


| Basic Information | |
|---|---|
| Family ID | F079364 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 116 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MKGGDEYDGLTKARKFHLWKAGQLKKIKRAYNKRFRKYSKEIKDE |
| Number of Associated Samples | 88 |
| Number of Associated Scaffolds | 116 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 18.97 % |
| % of genes near scaffold ends (potentially truncated) | 50.00 % |
| % of genes from short scaffolds (< 2000 bps) | 77.59 % |
| Associated GOLD sequencing projects | 79 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Predicted Viral (38.793 % of family members) |
| NCBI Taxonomy ID | 10239 (predicted) |
| Taxonomy | All Organisms → Viruses → Predicted Viral |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (32.759 % of family members) |
| Environment Ontology (ENVO) | Unclassified (77.586 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (81.034 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 56.16% β-sheet: 0.00% Coil/Unstructured: 43.84% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 116 Family Scaffolds |
|---|---|---|
| PF02511 | Thy1 | 24.14 |
| PF03796 | DnaB_C | 6.03 |
| PF01612 | DNA_pol_A_exo1 | 5.17 |
| PF13155 | Toprim_2 | 5.17 |
| PF02562 | PhoH | 2.59 |
| PF11753 | DUF3310 | 2.59 |
| PF00476 | DNA_pol_A | 2.59 |
| PF13481 | AAA_25 | 1.72 |
| PF04545 | Sigma70_r4 | 1.72 |
| PF00462 | Glutaredoxin | 1.72 |
| PF05367 | Phage_endo_I | 0.86 |
| PF03237 | Terminase_6N | 0.86 |
| PF03592 | Terminase_2 | 0.86 |
| PF02796 | HTH_7 | 0.86 |
| PF03819 | MazG | 0.86 |
| PF04542 | Sigma70_r2 | 0.86 |
| COG ID | Name | Functional Category | % Frequency in 116 Family Scaffolds |
|---|---|---|---|
| COG1351 | Thymidylate synthase ThyX, FAD-dependent family | Nucleotide transport and metabolism [F] | 24.14 |
| COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 6.03 |
| COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 6.03 |
| COG0749 | DNA polymerase I, 3'-5' exonuclease and polymerase domains | Replication, recombination and repair [L] | 2.59 |
| COG1702 | Phosphate starvation-inducible protein PhoH, predicted ATPase | Signal transduction mechanisms [T] | 2.59 |
| COG1875 | Predicted ribonuclease YlaK, contains NYN-type RNase and PhoH-family ATPase domains | General function prediction only [R] | 2.59 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.86 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.86 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.86 |
| COG3728 | Phage terminase, small subunit | Mobilome: prophages, transposons [X] | 0.86 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.86 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 70.69 % |
| Unclassified | root | N/A | 29.31 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000115|DelMOSum2011_c10023167 | All Organisms → Viruses → Predicted Viral | 2896 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10064837 | All Organisms → Viruses → Predicted Viral | 1351 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10125809 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 795 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10040247 | All Organisms → Viruses → Predicted Viral | 2167 | Open in IMG/M |
| 3300001353|JGI20159J14440_10012252 | All Organisms → Viruses → Predicted Viral | 4495 | Open in IMG/M |
| 3300001419|JGI11705J14877_10003259 | Not Available | 8378 | Open in IMG/M |
| 3300001589|JGI24005J15628_10013762 | All Organisms → Viruses → Predicted Viral | 3634 | Open in IMG/M |
| 3300002930|Water_104463 | All Organisms → Viruses → Predicted Viral | 2180 | Open in IMG/M |
| 3300006025|Ga0075474_10016303 | All Organisms → Viruses → Predicted Viral | 2750 | Open in IMG/M |
| 3300006025|Ga0075474_10259354 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 521 | Open in IMG/M |
| 3300006027|Ga0075462_10239167 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 540 | Open in IMG/M |
| 3300006029|Ga0075466_1038525 | All Organisms → Viruses → Predicted Viral | 1457 | Open in IMG/M |
| 3300006810|Ga0070754_10105091 | All Organisms → Viruses → Predicted Viral | 1391 | Open in IMG/M |
| 3300006867|Ga0075476_10317906 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 543 | Open in IMG/M |
| 3300006870|Ga0075479_10250185 | Not Available | 702 | Open in IMG/M |
| 3300006874|Ga0075475_10169669 | Not Available | 948 | Open in IMG/M |
| 3300006916|Ga0070750_10074635 | All Organisms → Viruses → Predicted Viral | 1601 | Open in IMG/M |
| 3300006916|Ga0070750_10216161 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 843 | Open in IMG/M |
| 3300006919|Ga0070746_10384300 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 631 | Open in IMG/M |
| 3300006919|Ga0070746_10536663 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 509 | Open in IMG/M |
| 3300007229|Ga0075468_10097907 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 933 | Open in IMG/M |
| 3300007234|Ga0075460_10194350 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 692 | Open in IMG/M |
| 3300007236|Ga0075463_10001061 | Not Available | 9136 | Open in IMG/M |
| 3300007276|Ga0070747_1011999 | All Organisms → Viruses → Predicted Viral | 3674 | Open in IMG/M |
| 3300007345|Ga0070752_1048243 | All Organisms → Viruses → Predicted Viral | 1969 | Open in IMG/M |
| 3300007539|Ga0099849_1375155 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 502 | Open in IMG/M |
| 3300007540|Ga0099847_1000670 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 11588 | Open in IMG/M |
| 3300007540|Ga0099847_1004229 | All Organisms → cellular organisms → Bacteria | 4892 | Open in IMG/M |
| 3300007540|Ga0099847_1019039 | All Organisms → Viruses → Predicted Viral | 2243 | Open in IMG/M |
| 3300007540|Ga0099847_1043542 | All Organisms → Viruses → Predicted Viral | 1423 | Open in IMG/M |
| 3300007540|Ga0099847_1054370 | All Organisms → Viruses → Predicted Viral | 1256 | Open in IMG/M |
| 3300007540|Ga0099847_1103587 | Not Available | 866 | Open in IMG/M |
| 3300007540|Ga0099847_1154624 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 681 | Open in IMG/M |
| 3300007558|Ga0102822_1066238 | Not Available | 853 | Open in IMG/M |
| 3300008012|Ga0075480_10242012 | Not Available | 936 | Open in IMG/M |
| 3300009071|Ga0115566_10029632 | All Organisms → Viruses → Predicted Viral | 3901 | Open in IMG/M |
| 3300009071|Ga0115566_10233579 | All Organisms → Viruses → Predicted Viral | 1108 | Open in IMG/M |
| 3300009079|Ga0102814_10533831 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 640 | Open in IMG/M |
| 3300009124|Ga0118687_10119439 | Not Available | 925 | Open in IMG/M |
| 3300009409|Ga0114993_10852656 | Not Available | 655 | Open in IMG/M |
| 3300009420|Ga0114994_10141024 | All Organisms → Viruses → Predicted Viral | 1633 | Open in IMG/M |
| 3300009420|Ga0114994_10870130 | Not Available | 584 | Open in IMG/M |
| 3300009428|Ga0114915_1182515 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 584 | Open in IMG/M |
| 3300009435|Ga0115546_1280118 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 569 | Open in IMG/M |
| 3300009495|Ga0115571_1157176 | Not Available | 949 | Open in IMG/M |
| 3300009507|Ga0115572_10244981 | All Organisms → Viruses → Predicted Viral | 1026 | Open in IMG/M |
| 3300009705|Ga0115000_10009094 | Not Available | 7568 | Open in IMG/M |
| 3300009706|Ga0115002_10412675 | Not Available | 996 | Open in IMG/M |
| 3300009786|Ga0114999_10116864 | All Organisms → Viruses → Predicted Viral | 2301 | Open in IMG/M |
| 3300010296|Ga0129348_1154357 | Not Available | 794 | Open in IMG/M |
| 3300010368|Ga0129324_10058132 | All Organisms → Viruses → Predicted Viral | 1748 | Open in IMG/M |
| 3300010392|Ga0118731_109503668 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 645 | Open in IMG/M |
| 3300010883|Ga0133547_10113602 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5974 | Open in IMG/M |
| 3300010883|Ga0133547_10772022 | All Organisms → Viruses → Predicted Viral | 1892 | Open in IMG/M |
| 3300011118|Ga0114922_11483671 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 545 | Open in IMG/M |
| 3300011118|Ga0114922_11563459 | Not Available | 530 | Open in IMG/M |
| 3300011252|Ga0151674_1001220 | Not Available | 8706 | Open in IMG/M |
| 3300011258|Ga0151677_1135545 | Not Available | 549 | Open in IMG/M |
| 3300013010|Ga0129327_10006076 | Not Available | 6808 | Open in IMG/M |
| 3300013010|Ga0129327_10065064 | All Organisms → Viruses → Predicted Viral | 1804 | Open in IMG/M |
| 3300013010|Ga0129327_10156968 | All Organisms → Viruses → Predicted Viral | 1135 | Open in IMG/M |
| 3300013010|Ga0129327_10315445 | Not Available | 812 | Open in IMG/M |
| 3300013010|Ga0129327_10709949 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 564 | Open in IMG/M |
| 3300016749|Ga0182053_1053349 | All Organisms → Viruses → Predicted Viral | 1202 | Open in IMG/M |
| 3300017697|Ga0180120_10012919 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 3965 | Open in IMG/M |
| 3300017727|Ga0181401_1087755 | Not Available | 802 | Open in IMG/M |
| 3300017739|Ga0181433_1134763 | Not Available | 586 | Open in IMG/M |
| 3300017744|Ga0181397_1045312 | All Organisms → Viruses → Predicted Viral | 1227 | Open in IMG/M |
| 3300017767|Ga0181406_1265099 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 503 | Open in IMG/M |
| 3300018682|Ga0188851_1001923 | All Organisms → Viruses → Predicted Viral | 3406 | Open in IMG/M |
| 3300018682|Ga0188851_1005808 | All Organisms → Viruses → Predicted Viral | 1763 | Open in IMG/M |
| 3300018682|Ga0188851_1007112 | Not Available | 1559 | Open in IMG/M |
| 3300018682|Ga0188851_1037547 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 515 | Open in IMG/M |
| 3300019096|Ga0188835_1005051 | All Organisms → Viruses → Predicted Viral | 1281 | Open in IMG/M |
| 3300019122|Ga0188839_1003053 | All Organisms → Viruses → Predicted Viral | 2505 | Open in IMG/M |
| 3300019751|Ga0194029_1098199 | Not Available | 513 | Open in IMG/M |
| 3300019756|Ga0194023_1060702 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 759 | Open in IMG/M |
| 3300020175|Ga0206124_10133015 | All Organisms → Viruses → Predicted Viral | 1011 | Open in IMG/M |
| 3300020175|Ga0206124_10221616 | Not Available | 741 | Open in IMG/M |
| 3300020358|Ga0211689_1183398 | Not Available | 573 | Open in IMG/M |
| 3300021185|Ga0206682_10041636 | All Organisms → cellular organisms → Bacteria | 2594 | Open in IMG/M |
| 3300021425|Ga0213866_10268646 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 863 | Open in IMG/M |
| 3300021959|Ga0222716_10383820 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 821 | Open in IMG/M |
| 3300022050|Ga0196883_1008036 | All Organisms → Viruses → Predicted Viral | 1236 | Open in IMG/M |
| 3300022065|Ga0212024_1007829 | All Organisms → Viruses → Predicted Viral | 1526 | Open in IMG/M |
| 3300022065|Ga0212024_1010319 | All Organisms → Viruses → Predicted Viral | 1386 | Open in IMG/M |
| 3300022178|Ga0196887_1103774 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 632 | Open in IMG/M |
| 3300022183|Ga0196891_1090336 | Not Available | 541 | Open in IMG/M |
| 3300025048|Ga0207905_1038812 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 755 | Open in IMG/M |
| 3300025120|Ga0209535_1191301 | Not Available | 588 | Open in IMG/M |
| 3300025276|Ga0208814_1015325 | All Organisms → Viruses → Predicted Viral | 2644 | Open in IMG/M |
| 3300025543|Ga0208303_1072692 | Not Available | 779 | Open in IMG/M |
| 3300025590|Ga0209195_1079499 | Not Available | 759 | Open in IMG/M |
| 3300025610|Ga0208149_1155392 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 520 | Open in IMG/M |
| 3300025645|Ga0208643_1140425 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 622 | Open in IMG/M |
| 3300025803|Ga0208425_1018296 | All Organisms → Viruses → Predicted Viral | 1876 | Open in IMG/M |
| 3300025870|Ga0209666_1155323 | All Organisms → Viruses → Predicted Viral | 1033 | Open in IMG/M |
| 3300027687|Ga0209710_1043619 | All Organisms → Viruses → Predicted Viral | 2086 | Open in IMG/M |
| 3300027687|Ga0209710_1297762 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 501 | Open in IMG/M |
| 3300027813|Ga0209090_10170467 | All Organisms → Viruses → Predicted Viral | 1138 | Open in IMG/M |
| 3300028125|Ga0256368_1017824 | All Organisms → Viruses → Predicted Viral | 1241 | Open in IMG/M |
| 3300028197|Ga0257110_1220541 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 723 | Open in IMG/M |
| 3300031539|Ga0307380_11482704 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 506 | Open in IMG/M |
| 3300031565|Ga0307379_10488646 | All Organisms → Viruses → Predicted Viral | 1155 | Open in IMG/M |
| 3300031621|Ga0302114_10191928 | Not Available | 865 | Open in IMG/M |
| 3300031622|Ga0302126_10062028 | All Organisms → Viruses → Predicted Viral | 1536 | Open in IMG/M |
| 3300031628|Ga0308014_1148174 | Not Available | 532 | Open in IMG/M |
| 3300031673|Ga0307377_10130593 | All Organisms → Viruses → Predicted Viral | 2004 | Open in IMG/M |
| 3300032277|Ga0316202_10016010 | All Organisms → Viruses → Predicted Viral | 3742 | Open in IMG/M |
| 3300033742|Ga0314858_086739 | Not Available | 788 | Open in IMG/M |
| 3300033742|Ga0314858_119174 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 674 | Open in IMG/M |
| 3300033742|Ga0314858_121165 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 668 | Open in IMG/M |
| 3300033742|Ga0314858_192268 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 524 | Open in IMG/M |
| 3300034374|Ga0348335_114324 | Not Available | 815 | Open in IMG/M |
| 3300034375|Ga0348336_171989 | Not Available | 615 | Open in IMG/M |
| 3300034418|Ga0348337_088473 | All Organisms → Viruses → Predicted Viral | 1052 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 32.76% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 13.79% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 6.90% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 5.17% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 5.17% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 4.31% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 3.45% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 3.45% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 2.59% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.72% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 1.72% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 1.72% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.72% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.72% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 1.72% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.86% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 0.86% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 0.86% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.86% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.86% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.86% |
| Estuary Water | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuary Water | 0.86% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.86% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.86% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.86% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.86% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.86% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment | 0.86% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.86% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300001353 | Pelagic Microbial community sample from North Sea - COGITO 998_met_09 | Environmental | Open in IMG/M |
| 3300001419 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline water (15 m) | Environmental | Open in IMG/M |
| 3300001589 | Marine viral communities from the Pacific Ocean - LP-40 | Environmental | Open in IMG/M |
| 3300002930 | Estuary water microbial communities from Pearl Estuary, Zhujiang, China | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006867 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006870 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006874 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300007229 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007234 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007236 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007558 | Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.733 | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009079 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 | Environmental | Open in IMG/M |
| 3300009124 | Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsf | Environmental | Open in IMG/M |
| 3300009409 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 | Environmental | Open in IMG/M |
| 3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
| 3300009428 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 | Environmental | Open in IMG/M |
| 3300009435 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 | Environmental | Open in IMG/M |
| 3300009495 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 | Environmental | Open in IMG/M |
| 3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
| 3300009705 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 | Environmental | Open in IMG/M |
| 3300009706 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_86 | Environmental | Open in IMG/M |
| 3300009786 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 | Environmental | Open in IMG/M |
| 3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010392 | Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385 | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300011118 | Deep subsurface microbial communities from Aarhus Bay to uncover new lineages of life (NeLLi) - Aarhus_00045 metaG | Environmental | Open in IMG/M |
| 3300011252 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_4, permeate | Environmental | Open in IMG/M |
| 3300011258 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, permeate | Environmental | Open in IMG/M |
| 3300013010 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA | Environmental | Open in IMG/M |
| 3300016749 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011512AT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017727 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20 | Environmental | Open in IMG/M |
| 3300017739 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 | Environmental | Open in IMG/M |
| 3300017744 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23 | Environmental | Open in IMG/M |
| 3300017767 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20 | Environmental | Open in IMG/M |
| 3300018682 | Metatranscriptome of marine microbial communities from Baltic Sea - GS680_0p1 | Environmental | Open in IMG/M |
| 3300019096 | Metatranscriptome of marine microbial communities from Baltic Sea - GS676_0p1 | Environmental | Open in IMG/M |
| 3300019122 | Metatranscriptome of marine microbial communities from Baltic Sea - GS677_0p1 | Environmental | Open in IMG/M |
| 3300019751 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW18Oct16_MG | Environmental | Open in IMG/M |
| 3300019756 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW6Sep16_MG | Environmental | Open in IMG/M |
| 3300020175 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2 | Environmental | Open in IMG/M |
| 3300020358 | Marine microbial communities from Tara Oceans - TARA_B100000768 (ERX555925-ERR599009) | Environmental | Open in IMG/M |
| 3300021185 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 | Environmental | Open in IMG/M |
| 3300021425 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284 | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300022050 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v3) | Environmental | Open in IMG/M |
| 3300022065 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2) | Environmental | Open in IMG/M |
| 3300022178 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3) | Environmental | Open in IMG/M |
| 3300022183 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3) | Environmental | Open in IMG/M |
| 3300025048 | Marine viral communities from the Subarctic Pacific Ocean - LP-49 (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025276 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 (SPAdes) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025590 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100420 (SPAdes) | Environmental | Open in IMG/M |
| 3300025610 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025870 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_125m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027687 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300027813 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300028125 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SB | Environmental | Open in IMG/M |
| 3300028197 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_10m | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
| 3300031621 | Marine microbial communities from Western Arctic Ocean, Canada - AG5_Surface | Environmental | Open in IMG/M |
| 3300031622 | Marine microbial communities from Western Arctic Ocean, Canada - CB4_20m | Environmental | Open in IMG/M |
| 3300031628 | Marine microbial communities from water near the shore, Antarctic Ocean - #229 | Environmental | Open in IMG/M |
| 3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
| 3300032277 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotite | Environmental | Open in IMG/M |
| 3300033742 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawater | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| 3300034375 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4) | Environmental | Open in IMG/M |
| 3300034418 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2011_100231678 | 3300000115 | Marine | GDEYDGLTKARKFYLWKRGQLKKIKRAYNKRFRKYSKEIKDE* |
| DelMOSum2011_100648371 | 3300000115 | Marine | GDEYDGLTKARKFYLWKRGQLKKIKRAYNKRFRKHNKEIKDE* |
| DelMOSum2011_101258093 | 3300000115 | Marine | MKGGDEYDGLTKARKFHLWKAGQLKKIKRAYNKRFRKYSKEIKDE*IY* |
| DelMOWin2010_100402476 | 3300000117 | Marine | MKGGDEYDALSKSRKFLRWKAGQVKKIKRAYNKRFRKYSRRIDYE* |
| JGI20159J14440_100122527 | 3300001353 | Pelagic Marine | MKRIPMKGGAEYDGLTKARRFLIWKSGQLKKIKRAYNKRFRKYSKEIKDE* |
| JGI11705J14877_1000325912 | 3300001419 | Saline Water And Sediment | MKGGDEYDALSKSRKFLRWRSGQVKKIKRAYNKRFRRYSRRINHEE* |
| JGI24005J15628_100137624 | 3300001589 | Marine | LTKARKFYLWKSGQLKKIKRAYNKRFRKHNKEIXDE* |
| Water_1044631 | 3300002930 | Estuary Water | YDALSKSRKFLRWKSGQVKKIKRAYNKRFRRYSRRINHEE* |
| Ga0075474_100163031 | 3300006025 | Aqueous | MKGGDEYDALSKSRKFLRWKSGQIKKIKRAYNKRFRKYSKEINNE |
| Ga0075474_102593541 | 3300006025 | Aqueous | DEYDALSKSRKFLRWKSGQIKKIKRAYNKRFRKYSKEINNE* |
| Ga0075462_102391674 | 3300006027 | Aqueous | YDALSKSRKFLRWRSGQVKKIKRAYNKRFRRYSRKINHEE* |
| Ga0075466_10385253 | 3300006029 | Aqueous | KARKFYLWKSGQLKKIKRAYNKRFRKHNKEIEDE* |
| Ga0070754_101050913 | 3300006810 | Aqueous | LTKARKFYLWKSGQLKKIKRAYNKRFRKHNKEIKDE* |
| Ga0075476_103179061 | 3300006867 | Aqueous | SKSRKFLRWKSGQIKKIKRAYNKRFRKYSKEINNE* |
| Ga0075479_102501854 | 3300006870 | Aqueous | YDALSKSRKFLRWRSGQVKKIKRAYNKRFRKYSKEINNE* |
| Ga0075475_101696692 | 3300006874 | Aqueous | MKGGDEYDALSKSRKFLRWRSGQVKKIKRAYNKRFRRYSRKINHEE* |
| Ga0070750_100746352 | 3300006916 | Aqueous | MKGGDEYDALTKTRKFLRWKSGQIKKIKRAYNKRFRKYNKGIRTDDD* |
| Ga0070750_102161615 | 3300006916 | Aqueous | YDALSKSRKFLRWKTGQIKKIKRAYNKRFRKYSKGINYEE* |
| Ga0070746_103843001 | 3300006919 | Aqueous | SRKFLRWKTGQIKKIKRAYNKRFRKYSKGINYEE* |
| Ga0070746_105366631 | 3300006919 | Aqueous | GDEYDALSKSRKFLRWKSGQIKKIKRAYNKRFRKYSRRINHEE* |
| Ga0075468_100979072 | 3300007229 | Aqueous | MKGGDEYDGLTKSRKFHLWKAGQLKKIKRAYNKRFRKYSKEIKDE* |
| Ga0075460_101943504 | 3300007234 | Aqueous | DALSKSRKFLRWKTGQIKKIKRAYNKRFRKYSKGINYEE* |
| Ga0075463_100010619 | 3300007236 | Aqueous | MKGEDEYDALSKSRKFLRWKAGQIKKIKRAYNKRFRKYSKRIKMDE* |
| Ga0070747_10119994 | 3300007276 | Aqueous | YDGLTKARKFYLWKRGQLKKIKRAYNKRFRKQGKEIQDE* |
| Ga0070752_10482431 | 3300007345 | Aqueous | LTKARKFYLWKSGQLKKIKRAYNKRFRKYNKEIKDE* |
| Ga0099849_13751553 | 3300007539 | Aqueous | SRKFLRWRSGQVKKIKRAYNKRFRRYSRKINHEE* |
| Ga0099847_100067018 | 3300007540 | Aqueous | MKGGDEYDGLTKARKFLIWKSGQLKKIKRAYNKRFRKHIKEIKDE* |
| Ga0099847_10042299 | 3300007540 | Aqueous | MKGGDEYDGLTKARKFLLWKSGQLKKIKRAYNKRFRKHIKEVNDD* |
| Ga0099847_10190396 | 3300007540 | Aqueous | MKGGDEYDGLTKARKFLLWKSGQLKKIKRAYNKRFRKHIKELKDE* |
| Ga0099847_10435421 | 3300007540 | Aqueous | MKGGDEYDGLTKARKFLLWKSGQLKKIKRAYNKRFRKHIKEVNDE* |
| Ga0099847_10543705 | 3300007540 | Aqueous | KGGAEYDGLTKARRFLIWKSGQLKKIKRAYNKRFRKYSKEIKDE* |
| Ga0099847_11035873 | 3300007540 | Aqueous | MKGGDEYDGLTKARKFLLWKSGQLKKIKRAYNKRFRKHIKETNDE* |
| Ga0099847_11546244 | 3300007540 | Aqueous | GDEYDGLTKARRFLIWKAGQLKKIKRAYNKRFRKHNKEIKDE* |
| Ga0102822_10662381 | 3300007558 | Estuarine | MKGGDEYDGLTKGRRFLHWKTGQLKKIKRTYNKRFRKYSKRITTDE* |
| Ga0075480_102420122 | 3300008012 | Aqueous | MKGGDEYDGLTKSRKFHLWKAGQLKKIKRAYNKRFRKYNKEIKDE* |
| Ga0115566_1002963212 | 3300009071 | Pelagic Marine | MKGGAEYDGLTKARRFLIWKSGQLKKIKRAYNKRFRKYSKEIKDE* |
| Ga0115566_102335792 | 3300009071 | Pelagic Marine | MKGGDEYDGLTKARRFLLWKAGQLKKIKRAYNKRFRKHIKGLKDE* |
| Ga0102814_105338312 | 3300009079 | Estuarine | MKGGDEYDALTKARKFLRWKAGQVKKIKRAYNKRFRKYSKGVIQDEG* |
| Ga0118687_101194395 | 3300009124 | Sediment | EYDALTKARKFHLWKSGQLKKIKRAYNKRFRKYSKGMKTDE* |
| Ga0114993_108526562 | 3300009409 | Marine | MKSGDEYDGLTKARRFYLWKAGQLKKIKRAYNKRFRKYNKEIKDE* |
| Ga0114994_101410242 | 3300009420 | Marine | MKSGDEYDGLTKARKFYLWKKGQLKKLKRAYNKRFRKYNKEIKDE* |
| Ga0114994_108701301 | 3300009420 | Marine | MKSGDEYDGLTKARRFYLWKAGQLKKIKRAYNKRFRKYNKEIKD |
| Ga0114915_11825153 | 3300009428 | Deep Ocean | MKGGDEHGGLTKARKFYLWKKGQLKKIKRAYNKRFRKYIKEIKDD* |
| Ga0115546_12801182 | 3300009435 | Pelagic Marine | MKGGDEYDALSKSRKFLRWRSGQVKKIKRAYNKRFRKYSRRINHEE* |
| Ga0115571_11571765 | 3300009495 | Pelagic Marine | MKGGDEYDGLTKARKFLIWKSGQLKKIKRAYNKRFRKHIKGLKDE* |
| Ga0115572_102449813 | 3300009507 | Pelagic Marine | MKGGDEYDGLTKARKFLLWKSGQLKKIKRAYNKRFRKHIKEINDE* |
| Ga0115000_100090942 | 3300009705 | Marine | MKSGDEYDGLTKARRFYLWKAGQLKKIKRAYNKRFRKYNKEIKNEG* |
| Ga0115002_104126752 | 3300009706 | Marine | MKSGDEYDGLTKARRFYLWKAGQLKKIKRAYNKRFRKHNKEIKDE* |
| Ga0114999_101168643 | 3300009786 | Marine | MKGGDEYDGLTKARKFYIWQAGKLKKIKRAYNKRFRKYSKEIKDE* |
| Ga0129348_11543572 | 3300010296 | Freshwater To Marine Saline Gradient | GLTKARKFYLWKRGQLKKIKRAYNKRFRKHNKEIKDE* |
| Ga0129324_100581321 | 3300010368 | Freshwater To Marine Saline Gradient | KARKFYLWKAGQVKKIKRAYNKRLRKHNKEVNDE* |
| Ga0118731_1095036681 | 3300010392 | Marine | YDALSKSRKFLRWRSGQVKKIKRAYNKRFRRYSRRINHEE* |
| Ga0133547_101136021 | 3300010883 | Marine | LTKARRFYLWKAGQLKKIKRAYNKRFRKYNKEIKDAG* |
| Ga0133547_107720221 | 3300010883 | Marine | DEYDGLTKARKFYLWKAGQLKKIKRAYNKRFRKHNKDTLER* |
| Ga0114922_114836711 | 3300011118 | Deep Subsurface | MKGGDEYDAFTKIRKFLRWRSGQVKKIKRAYNKRFRRYSRRINHEE* |
| Ga0114922_115634593 | 3300011118 | Deep Subsurface | MTERISMKGGDEYDAFTKIRKFLRWKAGQVKKIKRAYNKRFRKYSKWDKN |
| Ga0151674_10012204 | 3300011252 | Marine | MKGGDEYDALTNARKFHLWKAGQLKKIKRAYNKRFRKCSKRMTKDENR* |
| Ga0151677_11355451 | 3300011258 | Marine | MKGGDEYDALTKARKFHLWRAGQLKKIKRAYNKRFRKHNKEMELKNE* |
| Ga0129327_100060764 | 3300013010 | Freshwater To Marine Saline Gradient | MKGGDEYDGLTKARKFLMWKSGQLKKIKRAYNKRFRKHIKEVKDD* |
| Ga0129327_100650641 | 3300013010 | Freshwater To Marine Saline Gradient | DEYDGLTKARKFYLWKSGQLKKIKRAYNKRFRKHTKETDNDR* |
| Ga0129327_101569681 | 3300013010 | Freshwater To Marine Saline Gradient | MKGGDEYDGLTKARRFLIWKSGQLKKIKRAYNKRFRKHNKEIKDE* |
| Ga0129327_103154452 | 3300013010 | Freshwater To Marine Saline Gradient | MKGGDEYDGLTKARRFLLWKSGQLKKIKRAYNKRFRKHNKENKDE* |
| Ga0129327_107099494 | 3300013010 | Freshwater To Marine Saline Gradient | GLTKARRFLIWKAGQLKKIKRAYNKRFRKHNKENKDE* |
| Ga0182053_10533491 | 3300016749 | Salt Marsh | EYDALTKARRFYKWRTGKLKAIKRAYNKRFRKHNKEMKND |
| Ga0180120_100129194 | 3300017697 | Freshwater To Marine Saline Gradient | MKRIPMKGGAEYDGLTKARKFFIWKSGQLKKIKRAYNKRFRKYSKEIKDE |
| Ga0181401_10877555 | 3300017727 | Seawater | GLTKGRRFLHWKTGQLKKIKRAYNKRFRKYNKKVIIDE |
| Ga0181433_11347631 | 3300017739 | Seawater | DEYDGLTKARKFHLWKAGQLKRIKRAYNKRFRKYSKEIKDE |
| Ga0181397_10453124 | 3300017744 | Seawater | MNKRIPMKGGNEYDALSKSRKFLRWKAGQVKKIKRAYSKRFRKYSRRIDYE |
| Ga0181406_12650991 | 3300017767 | Seawater | MTKRIPMKSSDEYDGLTKARKFHLWKAGQLKKIKRAYNKRFRKYNKEIKDE |
| Ga0188851_10019231 | 3300018682 | Freshwater Lake | MTKRIRMKGGDEYNGLTKARRFHIWKSGQLKKIKRAYNKRFRKHIKETKDE |
| Ga0188851_10058084 | 3300018682 | Freshwater Lake | MKGGDEYDGLTKARKFLLWKSGQLKKIKRAYNKRFRKHIKEINDE |
| Ga0188851_10071126 | 3300018682 | Freshwater Lake | GDEYDGLTKARKFLLWKSGQLKKIKRAYNKRFRKHIKEVNDE |
| Ga0188851_10375472 | 3300018682 | Freshwater Lake | MKGGDEYDGLTKARRFLIWKSGQLKKIKRAYNKRFRKHNKEIKDE |
| Ga0188835_10050514 | 3300019096 | Freshwater Lake | MWRSMMTKRIRMKGGDEYNGLTKARRFHIWKSGQLKKIKRAYNKRFRKHNKELKDE |
| Ga0188839_10030531 | 3300019122 | Freshwater Lake | MTKRIPMKGGGEYDGLTKARRFHIWKSGQLKKIKRAYNKRFRKHNKELKDE |
| Ga0194029_10981991 | 3300019751 | Freshwater | MDAFSKWRKFLNFKRGELKKIKRAYNKRLRKANKETCQ |
| Ga0194023_10607021 | 3300019756 | Freshwater | DEYDALSKSRKFLRWKSGQIKKIKRAYNKRFRKYSKEINNE |
| Ga0206124_101330152 | 3300020175 | Seawater | MKGGDEYDGLTKARRFLLWKSGQLKKIKRAYNKRFRKHIKEIKDE |
| Ga0206124_102216162 | 3300020175 | Seawater | MKRIPMKGGAEYDGLTKARRFLIWKSGQLKKIKRAYNKRFRKYSKEI |
| Ga0211689_11833981 | 3300020358 | Marine | GLTKARKFYLWKRGQLKKIKRTYNKRFRKYSKEMKDD |
| Ga0206682_100416366 | 3300021185 | Seawater | TKGGDEYDALSKARKFHLWKAGQLKKIKRAYNKRFRKYNKVTRDE |
| Ga0213866_102686461 | 3300021425 | Seawater | MKGGDEYDALSKSRKFLRWRSGQVKKIKRAYNKRFRRYSRRINHEE |
| Ga0222716_103838201 | 3300021959 | Estuarine Water | PTKGGDEYDALSKARKFHLWKAGQLKKIKRAYNKRFRKYNKVTRDE |
| Ga0196883_10080362 | 3300022050 | Aqueous | MKGGDEYDALSKSRKFLRWRSGQVKKIKRAYNKRFRRYSRKINHEE |
| Ga0212024_10078293 | 3300022065 | Aqueous | MKGGDEYDALTKTRKFLRWKSGQIKKIKRAYNKRFRKYNKGIF |
| Ga0212024_10103191 | 3300022065 | Aqueous | MKGGDEYDALTKTRKFLRWKSGQIKKIKRAYNKRFRKYNKGIRTDDD |
| Ga0196887_11037742 | 3300022178 | Aqueous | MKGGDEYDGLTKARKFHLWKAGQLKKIKRAYNKRFRKYSKEIKDE |
| Ga0196891_10903363 | 3300022183 | Aqueous | EDEYDALSKSRKFLRWKAGQIKKIKRAYNKRFRKYSKRIKMDE |
| Ga0207905_10388122 | 3300025048 | Marine | MKGGDEYDGLTKSRKFHLWKAGQLKKIKRAYNKRFRKYSKEIKDE |
| Ga0209535_11913013 | 3300025120 | Marine | GDEYDGLTKSRKFHLWKAGQLKKIKRAYNKRFRKYSKEIKDE |
| Ga0208814_10153256 | 3300025276 | Deep Ocean | MKGGDEYGGLTKARKFYLWKKGQLKKIKRAYNKRFRKHNKEIKDE |
| Ga0208303_10726925 | 3300025543 | Aqueous | DEYDGLTKARRFLIWKSGQLKKIKRAYNKRFRKHNKENKDE |
| Ga0209195_10794991 | 3300025590 | Pelagic Marine | MTKRIPMKGGAEYDGLTKARRFLIWKSGQLKKIKRAYNKRFRKYSKEIKDE |
| Ga0208149_11553923 | 3300025610 | Aqueous | MKGGDEYDALSKSRKFLRWKSGQLKKIKRAYNKRFRKYSKEINNE |
| Ga0208643_11404252 | 3300025645 | Aqueous | MKGGDEYDGLTKARKFHLWKAGQLKKIKRAYNKRFRKYSKEIKDEXIY |
| Ga0208425_10182962 | 3300025803 | Aqueous | MKGEDEYDALSKSRKFLRWKAGQIKKIKRAYNKRFRKYSKRIKMDE |
| Ga0209666_11553231 | 3300025870 | Marine | VKRIPMKGGDEFDALTKARRFLRWKSGQVKKIKRVYNKRFRRYSRRINHEE |
| Ga0209710_10436195 | 3300027687 | Marine | GDEYDGLTKARKFYLWKAGQLKKIKRAYNKRFRKCNKEIKDE |
| Ga0209710_12977621 | 3300027687 | Marine | DEYDGLTKARKFYLWKAGQIKKIKRAYNKRFRKYNKEIKDAG |
| Ga0209090_101704671 | 3300027813 | Marine | MKSGDEYDGLTKARKFYLWKKGQLKKLKRAYNKRFRKYNKEIKDE |
| Ga0256368_10178242 | 3300028125 | Sea-Ice Brine | MKGGDEYDGLTKGRRFYLWKAGQLKKIKRAYNKRFRKHTKERVDE |
| Ga0257110_12205411 | 3300028197 | Marine | MTKRIPMKGGNEYDGLTKARKFYLWKSGQLKKIKRAYNKRFRKYNKEIKDE |
| Ga0307380_114827042 | 3300031539 | Soil | MKRIPMKGGGEYDGLTKARKFFIWKSGQLKKIKRAYNKRFRKYSKEIKDE |
| Ga0307379_104886462 | 3300031565 | Soil | MKGGGEYDGLTKARKFFIWKSGQLKKIKRAYNKRFRKYSKEIKDE |
| Ga0302114_101919282 | 3300031621 | Marine | MKSGDEYDGLTKARRFYLWKAGQLKKIKRAYNKRFRKYNKEIKNEG |
| Ga0302126_100620283 | 3300031622 | Marine | GDEYDGLTKARKFYLWKSGQLKKIKRAYNKRFRKYNKEIKDE |
| Ga0308014_11481743 | 3300031628 | Marine | TKARKFHLWKSGQLKKIKRAYNKRLRKHNKDVNDEGLL |
| Ga0307377_101305933 | 3300031673 | Soil | MKRIPMKGGGEYDGLTKARRFFIWKSGQLKKIKRAYNKRFRKYSKEIKDE |
| Ga0316202_100160103 | 3300032277 | Microbial Mat | MKGGDEYDAFTKTRKFLRWKAGQVKKIKRAYNKRFRRYSRRINHEE |
| Ga0314858_086739_3_134 | 3300033742 | Sea-Ice Brine | DEYDGLTKARRFMHWKSGQLKKIKRAYNKRFRKYSKESVDDQK |
| Ga0314858_119174_471_608 | 3300033742 | Sea-Ice Brine | MKGGDEYDGLTKARRFYLWKAGQLKKIKRAYNKRFRKCNKEIKDE |
| Ga0314858_121165_474_614 | 3300033742 | Sea-Ice Brine | MKGGDEYDGLTKARRFFLWKAGQLKKIKRAYNKRFRKYSKEVDNDG |
| Ga0314858_192268_407_523 | 3300033742 | Sea-Ice Brine | GMITKARKFYVWKAGQLKKIKRAYNKRFRKHNKEMKDE |
| Ga0348335_114324_3_167 | 3300034374 | Aqueous | MKGGDEYDALSKSRKFLRWKSGQIKKIKRAYNKRFRKYSKEINNEWNKSNRDRRT |
| Ga0348336_171989_3_119 | 3300034375 | Aqueous | DGLTKARKFYLWKSGQLKKIKRAYNKRFRKHNKEIKDE |
| Ga0348337_088473_1_147 | 3300034418 | Aqueous | MKGGDEYDALSKSRKFLRWKSGQIKKIKRAYNKRFRKYSKEINNEWNKS |
| ⦗Top⦘ |