRDVGWGTKDW |
| Ga0308187_100512592 | 3300031114 | Soil | FIFPEPDGGAMAKLASMHMANSQFYREFGWGEKHW |
| Ga0308187_104301491 | 3300031114 | Soil | RFVFPEPDGGALVKLSNMHIANRQFYREFGWGEKSW |
| Ga0299913_109458892 | 3300031229 | Soil | GSRLEISDPYTIRFVLPEPDGGLLAKLSMLHIASRQFYRDFGWGEKSW |
| Ga0308194_101411851 | 3300031421 | Soil | RFVFPQPDGGALAKIGIMHMANRQFYRDVGWGTEHW |
| Ga0306919_101020292 | 3300031879 | Soil | FVFPEPDGGALHKLTHMHIANRQFYREFGWGEKRW |
| Ga0307471_1005885241 | 3300032180 | Hardwood Forest Soil | KAGSRMEVIDPHTVRLVFSEPDGMALGKLTWMHIGNRQFYRELGWGEQHW |
| Ga0214471_106132892 | 3300033417 | Soil | PGSRLEVLDPYTVRFVFPEPDGGAMARLVNTHMANRQFHRDFGWGEKSW |
| ⦗Top⦘ |