


| Basic Information | |
|---|---|
| Family ID | F079500 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 115 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MKTLIHFSRSGDSYFRAHPHHTLFSLVVSFVLAVLAVLIFTVSAK |
| Number of Associated Samples | 85 |
| Number of Associated Scaffolds | 115 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 86.96 % |
| % of genes near scaffold ends (potentially truncated) | 20.00 % |
| % of genes from short scaffolds (< 2000 bps) | 59.13 % |
| Associated GOLD sequencing projects | 74 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (86.957 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil (32.174 % of family members) |
| Environment Ontology (ENVO) | Unclassified (72.174 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.087 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.47% β-sheet: 0.00% Coil/Unstructured: 57.53% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 115 Family Scaffolds |
|---|---|---|
| PF11154 | DUF2934 | 28.70 |
| PF02353 | CMAS | 6.96 |
| PF08543 | Phos_pyr_kin | 3.48 |
| PF00501 | AMP-binding | 2.61 |
| PF04879 | Molybdop_Fe4S4 | 2.61 |
| PF10431 | ClpB_D2-small | 2.61 |
| PF00034 | Cytochrom_C | 1.74 |
| PF13180 | PDZ_2 | 1.74 |
| PF13683 | rve_3 | 1.74 |
| PF00072 | Response_reg | 0.87 |
| PF13191 | AAA_16 | 0.87 |
| PF02604 | PhdYeFM_antitox | 0.87 |
| PF00730 | HhH-GPD | 0.87 |
| PF04471 | Mrr_cat | 0.87 |
| PF00582 | Usp | 0.87 |
| PF00196 | GerE | 0.87 |
| PF01329 | Pterin_4a | 0.87 |
| PF02446 | Glyco_hydro_77 | 0.87 |
| PF13776 | DUF4172 | 0.87 |
| PF00571 | CBS | 0.87 |
| PF07733 | DNA_pol3_alpha | 0.87 |
| PF02163 | Peptidase_M50 | 0.87 |
| PF00486 | Trans_reg_C | 0.87 |
| PF01751 | Toprim | 0.87 |
| PF00266 | Aminotran_5 | 0.87 |
| PF12779 | WXXGXW | 0.87 |
| PF00625 | Guanylate_kin | 0.87 |
| PF12679 | ABC2_membrane_2 | 0.87 |
| PF01590 | GAF | 0.87 |
| PF04015 | DUF362 | 0.87 |
| PF02452 | PemK_toxin | 0.87 |
| PF02321 | OEP | 0.87 |
| PF07676 | PD40 | 0.87 |
| PF00374 | NiFeSe_Hases | 0.87 |
| PF13533 | Biotin_lipoyl_2 | 0.87 |
| PF14534 | DUF4440 | 0.87 |
| PF03070 | TENA_THI-4 | 0.87 |
| PF13450 | NAD_binding_8 | 0.87 |
| PF08240 | ADH_N | 0.87 |
| PF13442 | Cytochrome_CBB3 | 0.87 |
| PF02899 | Phage_int_SAM_1 | 0.87 |
| PF13193 | AMP-binding_C | 0.87 |
| PF09285 | Elong-fact-P_C | 0.87 |
| COG ID | Name | Functional Category | % Frequency in 115 Family Scaffolds |
|---|---|---|---|
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 6.96 |
| COG2227 | 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase | Coenzyme transport and metabolism [H] | 6.96 |
| COG2230 | Cyclopropane fatty-acyl-phospholipid synthase and related methyltransferases | Lipid transport and metabolism [I] | 6.96 |
| COG0351 | Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase | Coenzyme transport and metabolism [H] | 3.48 |
| COG0524 | Sugar or nucleoside kinase, ribokinase family | Carbohydrate transport and metabolism [G] | 3.48 |
| COG2240 | Pyridoxal/pyridoxine/pyridoxamine kinase | Coenzyme transport and metabolism [H] | 3.48 |
| COG2870 | ADP-heptose synthase, bifunctional sugar kinase/adenylyltransferase | Cell wall/membrane/envelope biogenesis [M] | 3.48 |
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 1.74 |
| COG0122 | 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.87 |
| COG0177 | Endonuclease III | Replication, recombination and repair [L] | 0.87 |
| COG0194 | Guanylate kinase | Nucleotide transport and metabolism [F] | 0.87 |
| COG0374 | Ni,Fe-hydrogenase I large subunit | Energy production and conversion [C] | 0.87 |
| COG0587 | DNA polymerase III, alpha subunit | Replication, recombination and repair [L] | 0.87 |
| COG1059 | Thermostable 8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.87 |
| COG1194 | Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairs | Replication, recombination and repair [L] | 0.87 |
| COG1640 | 4-alpha-glucanotransferase | Carbohydrate transport and metabolism [G] | 0.87 |
| COG2006 | Uncharacterized conserved protein, DUF362 family | Function unknown [S] | 0.87 |
| COG2154 | Pterin-4a-carbinolamine dehydratase | Coenzyme transport and metabolism [H] | 0.87 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.87 |
| COG2176 | DNA polymerase III, alpha subunit (gram-positive type) | Replication, recombination and repair [L] | 0.87 |
| COG2231 | 3-Methyladenine DNA glycosylase, HhH-GPD/Endo3 superfamily | Replication, recombination and repair [L] | 0.87 |
| COG2337 | mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin module | Defense mechanisms [V] | 0.87 |
| COG3259 | Coenzyme F420-reducing hydrogenase, alpha subunit | Energy production and conversion [C] | 0.87 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.87 |
| COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 0.87 |
| COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 0.87 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 86.96 % |
| Unclassified | root | N/A | 13.04 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000567|JGI12270J11330_10007338 | All Organisms → cellular organisms → Bacteria | 7621 | Open in IMG/M |
| 3300000567|JGI12270J11330_10020032 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 4156 | Open in IMG/M |
| 3300000567|JGI12270J11330_10020628 | All Organisms → cellular organisms → Bacteria | 4085 | Open in IMG/M |
| 3300000567|JGI12270J11330_10025231 | All Organisms → cellular organisms → Bacteria | 3582 | Open in IMG/M |
| 3300000567|JGI12270J11330_10112396 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 1140 | Open in IMG/M |
| 3300001356|JGI12269J14319_10000505 | All Organisms → cellular organisms → Bacteria | 37466 | Open in IMG/M |
| 3300004473|Ga0068919_1373103 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 646 | Open in IMG/M |
| 3300006050|Ga0075028_100498754 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 710 | Open in IMG/M |
| 3300006102|Ga0075015_100322042 | Not Available | 856 | Open in IMG/M |
| 3300006162|Ga0075030_100027734 | All Organisms → cellular organisms → Bacteria | 4842 | Open in IMG/M |
| 3300009518|Ga0116128_1007088 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4143 | Open in IMG/M |
| 3300009519|Ga0116108_1004718 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5995 | Open in IMG/M |
| 3300009519|Ga0116108_1067974 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1106 | Open in IMG/M |
| 3300009519|Ga0116108_1170287 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 644 | Open in IMG/M |
| 3300009520|Ga0116214_1037113 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1761 | Open in IMG/M |
| 3300009521|Ga0116222_1011312 | All Organisms → cellular organisms → Bacteria | 4192 | Open in IMG/M |
| 3300009522|Ga0116218_1389508 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 622 | Open in IMG/M |
| 3300009523|Ga0116221_1417528 | Not Available | 584 | Open in IMG/M |
| 3300009525|Ga0116220_10000433 | All Organisms → cellular organisms → Bacteria | 16388 | Open in IMG/M |
| 3300009548|Ga0116107_1158895 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 618 | Open in IMG/M |
| 3300009616|Ga0116111_1003497 | All Organisms → cellular organisms → Bacteria | 8607 | Open in IMG/M |
| 3300009616|Ga0116111_1028898 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1811 | Open in IMG/M |
| 3300009629|Ga0116119_1050436 | All Organisms → cellular organisms → Bacteria | 1079 | Open in IMG/M |
| 3300009630|Ga0116114_1025043 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1777 | Open in IMG/M |
| 3300009631|Ga0116115_1183769 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
| 3300009632|Ga0116102_1006597 | All Organisms → cellular organisms → Bacteria | 4382 | Open in IMG/M |
| 3300009634|Ga0116124_1024024 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1936 | Open in IMG/M |
| 3300009644|Ga0116121_1123096 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 816 | Open in IMG/M |
| 3300009672|Ga0116215_1022850 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2907 | Open in IMG/M |
| 3300009698|Ga0116216_10702000 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 608 | Open in IMG/M |
| 3300009700|Ga0116217_10889246 | Not Available | 547 | Open in IMG/M |
| 3300009762|Ga0116130_1177716 | Not Available | 673 | Open in IMG/M |
| 3300009764|Ga0116134_1197440 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 701 | Open in IMG/M |
| 3300009824|Ga0116219_10151392 | All Organisms → cellular organisms → Bacteria | 1342 | Open in IMG/M |
| 3300009839|Ga0116223_10116733 | All Organisms → cellular organisms → Bacteria | 1678 | Open in IMG/M |
| 3300010339|Ga0074046_10160459 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1430 | Open in IMG/M |
| 3300010343|Ga0074044_10004122 | All Organisms → cellular organisms → Bacteria | 12128 | Open in IMG/M |
| 3300010379|Ga0136449_100096748 | All Organisms → cellular organisms → Bacteria | 6091 | Open in IMG/M |
| 3300010379|Ga0136449_100286880 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3016 | Open in IMG/M |
| 3300010379|Ga0136449_102580251 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 726 | Open in IMG/M |
| 3300011064|Ga0138525_1073252 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 945 | Open in IMG/M |
| 3300011074|Ga0138559_1130111 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1438 | Open in IMG/M |
| 3300014151|Ga0181539_1000007 | All Organisms → cellular organisms → Bacteria | 183631 | Open in IMG/M |
| 3300014164|Ga0181532_10151299 | Not Available | 1395 | Open in IMG/M |
| 3300014165|Ga0181523_10006283 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 9541 | Open in IMG/M |
| 3300014502|Ga0182021_10001939 | All Organisms → cellular organisms → Bacteria | 24146 | Open in IMG/M |
| 3300016702|Ga0181511_1497242 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1040 | Open in IMG/M |
| 3300016750|Ga0181505_10542994 | Not Available | 717 | Open in IMG/M |
| 3300017823|Ga0187818_10007670 | All Organisms → cellular organisms → Bacteria | 4618 | Open in IMG/M |
| 3300017823|Ga0187818_10039278 | All Organisms → cellular organisms → Bacteria | 2032 | Open in IMG/M |
| 3300017823|Ga0187818_10040879 | All Organisms → cellular organisms → Bacteria | 1992 | Open in IMG/M |
| 3300017823|Ga0187818_10068571 | All Organisms → cellular organisms → Bacteria | 1527 | Open in IMG/M |
| 3300017823|Ga0187818_10074595 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1461 | Open in IMG/M |
| 3300017823|Ga0187818_10503831 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 543 | Open in IMG/M |
| 3300017925|Ga0187856_1200057 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 724 | Open in IMG/M |
| 3300017931|Ga0187877_1008188 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6977 | Open in IMG/M |
| 3300017931|Ga0187877_1014722 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4534 | Open in IMG/M |
| 3300017932|Ga0187814_10093704 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1107 | Open in IMG/M |
| 3300017934|Ga0187803_10013125 | All Organisms → cellular organisms → Bacteria | 3312 | Open in IMG/M |
| 3300017938|Ga0187854_10033236 | All Organisms → cellular organisms → Bacteria | 2705 | Open in IMG/M |
| 3300017938|Ga0187854_10203440 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 874 | Open in IMG/M |
| 3300017940|Ga0187853_10336364 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 676 | Open in IMG/M |
| 3300017943|Ga0187819_10126980 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1522 | Open in IMG/M |
| 3300017943|Ga0187819_10142382 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1429 | Open in IMG/M |
| 3300017943|Ga0187819_10873728 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 504 | Open in IMG/M |
| 3300017955|Ga0187817_10431584 | Not Available | 841 | Open in IMG/M |
| 3300017959|Ga0187779_10000148 | All Organisms → cellular organisms → Bacteria | 52649 | Open in IMG/M |
| 3300017966|Ga0187776_10076765 | Not Available | 1947 | Open in IMG/M |
| 3300017995|Ga0187816_10501737 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
| 3300017996|Ga0187891_1035982 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2180 | Open in IMG/M |
| 3300018003|Ga0187876_1024664 | All Organisms → cellular organisms → Bacteria | 2771 | Open in IMG/M |
| 3300018004|Ga0187865_1153150 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 807 | Open in IMG/M |
| 3300018008|Ga0187888_1280377 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 644 | Open in IMG/M |
| 3300018012|Ga0187810_10104445 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1115 | Open in IMG/M |
| 3300018016|Ga0187880_1082876 | Not Available | 1618 | Open in IMG/M |
| 3300018021|Ga0187882_1153379 | Not Available | 934 | Open in IMG/M |
| 3300018025|Ga0187885_10033407 | All Organisms → cellular organisms → Bacteria | 2765 | Open in IMG/M |
| 3300018025|Ga0187885_10112133 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1316 | Open in IMG/M |
| 3300018025|Ga0187885_10392983 | Not Available | 622 | Open in IMG/M |
| 3300018033|Ga0187867_10186446 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1183 | Open in IMG/M |
| 3300018042|Ga0187871_10065896 | Not Available | 2137 | Open in IMG/M |
| 3300018086|Ga0187769_10045383 | All Organisms → cellular organisms → Bacteria | 3035 | Open in IMG/M |
| 3300018086|Ga0187769_10063820 | All Organisms → cellular organisms → Bacteria | 2585 | Open in IMG/M |
| 3300018088|Ga0187771_10359035 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1226 | Open in IMG/M |
| 3300018089|Ga0187774_10003830 | All Organisms → cellular organisms → Bacteria | 5323 | Open in IMG/M |
| 3300018090|Ga0187770_10893113 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 713 | Open in IMG/M |
| 3300018090|Ga0187770_11272571 | Not Available | 596 | Open in IMG/M |
| 3300019082|Ga0187852_1256786 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 705 | Open in IMG/M |
| 3300019284|Ga0187797_1025799 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 513 | Open in IMG/M |
| 3300023090|Ga0224558_1024256 | All Organisms → cellular organisms → Bacteria | 2957 | Open in IMG/M |
| 3300025442|Ga0208034_1033742 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 1203 | Open in IMG/M |
| 3300025500|Ga0208686_1118305 | Not Available | 551 | Open in IMG/M |
| 3300027394|Ga0209904_1000054 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Fervidibacteria | 9308 | Open in IMG/M |
| 3300027568|Ga0208042_1012493 | All Organisms → cellular organisms → Bacteria | 2229 | Open in IMG/M |
| 3300027570|Ga0208043_1003701 | All Organisms → cellular organisms → Bacteria | 5474 | Open in IMG/M |
| 3300027604|Ga0208324_1021834 | All Organisms → cellular organisms → Bacteria | 1969 | Open in IMG/M |
| 3300027641|Ga0208827_1000144 | All Organisms → cellular organisms → Bacteria | 53542 | Open in IMG/M |
| 3300027696|Ga0208696_1010178 | All Organisms → cellular organisms → Bacteria | 3877 | Open in IMG/M |
| 3300027696|Ga0208696_1092018 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1013 | Open in IMG/M |
| 3300027854|Ga0209517_10001459 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 35767 | Open in IMG/M |
| 3300027854|Ga0209517_10002616 | All Organisms → cellular organisms → Bacteria | 25116 | Open in IMG/M |
| 3300027854|Ga0209517_10015427 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7683 | Open in IMG/M |
| 3300027854|Ga0209517_10195080 | Not Available | 1255 | Open in IMG/M |
| 3300027902|Ga0209048_10433201 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 898 | Open in IMG/M |
| 3300027911|Ga0209698_10020925 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 6205 | Open in IMG/M |
| 3300027911|Ga0209698_11331451 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 525 | Open in IMG/M |
| 3300028646|Ga0302159_10046280 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 958 | Open in IMG/M |
| 3300028774|Ga0302208_10005964 | All Organisms → cellular organisms → Bacteria | 4322 | Open in IMG/M |
| 3300030659|Ga0316363_10130399 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1092 | Open in IMG/M |
| 3300030707|Ga0310038_10428237 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 571 | Open in IMG/M |
| 3300032160|Ga0311301_10180100 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3697 | Open in IMG/M |
| 3300032160|Ga0311301_10216445 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3242 | Open in IMG/M |
| 3300032160|Ga0311301_11202464 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 971 | Open in IMG/M |
| 3300033433|Ga0326726_10001002 | All Organisms → cellular organisms → Bacteria | 26201 | Open in IMG/M |
| 3300033433|Ga0326726_10816582 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 903 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 32.17% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 17.39% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 14.78% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 12.17% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 6.96% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.35% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.61% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.74% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.74% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.74% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.87% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.87% |
| Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.87% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.87% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.87% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300004473 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
| 3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009548 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100 | Environmental | Open in IMG/M |
| 3300009616 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 | Environmental | Open in IMG/M |
| 3300009629 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100 | Environmental | Open in IMG/M |
| 3300009630 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40 | Environmental | Open in IMG/M |
| 3300009631 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 | Environmental | Open in IMG/M |
| 3300009632 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 | Environmental | Open in IMG/M |
| 3300009634 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 | Environmental | Open in IMG/M |
| 3300009644 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009762 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40 | Environmental | Open in IMG/M |
| 3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011064 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 2 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011074 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 40 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300014151 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaG | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300016702 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017925 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40 | Environmental | Open in IMG/M |
| 3300017931 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
| 3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300017996 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_40 | Environmental | Open in IMG/M |
| 3300018003 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_40 | Environmental | Open in IMG/M |
| 3300018004 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100 | Environmental | Open in IMG/M |
| 3300018008 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018016 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40 | Environmental | Open in IMG/M |
| 3300018021 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150 | Environmental | Open in IMG/M |
| 3300018025 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100 | Environmental | Open in IMG/M |
| 3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300019082 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_40 | Environmental | Open in IMG/M |
| 3300019284 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023090 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24 | Environmental | Open in IMG/M |
| 3300025442 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025500 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300027394 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 712P3D | Environmental | Open in IMG/M |
| 3300027568 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027570 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027696 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027902 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028646 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_2 | Environmental | Open in IMG/M |
| 3300028774 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E2_3 | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12270J11330_100073388 | 3300000567 | Peatlands Soil | MKTQMHFSRSGDSYFRAHPHHTLFSFVVSFVLAVLAVLIFAVSAK* |
| JGI12270J11330_100200321 | 3300000567 | Peatlands Soil | MRTLEHFRRSGDRHFHAHPFHTLFALVAGFVLAVLAVLILTVPAK* |
| JGI12270J11330_100206283 | 3300000567 | Peatlands Soil | MKTLTHSRFGDSDFREHPFHTLFLLVVGFVLAILAVLILTVPAK* |
| JGI12270J11330_100252313 | 3300000567 | Peatlands Soil | MKTLTHSGDSYFRAHPHHTLFSLVVSFVLAVLAVLLFTVSAK* |
| JGI12270J11330_101123961 | 3300000567 | Peatlands Soil | MGTLEHFRRSGDSHFHAHPFHTLFALVAGFVLAVLAVLILTVPAR* |
| JGI12269J14319_1000050523 | 3300001356 | Peatlands Soil | MMKTLTHLSRSGDSYFRAHPHHTLFSLVVSFVLAVLAVLIFTVSAK* |
| Ga0068919_13731031 | 3300004473 | Peatlands Soil | MKTLTHSGDSYFRAHPHHTLFSLVVSFVLAVLAVLIFTVSAK* |
| Ga0075028_1004987542 | 3300006050 | Watersheds | FRRPGYSYFRVHPLHTLFSLVASFVLAVLAVLILTVPAK* |
| Ga0075015_1003220422 | 3300006102 | Watersheds | VKTLIHSRRPGYSYFRVHPLHTLFSLVASFVLAVLAVLILTVPAK* |
| Ga0075030_1000277345 | 3300006162 | Watersheds | MRTLEHFRSSGDSHFHAHPYHSLFAVVAGFVLTVLAMLILTVPAK* |
| Ga0116128_10070883 | 3300009518 | Peatland | MKTVMHFSRSGDSYSRAHPHHTLFSLVVSFVLAVLAVLIFTVSAK* |
| Ga0116108_10047184 | 3300009519 | Peatland | MKTLIHFGRSGDSAFRAHPHHSLFSLVVSFVLAVLAVLILAVSAK* |
| Ga0116108_10679742 | 3300009519 | Peatland | MKTLTHFSGSGESHFRAHPFHTLFLLVVSLVLAILAVLIFTVPAK* |
| Ga0116108_11702872 | 3300009519 | Peatland | MKTLTHFSRSGDSHFREHPFHTLFLLVVGFVLAILAVLIFAVPAK* |
| Ga0116214_10371132 | 3300009520 | Peatlands Soil | MKTLTHLSRSGDSYFRAHPHHTLFSLVVSFVLAVLAVLIFTVSAK* |
| Ga0116222_10113122 | 3300009521 | Peatlands Soil | MKTLTHFGRSGDSYFRAHPHHTLFSLLVSFVLAVLAVLIFTVSAK* |
| Ga0116218_13895081 | 3300009522 | Peatlands Soil | MKSLEHFRRSGDSHFHAHPFHTLFALVAGFVLAVLAVLILAVPAK* |
| Ga0116221_14175281 | 3300009523 | Peatlands Soil | MRTLEHFRRSGDSHFHAHPFHILFVLVAGFVLAVLAVLILT |
| Ga0116220_1000043319 | 3300009525 | Peatlands Soil | MKALTHFSKSGDSYFRAHPHHTLFSLVVSFVLAVLAVLIFTVSAK* |
| Ga0116107_11588952 | 3300009548 | Peatland | SGDSAFRAHPHHSLFSLVVSFVLAVLAVLILAVSAK* |
| Ga0116111_10034974 | 3300009616 | Peatland | MRTLEHFMRSGDSHFHAHPFHTLFALVAGFVLAVLAVLILTVPAR* |
| Ga0116111_10288981 | 3300009616 | Peatland | MKTVMHFSRSGDSYSRAHLYDTLFSLVVSFVLAVLAVLIFTVSAK* |
| Ga0116119_10504362 | 3300009629 | Peatland | MKTLTHFSGSGESHFRAHPFHTLFLLVVSLVLAILAVLIFAVPAK* |
| Ga0116114_10250432 | 3300009630 | Peatland | MKTMTHFSRSGDSHFREHPFHTLFLLVVGFVLAILAVLIFAVPAK* |
| Ga0116115_11837691 | 3300009631 | Peatland | KTLTHFSRSGDSHFREHPFHTLFLLVVGFVLAILAVLIFAVPAK* |
| Ga0116102_10065973 | 3300009632 | Peatland | MKTLIHFSRSGDSYFRAHPHHTLFSLVVSFVLAVLAVLIFTVSAK* |
| Ga0116124_10240243 | 3300009634 | Peatland | MKTLIHFSRSGDSYSRAHPHHTLFSLVVSFVLAVLAVLIFTVSAK* |
| Ga0116121_11230962 | 3300009644 | Peatland | MKTPTHFSSSSDSRFHAHPLHPLFSLVVSFVLAVLAVLIFAVSAK* |
| Ga0116215_10228503 | 3300009672 | Peatlands Soil | MKTLTHFGRSGDSYFRAHPHHTLFSLLVSFVLAVLAVLLFTVSAK* |
| Ga0116216_107020002 | 3300009698 | Peatlands Soil | MKTLEHFRRSGDSHFHAHPFHTLFALVAGFVLAVLAVLILTVPAR* |
| Ga0116217_108892461 | 3300009700 | Peatlands Soil | MKTLIHFSRSGDSYFRAHPHHTLFSLVVSFVLAVLAVLIFTV |
| Ga0116130_11777161 | 3300009762 | Peatland | MKTLTHFSRSGDSHFREHPFHTLFLLVVGFVLAILAVL |
| Ga0116134_11974402 | 3300009764 | Peatland | GDSHFREHPFHTLFLLVVGFVLAILAVLIFAVPAK* |
| Ga0116219_101513921 | 3300009824 | Peatlands Soil | LEHFRRSGDSHFHAHPFHILFVLVAGFVLAVLAVLILTVPAK* |
| Ga0116223_101167332 | 3300009839 | Peatlands Soil | MKTPTHFSSSSDSHFRAHPLHPLFSLVVSFVLAVLAVLIFAVSAK* |
| Ga0074046_101604591 | 3300010339 | Bog Forest Soil | MKTLLHFGRSGDCFSRAHSYHNLFSLVVPFVLAVLAVLILAVTAK* |
| Ga0074044_100041227 | 3300010343 | Bog Forest Soil | MRTLEHFRRSGDSHFHAHPFHTVFVLVAGFVLAVLAVLTFTVSAR* |
| Ga0136449_1000967487 | 3300010379 | Peatlands Soil | MRTLEHFRRSDDRNFHAHPLHTLFALVAGFVLAVLAVLILTVPAR* |
| Ga0136449_1002868803 | 3300010379 | Peatlands Soil | MRTPGHFRSSGDSHFHAHPFHTLFALVAGFVLTVLAMLILTVPAK* |
| Ga0136449_1025802512 | 3300010379 | Peatlands Soil | MKTLTHLSRSGDSYFRAHPHHTLFSLVVSFVLTVLAVLIFAVSAK* |
| Ga0138525_10732522 | 3300011064 | Peatlands Soil | HRRLIMKALTHFSKSGDSYFRAHPHHTLFSLVVSFVLAVLAVLIFTVSAK* |
| Ga0138559_11301111 | 3300011074 | Peatlands Soil | MKALTHFSKSGDSYFRAHPHHTLFSLVVSFVLAVLAVLLFTVSAK* |
| Ga0181539_1000007131 | 3300014151 | Bog | MKTVMHSSRSDDSYSRAHPHHTLFSLVVSFVLAVLAVLIFTVSAK* |
| Ga0181532_101512992 | 3300014164 | Bog | MKTLIHLGKSGDSCFRAHPYHNLFSLVISFVLAVLAVLILAVTAK* |
| Ga0181523_100062832 | 3300014165 | Bog | MKTLIHFGKSGDSCFRAHPHHNLFSLVISFVLAVLAVLILAVTAK* |
| Ga0182021_100019397 | 3300014502 | Fen | MNLLMHFRRSGDSFFHAHPFHNLLSLVVSFVLVVFAVLILTVSAK* |
| Ga0181511_14972422 | 3300016702 | Peatland | MKTLLHFGRSGDCFSRAHSYHNLFSLVVPFVLAILAVLILAVTAK |
| Ga0181505_105429942 | 3300016750 | Peatland | MKTLIHLGKSGDSCFRAHPYHNLFSLVISFVLAVLAVLILAVTAK |
| Ga0187818_100076705 | 3300017823 | Freshwater Sediment | MRTLEHFRRSDDRNFHAHPFHTLFALVAGFVLAVLAVLILTVPAR |
| Ga0187818_100392783 | 3300017823 | Freshwater Sediment | MKTLTHFSRSGDSYFRPHPHHTLFSLVVTFVLAVLAVLIFTVSAK |
| Ga0187818_100408793 | 3300017823 | Freshwater Sediment | MRTLEHFRRSGDSHFHAHPFHTLFALVAGFVLAVLAVLILTVPAR |
| Ga0187818_100685712 | 3300017823 | Freshwater Sediment | WGVVVKPLIHFSKPGDSYFRAHPLQTVFSLVAAFVLAVLAVLILAVPAK |
| Ga0187818_100745952 | 3300017823 | Freshwater Sediment | MRLEHRRSGGSHFHAHPFHTLFVLVAGFVLVVLAVLILTVPAK |
| Ga0187818_105038311 | 3300017823 | Freshwater Sediment | MKTVMHFSRSGDTYSRAHPHHTLFSLAVSFVLAVLAVLIFTVSAK |
| Ga0187856_12000572 | 3300017925 | Peatland | MKTLTHFSGSGESHFRAHPFHTLFLLVVSLVLAILAVLIFTVPAK |
| Ga0187877_10081882 | 3300017931 | Peatland | MKTVMHFSRSGDSYSRAHPHHTLFSLVVSFVLAVLAVLIFTVSAK |
| Ga0187877_10147226 | 3300017931 | Peatland | MKTLIHFGRSGDSAFRAHPHHSLFSLVVSFVLAVLAVLILAVSAK |
| Ga0187814_100937042 | 3300017932 | Freshwater Sediment | MKTLTHFSRSGDRHFRTHPHHHLFSLIASFVLAVLAVLMLTVTAK |
| Ga0187803_100131255 | 3300017934 | Freshwater Sediment | MKTLIHFSRSGDSYFRAHPHHPLFSLVVSFVLAVLAVLIFTVSAK |
| Ga0187854_100332363 | 3300017938 | Peatland | MKTLIHFSRSGDSYFRAHPHHTLFSLVVSFVLAVLAVLIFTVSAK |
| Ga0187854_102034402 | 3300017938 | Peatland | MKTLTHFSRSGDSHFREHPFHTLFLLVVGFVLAILAVLIFAVPAK |
| Ga0187853_103363642 | 3300017940 | Peatland | GLLPDRRRRLIMKTLTHFSRSGDSHFREHPFHTLFLLVVGFVLAILAVLIFAVPAK |
| Ga0187819_101269803 | 3300017943 | Freshwater Sediment | MKTPTHFSRSGDRYFRAHPHHHLFSLIASFVLAVLAVLILAVTAK |
| Ga0187819_101423821 | 3300017943 | Freshwater Sediment | MKTLTHFSRFGDSYFRPHPHHTLFSLVISFVLAVLAVLLFTVSAK |
| Ga0187819_108737281 | 3300017943 | Freshwater Sediment | MRTVEHRRSGDSHFHAHPFHTLFVLVAGFVLVILAVLILTVPAK |
| Ga0187817_104315841 | 3300017955 | Freshwater Sediment | MRTLEHFRRSGDSHFDAHPFNTLFALVAGFVLAVLAVLILTVPAR |
| Ga0187779_100001488 | 3300017959 | Tropical Peatland | MKVPLHFRRAGPGHIRGHDFHTLFSFVASFVLAVLAVLILTVSAK |
| Ga0187776_100767653 | 3300017966 | Tropical Peatland | MKVPLHFRRSGPGHIREHDLHTLFSFVASFVLAVLAVLILAVSAK |
| Ga0187816_105017372 | 3300017995 | Freshwater Sediment | MKTLTHFSRSGDRHFRTHPHHHLFSLIASFVLAVLAV |
| Ga0187891_10359822 | 3300017996 | Peatland | MKTLTHFSRSGDRYFRAHPHHHLFSLIASFVLTVLAILILAVTAK |
| Ga0187876_10246641 | 3300018003 | Peatland | MMTLIHFSRSGDRYFRAHPHHHLFSLIASFVLTVLVILIFAVTAK |
| Ga0187865_11531502 | 3300018004 | Peatland | MKTMTHFSRSGDSHFREHPFHTLFLLVVGFVLAILAVLIFAVPAK |
| Ga0187888_12803771 | 3300018008 | Peatland | MKTLTHFSRSGDSHFREHPFNTLFLLVVGFVLAILAVLIFAVPAK |
| Ga0187810_101044453 | 3300018012 | Freshwater Sediment | MKTLTHFSRSGDSYFRPHPHHTLFSLVVSFVLAVLAVLIFTVSAK |
| Ga0187880_10828762 | 3300018016 | Peatland | MKTLIHFSRSGDSYFRAHPHHTLFSLVVSLVLAVLAVLIFTVSAK |
| Ga0187882_11533791 | 3300018021 | Peatland | MKTLTHFSRSGDSHFREHPFHTLFLFVVGFVLAILAVLIFAVPAK |
| Ga0187885_100334074 | 3300018025 | Peatland | THFSRSGDSHFREHPFHTLFLLVVGFVLAILAVLIFAVPAK |
| Ga0187885_101121332 | 3300018025 | Peatland | MKTLTHFSRSGDSHFREHPFHTLFLLVVGFVLAILAVLIFAVPA |
| Ga0187885_103929832 | 3300018025 | Peatland | MKTMTHFSRSGDSHFREHPFHTLFLLVVGFVLAILAVLIFAVPA |
| Ga0187867_101864462 | 3300018033 | Peatland | MKTPTHFSSSSDSRFHAHPLHPLFSLVVSFVLAVLAVLIFAVSAK |
| Ga0187871_100658961 | 3300018042 | Peatland | MKTLTHFSGSGESHFRAHPFHTLFLLVVSLVLAILAVLIFTV |
| Ga0187769_100453833 | 3300018086 | Tropical Peatland | MKTPTHFSRFGDSYFRPHPHHTLFSLVISFVLAVLAVLLFTVSAK |
| Ga0187769_100638202 | 3300018086 | Tropical Peatland | MKTLTHFSRSGDSHFREHPFHTLFLLVVGFVLAILAVLIFTVPAK |
| Ga0187771_103590353 | 3300018088 | Tropical Peatland | MKTLTHFSRSGDSYFRPHPHHTLFSLVVSFVLAVLAVLLLTVSAK |
| Ga0187774_100038301 | 3300018089 | Tropical Peatland | RSGPGHIREHDLHTLFSFVASFVLAVLAVLILAVSAK |
| Ga0187770_108931132 | 3300018090 | Tropical Peatland | MKTLTHFSRFGDSYFRPHPHHTLFSLVISFVLALLAVLLFTVSAK |
| Ga0187770_112725711 | 3300018090 | Tropical Peatland | MKTLTHFGRSGDSYFRPHPHHTLFSLVVSFVLAVLAVLIFTVSAK |
| Ga0187852_12567861 | 3300019082 | Peatland | PDRRRRLIMKTLTHFSRSGDSHFREHPFHTLFLLVVGFVLAILAVLIFAVPAK |
| Ga0187797_10257992 | 3300019284 | Peatland | GDSYFRPHPHHTLFSLVVSFVLAVLAVLIFTVSAK |
| Ga0224558_10242564 | 3300023090 | Soil | MKTLTHFSSSGDSYFRAHPHHTLFSLVVSFVLAVLAVLIFAVPAK |
| Ga0208034_10337422 | 3300025442 | Peatland | MRTLEHFMRSGDSHFHAHPFHTLFALVAGFVLAVLAVLILTVPAR |
| Ga0208686_11183052 | 3300025500 | Peatland | MKTLIHFSRSGDSYFRAHPHHTLFSLVVSFVLAVLAV |
| Ga0209904_10000548 | 3300027394 | Thawing Permafrost | MRTLEHFRRSDDRNVHAHPFHTLFALVAGFVLAVLAVLILTVPAR |
| Ga0208042_10124933 | 3300027568 | Peatlands Soil | MKALTHFSKSGDSYFRAHPHHTLFSLVVSFVLAVLAVLIFTVSAK |
| Ga0208043_10037017 | 3300027570 | Peatlands Soil | MKTLTHSRFGDSDFREHPFHTLFLLVVGFVLAILAVLILTVPAK |
| Ga0208324_10218341 | 3300027604 | Peatlands Soil | MKTLTHFGRSGDSYFRAHPHHTLFSLLVSFVLAVLAVLIFTVSAK |
| Ga0208827_100014429 | 3300027641 | Peatlands Soil | MKTLTHLSRSGDSYFRAHPHHTLFSLVVSFVLAVLAVLIFTVSAK |
| Ga0208696_10101782 | 3300027696 | Peatlands Soil | MKTLTHSGDSYFRAHPHHTLFSLVVSFVLAVLAVLLFTVSAK |
| Ga0208696_10920183 | 3300027696 | Peatlands Soil | GDSYFRAHPHHTLFSLLVSFVLAVLAVLIFTVSAK |
| Ga0209517_1000145910 | 3300027854 | Peatlands Soil | MGTLEHFRRSGDSHFHAHPFHTLFALVAGFVLAVLAVLILTVPAR |
| Ga0209517_1000261611 | 3300027854 | Peatlands Soil | MRTLEHFRRSGDRHFHAHPFHTLFALVAGFVLAVLAVLILTVPAK |
| Ga0209517_100154279 | 3300027854 | Peatlands Soil | MKTQMHFSRSGDSYFRAHPHHTLFSFVVSFVLAVLAVLIFAVSAK |
| Ga0209517_101950803 | 3300027854 | Peatlands Soil | MKALTHFSKSGDSYFRAHPHHTLFSLVVSFVLAVLA |
| Ga0209048_104332011 | 3300027902 | Freshwater Lake Sediment | MKTPTHFGRSGDRYFRAHPHHHLFSLIASFVLAVLAVLILAVTAK |
| Ga0209698_100209254 | 3300027911 | Watersheds | MRTLEHFRSSGDSHFHAHPYHSLFAVVAGFVLTVLAMLILTVPAK |
| Ga0209698_113314512 | 3300027911 | Watersheds | MKIPTHFSRSGDRYFRAHPHHHLFSLIASFVLAVLAVLILAVTAK |
| Ga0302159_100462802 | 3300028646 | Fen | MNLLMHFRRSGDSFFHAHPFHNLLSLVVSFVLVVFAVLILTVSAK |
| Ga0302208_100059645 | 3300028774 | Fen | MNLLMHFRRSGDSFFHAHPFHNLLSLVVSFVLVVSAK |
| Ga0316363_101303992 | 3300030659 | Peatlands Soil | MKTPTHFSSSSDSHFRAHPLHPLFSLVVSFVLAVLAVLIFAVSAK |
| Ga0310038_104282372 | 3300030707 | Peatlands Soil | SLEHFRRSGDSHFHAHPFHTLFALVAGFVLAVLAVLILAVPAK |
| Ga0311301_101801002 | 3300032160 | Peatlands Soil | MKSLEHFRRSGDSHFHAHPFHTLFALVAGFVLAVLAVLILAVPAK |
| Ga0311301_102164453 | 3300032160 | Peatlands Soil | MRTPGHFRSSGDSHFHAHPFHTLFALVAGFVLTVLAMLILTVPAK |
| Ga0311301_112024641 | 3300032160 | Peatlands Soil | MKTLTHLSRSGDSYFRAHPHHTLFSLVVSFVLTVLAVLIFAVSAK |
| Ga0326726_1000100227 | 3300033433 | Peat Soil | MKTLLHFRETHDSYFHPHPLHTVFSLVISFVLALLAVLILTVSAK |
| Ga0326726_108165822 | 3300033433 | Peat Soil | MKPLMHFRRSGDSFFHAHPLHNLFSFVVSFVLAVLAVLILTVSAK |
| ⦗Top⦘ |