


| Basic Information | |
|---|---|
| Family ID | F079341 |
| Family Type | Metagenome |
| Number of Sequences | 116 |
| Average Sequence Length | 43 residues |
| Representative Sequence | LSGKLVWKRGDGWVQYNPPRSHPSYEEWQKLKQKEKENENE |
| Number of Associated Samples | 76 |
| Number of Associated Scaffolds | 116 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 49.14 % |
| % of genes near scaffold ends (potentially truncated) | 42.24 % |
| % of genes from short scaffolds (< 2000 bps) | 78.45 % |
| Associated GOLD sequencing projects | 63 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (46.552 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (45.690 % of family members) |
| Environment Ontology (ENVO) | Unclassified (68.103 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (90.517 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 23.19% β-sheet: 11.59% Coil/Unstructured: 65.22% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 116 Family Scaffolds |
|---|---|---|
| PF10544 | T5orf172 | 12.07 |
| PF03819 | MazG | 10.34 |
| PF02867 | Ribonuc_red_lgC | 5.17 |
| PF02511 | Thy1 | 3.45 |
| PF05367 | Phage_endo_I | 1.72 |
| PF11753 | DUF3310 | 1.72 |
| PF00145 | DNA_methylase | 0.86 |
| PF13455 | MUG113 | 0.86 |
| PF13578 | Methyltransf_24 | 0.86 |
| PF00476 | DNA_pol_A | 0.86 |
| PF02945 | Endonuclease_7 | 0.86 |
| PF11651 | P22_CoatProtein | 0.86 |
| COG ID | Name | Functional Category | % Frequency in 116 Family Scaffolds |
|---|---|---|---|
| COG0209 | Ribonucleotide reductase alpha subunit | Nucleotide transport and metabolism [F] | 5.17 |
| COG1351 | Thymidylate synthase ThyX, FAD-dependent family | Nucleotide transport and metabolism [F] | 3.45 |
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 0.86 |
| COG0749 | DNA polymerase I, 3'-5' exonuclease and polymerase domains | Replication, recombination and repair [L] | 0.86 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 47.41 % |
| Unclassified | root | N/A | 46.55 % |
| unclassified Hyphomonas | no rank | unclassified Hyphomonas | 6.03 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 45.69% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 11.21% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 9.48% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 5.17% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment | 5.17% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 4.31% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 3.45% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 3.45% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 2.59% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 2.59% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 0.86% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.86% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.86% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.86% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 0.86% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 0.86% |
| Saline | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline | 0.86% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.86% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300000949 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94 | Host-Associated | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300001748 | Saline surface water microbial communities from Etoliko Lagoon, Greece - surface water (0 m) | Environmental | Open in IMG/M |
| 3300003617 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_105LU_22_DNA | Environmental | Open in IMG/M |
| 3300003908 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_125SG_5_DNA | Environmental | Open in IMG/M |
| 3300004097 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaG | Environmental | Open in IMG/M |
| 3300004369 | Saline microbial communities from the South Caspian sea - cas-15 | Environmental | Open in IMG/M |
| 3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300005512 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_water | Environmental | Open in IMG/M |
| 3300005738 | Seawater microbial communities from Vineyard Sound, MA, USA - sterilised with crude oil T0 | Environmental | Open in IMG/M |
| 3300005747 | Seawater microbial communities from Vineyard Sound, MA, USA - control T14 | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006867 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006869 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
| 3300009027 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG | Environmental | Open in IMG/M |
| 3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300010316 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300012928 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG | Environmental | Open in IMG/M |
| 3300013010 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA | Environmental | Open in IMG/M |
| 3300017721 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_09 viral metaG | Environmental | Open in IMG/M |
| 3300017726 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 | Environmental | Open in IMG/M |
| 3300017739 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 | Environmental | Open in IMG/M |
| 3300017748 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21 | Environmental | Open in IMG/M |
| 3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017951 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018413 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011509CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018415 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011508AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018417 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018424 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019459 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300021347 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266 | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022067 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v3) | Environmental | Open in IMG/M |
| 3300022068 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2) | Environmental | Open in IMG/M |
| 3300022071 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v2) | Environmental | Open in IMG/M |
| 3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
| 3300022158 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v3) | Environmental | Open in IMG/M |
| 3300022168 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v2) | Environmental | Open in IMG/M |
| 3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022929 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG | Environmental | Open in IMG/M |
| 3300023084 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG | Environmental | Open in IMG/M |
| 3300023180 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG | Environmental | Open in IMG/M |
| 3300024344 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024519 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_27 | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025610 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
| 3300025687 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025751 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025767 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_105LU_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025828 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSpr2010_100096946 | 3300000116 | Marine | MSKLVWKRGDGWVQFNPPRSHPSYEEWRKLKEKEAKEGEGK* |
| DelMOSpr2010_100156602 | 3300000116 | Marine | LTSKQLSGKLVWKRGDGWVQFNPPRSHPSYEEWQKLKQKEKENENE* |
| DelMOSpr2010_101304082 | 3300000116 | Marine | LTSQQLSGKLVWKRGDGWVQFNPPRSHPSYEEWQKLKQKEKENENER* |
| DelMOWin2010_100253262 | 3300000117 | Marine | MSKLVWKRGDGWVQYNPPRSHPSYAEWQKXKXKEAKEGEGK* |
| BBAY94_101346992 | 3300000949 | Macroalgal Surface | LTSKQRSDKLVWKRGDGWVQYNPPRSHPSYEEWQKLKEKEKENKHE* |
| JGI24006J15134_100044045 | 3300001450 | Marine | MKSSLIWKRGDGWVQFNPPRSHPCYNEWMKLKEKEKDNEGTRTEGS* |
| JGI24003J15210_100613654 | 3300001460 | Marine | LTSKQHKDKLVWKRGDGWVQYNPPRSHPSYEEWKKLKEKEKQDEKHAD* |
| JGI11772J19994_10049402 | 3300001748 | Saline Water And Sediment | LTSKQRSGKLVWKRGDGWIQFNPPRSHPSYEEWQKLKQKEKEKENGSKD* |
| JGI11772J19994_10126943 | 3300001748 | Saline Water And Sediment | LTSKQLSGKLVWKRGDGWIQFNPPRSHPSYEEWQKLKQKQKENENE* |
| JGI26082J51739_100395163 | 3300003617 | Marine | MSKLVWKRGDGWVQYNPPRSHPSYEEWQKLKQKEKEKDNED* |
| JGI26085J52751_10115161 | 3300003908 | Marine | LTSQQLSGKLVWKRGDGWXQYNPPRSHPSYEEWQKLKQKEKEKDNEGRPD* |
| Ga0055584_1011722882 | 3300004097 | Pelagic Marine | MSKLVWKRGDGWVQYNPPRSHPSYAEWQKLKEKEAKEGEGK* |
| Ga0065726_1274516 | 3300004369 | Saline | MSKLVWKRGDGWVQYNPPRSHPSYEEWQKLKEKEAKEGESN* |
| Ga0065861_10635992 | 3300004448 | Marine | MSKLVWKRGDGWVQYNPPRSHPSYEEWQKLKEKEAKEGEGK* |
| Ga0074648_100070214 | 3300005512 | Saline Water And Sediment | MSKLVWKRGDGWVQYNPPRSHPSYEEWQKLKEKDAEKVRS* |
| Ga0074648_100118838 | 3300005512 | Saline Water And Sediment | LTLKQRSGKLVWKRGDGWIQFNPPRSHPSYEEWQKLKQKEKEKENGSKD* |
| Ga0074648_10412942 | 3300005512 | Saline Water And Sediment | LTSKQHSGKLAWKRGDGWVQFNPPRSHPSYEEWQKLKQKEKENENE* |
| Ga0074648_10557025 | 3300005512 | Saline Water And Sediment | LTSKQLSVKLVWKRGDGWIQFNPPRSHPSYEEWQKLKQKEKENENEG* |
| Ga0076926_1331532 | 3300005738 | Marine | LTSKQRSDKLVWKRGEGWVQYNPPRSHPSYEEWKKLKEKEKENE* |
| Ga0076924_10232892 | 3300005747 | Marine | LTSQQLSGKLVWKRGDGWVQFNPPRSHPSYEEWQKLKQKQKENENER* |
| Ga0076924_12304663 | 3300005747 | Marine | VPQVSVRLLTSQRPNPKLVWKRGDGWVQYNPPRSHPSYEEWQKLKEKEKEKDG* |
| Ga0075474_100187485 | 3300006025 | Aqueous | LTSKQHSGKLAWKRGDGWIQFNPPRSHPSYEEWQKLKQKEKENENE* |
| Ga0075474_101175532 | 3300006025 | Aqueous | LTSKQLSVKLVWKRGDGWIQFNPPRSHPSYEEWQKLKQKEKENENE* |
| Ga0075474_101755763 | 3300006025 | Aqueous | LTSKQLSGKLVWKRGDGWVQYNPPRSHPSYEEWKKLKQKEKENENE* |
| Ga0075474_102553753 | 3300006025 | Aqueous | SSGFERSMSKLVWKRGDGWVQYNPPRSHPSYAEWQKLKEKEAKEGEGK* |
| Ga0075474_102624203 | 3300006025 | Aqueous | LTSQQLSGKLVWKRGDGWVQFNPPRSHPSYEEWQKLKLKQKENENE* |
| Ga0075478_101448053 | 3300006026 | Aqueous | MSKLVWKRGDGWVQYNPPRSHPSYEEWQKLREKEAKEGEGK* |
| Ga0075478_102578203 | 3300006026 | Aqueous | MSKLVWKRGEGWVQYNPPRSHPSYAEWQKLKEKEAKEGEGK* |
| Ga0075462_100354303 | 3300006027 | Aqueous | LTSKQLSGKLVWKRGDGWVQFNPPRSHPSYEEWQKLKQKQKENENE* |
| Ga0075461_102482343 | 3300006637 | Aqueous | LTSQQLSGKLVWKRGDGWVQFNPPRSHPSYEEWQKLKQKEKENKDEA* |
| Ga0098038_12114072 | 3300006735 | Marine | LPQRSDKLIWKRGDGWVQYNPPRHHPQYEEWMKLKEKEKENEAKDD* |
| Ga0098042_10064264 | 3300006749 | Marine | MSDKLAWKRGDGWVQFNPPRGHPQYEEWMKKKQKEKEKENGS* |
| Ga0070749_102113392 | 3300006802 | Aqueous | LTSKQRSDKLVWKRGDGWVQYNPPRSHPSYEEWQKLKEKEKENEKHAD* |
| Ga0070749_103120042 | 3300006802 | Aqueous | MSKLVWKRGDGWVQYNPPRSHPSYEEWQKLKEKEAKEGEG |
| Ga0070749_103166572 | 3300006802 | Aqueous | LTSRQLSVKLVWKRGDGWIQFNPPRSHPSYEEWQKLKQKEKENDNG* |
| Ga0070749_104809962 | 3300006802 | Aqueous | LTSQQLSGKLVWKRGDGWIQFNPPRSHPSYEEWQKLKQKQKENENE* |
| Ga0070749_107704023 | 3300006802 | Aqueous | LTSKQLSGKLVWKRGDGWVQFNPPRSHPFYEEWQKLKQKEKENENE* |
| Ga0070754_100319635 | 3300006810 | Aqueous | MKKKPDKPQKLVWKRREGSIQFNPPRSHPSYEEWQKLKEKAKENE* |
| Ga0070754_103878334 | 3300006810 | Aqueous | KRGDGWVQFNPPRSHPSYEEWQKLKQKEKENGNTDSS* |
| Ga0070754_104344643 | 3300006810 | Aqueous | KHMKKKPDKPQKLVWKRREGSIQFNPPRSHPSYEEWQKLKEKAKEND* |
| Ga0070754_104978662 | 3300006810 | Aqueous | LTSKQLSVKLVWKRGDGWIQFNPPRSHPSYEEWQKLKLKQKENENE* |
| Ga0075476_1000101617 | 3300006867 | Aqueous | MKKKPDKPQKLVWKRREGSIQFNPPRSHPSYEEWQKLKEKAKEND* |
| Ga0075476_101215294 | 3300006867 | Aqueous | LTSQQLSGKLVWKRGDGWIQFNPPRSHPSYEEWQKLKQKEKENKDGNL* |
| Ga0075477_103570133 | 3300006869 | Aqueous | LTSQQLSGKLVWKRGDGWIQFNPPRSHPSYEEWQKLKQKQKENENER* |
| Ga0070750_100778002 | 3300006916 | Aqueous | LTSKQHSDKLVWKRGDGWVQYNPPRSHPSYEEWKKLKEKEKENEKHAD* |
| Ga0070750_100784092 | 3300006916 | Aqueous | LTSQQRSGKLVWKRGDGWVQYNPPRSHPSYEEWQKLKEKEKENEKHAD* |
| Ga0070750_103240821 | 3300006916 | Aqueous | LTSQQLSGKLVWKRGDGWVQFNPPRSHPSYEEWQKLKQKEKENKDGNL* |
| Ga0070750_104538623 | 3300006916 | Aqueous | LTSQQLSGKLVWKRGDGWIQFNPPRSHPSYEEWQKLKQKEKENENE* |
| Ga0070750_104924412 | 3300006916 | Aqueous | LTSKQHSDKLVWKRGDGWVQYNPPRSHPSYEEWKKLKEKEKQDEKHAD* |
| Ga0070752_12035432 | 3300007345 | Aqueous | MSKLVWKRGDGWVQYNPPRSHPSYTEWQKLKEKEAKEGEGK* |
| Ga0099851_11070611 | 3300007538 | Aqueous | KRGDGWVQFNPPRSHPSYEEWQKLKQKEKEKQNDG* |
| Ga0099849_11110762 | 3300007539 | Aqueous | MSKLVWKRGDGWVQYNPPRSHPSYAEWQKLKEKEAKEGEGS* |
| Ga0099849_11136551 | 3300007539 | Aqueous | LVWKRGDGWVQFNPPRSHPNYEEWQKLKQKHKENENE* |
| Ga0099849_13279381 | 3300007539 | Aqueous | KRGDGWVQYNPPRSHPSYEEWQKLKEKDAEKVRS* |
| Ga0099847_12228652 | 3300007540 | Aqueous | PNPKLVWKRGDGWVQYNPPRSHPSYEEWQKLKEKEKENDG* |
| Ga0070751_11107951 | 3300007640 | Aqueous | KLVWKRGDGWVQYNPPRSHPSYKEWQKLKEKDAEKVRS* |
| Ga0070751_11978321 | 3300007640 | Aqueous | SGKLVWKRGDGWIQFNPPRSHPSYEEWQKLKLKQKENENE* |
| Ga0102957_12590661 | 3300009027 | Pond Water | MSKLVWKRGDGWVQYNPPRSHPSYEEWQKLKEKEGKEK* |
| Ga0129348_10824974 | 3300010296 | Freshwater To Marine Saline Gradient | MSKLVWKRGDGWVQYNPPRSHPSYAEWQKLKEKKAKEGEGK* |
| Ga0129351_11027423 | 3300010300 | Freshwater To Marine Saline Gradient | LRSSGLERSMSKLVWKRGDGWVQYNPPRSHPSYEEWQKLKEKEAKEGEGK* |
| Ga0136655_11250461 | 3300010316 | Freshwater To Marine Saline Gradient | KLIWKQGDGWIIFNPPRSHPLYDEWQKLKEKEKENEQRD* |
| Ga0163110_117938254 | 3300012928 | Surface Seawater | MSDKLAWKRGDGWVQFNPPRGHPQYEEWMKKRKEK |
| Ga0129327_108380182 | 3300013010 | Freshwater To Marine Saline Gradient | LVWKRGDGWVQYNPPRSHPSYAEWQKLKEKEAKEGEGK* |
| Ga0181373_10022515 | 3300017721 | Marine | MSDKLAWKRGDGWVQFNPPRGHPQYEEWMKKKQKEKEKENGS |
| Ga0181381_10652711 | 3300017726 | Seawater | SKQHSDKLVWKRGDGWVQYNPPRSHPSYEEWKKLKEKEKQDEKHAD |
| Ga0181433_11467701 | 3300017739 | Seawater | KLMWKRGDGWVQYNPNPHHPCYEEWMKQKEKEKENEAKDD |
| Ga0181393_10850341 | 3300017748 | Seawater | KQRSDKLVWKRGDGWVQYNPPRSHPSYEEWKKLKEKEKENEKDSN |
| Ga0181552_102455464 | 3300017824 | Salt Marsh | MSKLVWKRGDGWVQYNPPRSHPSYAEWQKLKEKEAKEGEGK |
| Ga0181552_103313721 | 3300017824 | Salt Marsh | VWKRGDGWIQFNPPRSHPSYEEWQKLKQKEKENENE |
| Ga0181577_105618783 | 3300017951 | Salt Marsh | GDGWIQFNPPRSHPSYEEWHKLKQKLQEKEKEDDN |
| Ga0181560_100765977 | 3300018413 | Salt Marsh | MSKLVWKRGDGWVQYNPPRNHPSYAEWQKLKEKEAKEGEGK |
| Ga0181559_100831862 | 3300018415 | Salt Marsh | MSKLVWKRGDGWVQYNPPRSHPSYEEWQKLKEKEAKEGEGK |
| Ga0181558_101274961 | 3300018417 | Salt Marsh | MSKLVWKRGDGWVQYNPPRSHPSYAEWHKLKEKEAKEGEGK |
| Ga0181558_102251621 | 3300018417 | Salt Marsh | QQLSGKLVWKRGDGWVQFNPPRSHPSYEEWQKLKQKEKENKDV |
| Ga0181558_104734451 | 3300018417 | Salt Marsh | QQLSGKLVWKRGDGWVQFNPPRSHPSYEEWQKLKQKEKENKDGNL |
| Ga0181591_102534016 | 3300018424 | Salt Marsh | MSKLVWKRGDGWVQYNPPRSHPSYAEWQKLNEKEAKEGEGKCVAGIVKVK |
| Ga0181562_100145198 | 3300019459 | Salt Marsh | MSKLVWKRGDGWVQYNPPRSHPSYKEWQKLKEKDAEKVRS |
| Ga0213862_100991541 | 3300021347 | Seawater | TSQQLSGKLVWKRGDGWVQFNPPRSHPSYEEWQKLKQKEKEKEDEGRPN |
| Ga0222718_100316622 | 3300021958 | Estuarine Water | VWKRGDGWVQYNPPHSHPSYEEWQKLKEREKEKDG |
| Ga0222718_100429635 | 3300021958 | Estuarine Water | MSELIWKRGDGWVQYNPPRSHPSYEEWQKLKEKERKEK |
| Ga0222718_102878052 | 3300021958 | Estuarine Water | MSKLVWKRGDGWVQFNPPRSHPSYEEWRKLKEKEAKDNEVLPLQK |
| Ga0222716_100683902 | 3300021959 | Estuarine Water | MSKLVWKRGDGWVQYSPPRSHPSYEEWQKLKEKEAKEGEGK |
| Ga0222715_100997952 | 3300021960 | Estuarine Water | MSKLVWKRGDGWVQYNPPRSHPSYEEWQKLKQKEKEKDDEGRPD |
| Ga0222715_103175172 | 3300021960 | Estuarine Water | MSELVWKRGDGWVQYNPPRSHPSYEEWQKLKEKERKEK |
| Ga0222713_101983953 | 3300021962 | Estuarine Water | SQRPNPKLVWKRGDCWVQYNPPHSHPSYEEWQKLKEREKEKDG |
| Ga0222719_100243818 | 3300021964 | Estuarine Water | MSKLIWKRGDSWVQYNPPRSHPSYAEWQKLKEKEAKEGEGK |
| Ga0222719_101386971 | 3300021964 | Estuarine Water | KLVWKRGDGWVQYNPPRSHPSYEEWQKLKQKEKEKENE |
| Ga0222719_105288613 | 3300021964 | Estuarine Water | ERSMSKLVWKRGDGWVQFNPPRSHPSYEEWRKLKEKEAKDNELLPLQK |
| Ga0222719_107217602 | 3300021964 | Estuarine Water | LTSQQLSGKLVWKRGDGWVQFNPPRSHPSYEEWQKLKQKEKENKDDESKGSL |
| Ga0196895_10023261 | 3300022067 | Aqueous | GGKLVWKRGDGWVQFNPPRSHPSYEEWQKLKLKQKENENE |
| Ga0212021_11220411 | 3300022068 | Aqueous | MSKLVWKRGDGWVQYNPPRSHPSYAEWQKLKEKEA |
| Ga0212028_10371993 | 3300022071 | Aqueous | MKKKPDKPQKLVWKRREGSIQFNPPRSHPSYEEWQKLKEKAKEND |
| Ga0224906_10015853 | 3300022074 | Seawater | MSKKEEKSAWKRGEGWVQYNPPRYHPCYSEWIKLKQQKEKDDAG |
| Ga0196897_10009516 | 3300022158 | Aqueous | GKLVWKRGDGWVQFNPPRSHPSYEEWQKLKLKQKENENE |
| Ga0212027_10420931 | 3300022168 | Aqueous | SGKLVWKRGDGWVQFNPPRSHPSYEEWQKLKQKEKENENER |
| Ga0196899_10094227 | 3300022187 | Aqueous | RSMSKLVWKRGDGWVQYNPPRSHPSYEEWQKLKEKEAKEGEGK |
| Ga0196901_11854443 | 3300022200 | Aqueous | MSKLVWKRGDGWVQFNPPRSHPSYEEWRKLKEKEAKEGEGK |
| Ga0255752_101660394 | 3300022929 | Salt Marsh | LVWKRGDGWIQFNPPRSHPSYEEWQKLKQKQKENENE |
| Ga0255778_102308704 | 3300023084 | Salt Marsh | GEGWIQFNPPRNHPSYQEWQKLKQKHKEKQNERTID |
| Ga0255768_101261422 | 3300023180 | Salt Marsh | MSKLVWKRGDGWVQYNPPRSHPSYAEWKKLKEKEAKEGEGK |
| Ga0209992_103748203 | 3300024344 | Deep Subsurface | MSKKKGKLAWKRGDGWVQYNPPRHHPCYDEWSKKREKEANELR |
| (restricted) Ga0255046_105154641 | 3300024519 | Seawater | MSKLVWKRGDGWVQFNPPRSHPSYEEWRKLKEKEAKDNELL |
| Ga0209535_10972231 | 3300025120 | Marine | KLVWKRGDGWVQYNPPRSHPSYEEWKKLKEKEKENEKDSN |
| Ga0208303_10834663 | 3300025543 | Aqueous | LTSQQLSGKLVWKRGDGWVQFNPPRSHPSYEEWQKLKQKQKENENE |
| Ga0208149_11023743 | 3300025610 | Aqueous | MKKKPDKPQKLVWKRREGSIQFNPPRSHPSYEEWQKLKEKA |
| Ga0208149_11222793 | 3300025610 | Aqueous | DKPQKLVWKRREGSIQFNPPRSHPSYEEWQKLKEKAKENE |
| Ga0208898_10026063 | 3300025671 | Aqueous | MKKKPDKPQKLVWKRREGSIQFNPPRSHPSYEEWQKLKEKAKENE |
| Ga0208019_11035944 | 3300025687 | Aqueous | RSMSKLVWKRGDGWVQFNPPRSHPSYEEWRKLKEKEAKEGEGK |
| Ga0208150_10056877 | 3300025751 | Aqueous | SSGLERSMSKLVWKRGDGWVQYNPPRSHPSYAEWQKLKEKEAKEGEGK |
| Ga0209137_10717453 | 3300025767 | Marine | MSKLVWKRGDGWVQYNPPRSHPSYEEWQKLKQKEKEKDNED |
| Ga0208547_10462171 | 3300025828 | Aqueous | KPDKPQKLVWKRREGSIQFNPPRSHPSYEEWQKLKEKAKEND |
| Ga0208547_11214473 | 3300025828 | Aqueous | MKKKPDKPQKLVWKRREGSIQFNPPRSHPSYEEWQKLKEKAKEN |
| Ga0208547_12109723 | 3300025828 | Aqueous | LTSQQLSGKLVWKRGDGWIQFNPPRSHPSYEEWQKLKQKQKENENE |
| Ga0208645_12480441 | 3300025853 | Aqueous | LVWKRGDGWVQYNPPRSHPSYEEWQKLKQKEKENGNTDSS |
| Ga0208645_12601961 | 3300025853 | Aqueous | KLVWKRREGSIQFNPPRSHPSYEEWQKLKEKAKENE |
| Ga0348335_080027_1_126 | 3300034374 | Aqueous | LSGKLVWKRGDGWVQYNPPRSHPSYEEWQKLKQKEKENENE |
| ⦗Top⦘ |