


| Basic Information | |
|---|---|
| Family ID | F079259 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 116 |
| Average Sequence Length | 42 residues |
| Representative Sequence | LEEVQQKVAAAKKNGRKNALVRVEREGNTRFIALPFEAG |
| Number of Associated Samples | 101 |
| Number of Associated Scaffolds | 116 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.59 % |
| % of genes near scaffold ends (potentially truncated) | 96.55 % |
| % of genes from short scaffolds (< 2000 bps) | 93.10 % |
| Associated GOLD sequencing projects | 97 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (88.793 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (38.793 % of family members) |
| Environment Ontology (ENVO) | Unclassified (39.655 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.552 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 17.91% β-sheet: 23.88% Coil/Unstructured: 58.21% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 116 Family Scaffolds |
|---|---|---|
| PF01558 | POR | 12.93 |
| PF00535 | Glycos_transf_2 | 6.90 |
| PF02775 | TPP_enzyme_C | 4.31 |
| PF13649 | Methyltransf_25 | 1.72 |
| PF08241 | Methyltransf_11 | 0.86 |
| PF02771 | Acyl-CoA_dh_N | 0.86 |
| PF00027 | cNMP_binding | 0.86 |
| PF13180 | PDZ_2 | 0.86 |
| PF01144 | CoA_trans | 0.86 |
| PF04909 | Amidohydro_2 | 0.86 |
| PF02148 | zf-UBP | 0.86 |
| PF03466 | LysR_substrate | 0.86 |
| PF05598 | DUF772 | 0.86 |
| COG ID | Name | Functional Category | % Frequency in 116 Family Scaffolds |
|---|---|---|---|
| COG1014 | Pyruvate:ferredoxin oxidoreductase or related 2-oxoacid:ferredoxin oxidoreductase, gamma subunit | Energy production and conversion [C] | 12.93 |
| COG1788 | Acyl CoA:acetate/3-ketoacid CoA transferase, alpha subunit | Lipid transport and metabolism [I] | 0.86 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.86 |
| COG2057 | Acyl-CoA:acetate/3-ketoacid CoA transferase, beta subunit | Lipid transport and metabolism [I] | 0.86 |
| COG4670 | Acyl CoA:acetate/3-ketoacid CoA transferase | Lipid transport and metabolism [I] | 0.86 |
| COG5207 | Uncharacterized Zn-finger protein, UBP-type | General function prediction only [R] | 0.86 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 88.79 % |
| Unclassified | root | N/A | 11.21 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300003219|JGI26341J46601_10074528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 1021 | Open in IMG/M |
| 3300004082|Ga0062384_101386161 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 517 | Open in IMG/M |
| 3300005179|Ga0066684_10945654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 560 | Open in IMG/M |
| 3300005332|Ga0066388_100308384 | All Organisms → cellular organisms → Bacteria | 2229 | Open in IMG/M |
| 3300005437|Ga0070710_10314792 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 1026 | Open in IMG/M |
| 3300005553|Ga0066695_10753601 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300005554|Ga0066661_10104529 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1697 | Open in IMG/M |
| 3300005559|Ga0066700_10805982 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300005560|Ga0066670_10492269 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 754 | Open in IMG/M |
| 3300005569|Ga0066705_10934514 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Salinarimonadaceae → Salinarimonas → Salinarimonas rosea | 514 | Open in IMG/M |
| 3300005587|Ga0066654_10026502 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2374 | Open in IMG/M |
| 3300005587|Ga0066654_10337605 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 817 | Open in IMG/M |
| 3300005764|Ga0066903_101403035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1312 | Open in IMG/M |
| 3300005764|Ga0066903_101573254 | All Organisms → cellular organisms → Bacteria | 1245 | Open in IMG/M |
| 3300006163|Ga0070715_10470238 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 714 | Open in IMG/M |
| 3300006175|Ga0070712_100584763 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 944 | Open in IMG/M |
| 3300006806|Ga0079220_11211299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 624 | Open in IMG/M |
| 3300009038|Ga0099829_11347630 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300009088|Ga0099830_10508836 | All Organisms → cellular organisms → Bacteria | 983 | Open in IMG/M |
| 3300009137|Ga0066709_100285146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → Candidatus Accumulibacter vicinus | 2233 | Open in IMG/M |
| 3300009137|Ga0066709_103034911 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300009137|Ga0066709_103432275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Roseobacter → unclassified Roseobacter → Roseobacter sp. H9 | 575 | Open in IMG/M |
| 3300009553|Ga0105249_11877147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 672 | Open in IMG/M |
| 3300009698|Ga0116216_10683096 | Not Available | 617 | Open in IMG/M |
| 3300010047|Ga0126382_10091926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1933 | Open in IMG/M |
| 3300010048|Ga0126373_11275589 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 801 | Open in IMG/M |
| 3300010322|Ga0134084_10306447 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300010341|Ga0074045_10247542 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1180 | Open in IMG/M |
| 3300010361|Ga0126378_13150656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 525 | Open in IMG/M |
| 3300012198|Ga0137364_10737248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 744 | Open in IMG/M |
| 3300012202|Ga0137363_11589242 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 546 | Open in IMG/M |
| 3300012205|Ga0137362_10221471 | Not Available | 1632 | Open in IMG/M |
| 3300012205|Ga0137362_10302096 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1386 | Open in IMG/M |
| 3300012285|Ga0137370_10363435 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 872 | Open in IMG/M |
| 3300012361|Ga0137360_10347704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1241 | Open in IMG/M |
| 3300012362|Ga0137361_11306535 | Not Available | 650 | Open in IMG/M |
| 3300012582|Ga0137358_10461715 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 857 | Open in IMG/M |
| 3300012685|Ga0137397_11111243 | Not Available | 575 | Open in IMG/M |
| 3300012917|Ga0137395_10556084 | Not Available | 828 | Open in IMG/M |
| 3300012976|Ga0134076_10420254 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 599 | Open in IMG/M |
| 3300013772|Ga0120158_10341011 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300015242|Ga0137412_10603450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 831 | Open in IMG/M |
| 3300016319|Ga0182033_10472787 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1073 | Open in IMG/M |
| 3300016371|Ga0182034_11048900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 705 | Open in IMG/M |
| 3300016387|Ga0182040_11368262 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 599 | Open in IMG/M |
| 3300016422|Ga0182039_12235276 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 505 | Open in IMG/M |
| 3300017975|Ga0187782_11288392 | Not Available | 573 | Open in IMG/M |
| 3300018062|Ga0187784_10890067 | Not Available | 709 | Open in IMG/M |
| 3300018431|Ga0066655_11055874 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300018468|Ga0066662_12276333 | Not Available | 569 | Open in IMG/M |
| 3300020579|Ga0210407_11229868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 562 | Open in IMG/M |
| 3300020580|Ga0210403_11283176 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 560 | Open in IMG/M |
| 3300021362|Ga0213882_10225003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 776 | Open in IMG/M |
| 3300021388|Ga0213875_10225346 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 883 | Open in IMG/M |
| 3300021401|Ga0210393_10077635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2628 | Open in IMG/M |
| 3300021402|Ga0210385_10734417 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 756 | Open in IMG/M |
| 3300022722|Ga0242657_1211854 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 540 | Open in IMG/M |
| 3300022722|Ga0242657_1232156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 522 | Open in IMG/M |
| 3300022724|Ga0242665_10289470 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 570 | Open in IMG/M |
| 3300023547|Ga0247554_103789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 600 | Open in IMG/M |
| 3300023660|Ga0247550_100822 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 881 | Open in IMG/M |
| 3300025910|Ga0207684_11610142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 526 | Open in IMG/M |
| 3300026494|Ga0257159_1042852 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 764 | Open in IMG/M |
| 3300026555|Ga0179593_1155567 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 3617 | Open in IMG/M |
| 3300026988|Ga0207834_1005912 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1975 | Open in IMG/M |
| 3300027029|Ga0208731_1015363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 806 | Open in IMG/M |
| 3300027846|Ga0209180_10311752 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium | 901 | Open in IMG/M |
| 3300029636|Ga0222749_10333255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 791 | Open in IMG/M |
| 3300029701|Ga0222748_1035205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 804 | Open in IMG/M |
| 3300031474|Ga0170818_101393002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 610 | Open in IMG/M |
| 3300031546|Ga0318538_10179134 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1127 | Open in IMG/M |
| 3300031561|Ga0318528_10040966 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2316 | Open in IMG/M |
| 3300031564|Ga0318573_10054674 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1959 | Open in IMG/M |
| 3300031572|Ga0318515_10101459 | Not Available | 1509 | Open in IMG/M |
| 3300031640|Ga0318555_10727541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 536 | Open in IMG/M |
| 3300031668|Ga0318542_10090088 | Not Available | 1467 | Open in IMG/M |
| 3300031668|Ga0318542_10223703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 953 | Open in IMG/M |
| 3300031724|Ga0318500_10465309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 633 | Open in IMG/M |
| 3300031744|Ga0306918_10142142 | Not Available | 1763 | Open in IMG/M |
| 3300031770|Ga0318521_10383723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 836 | Open in IMG/M |
| 3300031770|Ga0318521_10497273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 732 | Open in IMG/M |
| 3300031771|Ga0318546_11260976 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 519 | Open in IMG/M |
| 3300031781|Ga0318547_10233749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1105 | Open in IMG/M |
| 3300031781|Ga0318547_10980120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 528 | Open in IMG/M |
| 3300031792|Ga0318529_10436191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 610 | Open in IMG/M |
| 3300031794|Ga0318503_10149570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 752 | Open in IMG/M |
| 3300031821|Ga0318567_10574053 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 640 | Open in IMG/M |
| 3300031832|Ga0318499_10205511 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 768 | Open in IMG/M |
| 3300031833|Ga0310917_10018541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 3964 | Open in IMG/M |
| 3300031833|Ga0310917_10453901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 872 | Open in IMG/M |
| 3300031846|Ga0318512_10193188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 993 | Open in IMG/M |
| 3300031879|Ga0306919_10021053 | Not Available | 3946 | Open in IMG/M |
| 3300031880|Ga0318544_10160189 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 864 | Open in IMG/M |
| 3300031893|Ga0318536_10225227 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 954 | Open in IMG/M |
| 3300031896|Ga0318551_10352840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 833 | Open in IMG/M |
| 3300031897|Ga0318520_10416615 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 822 | Open in IMG/M |
| 3300031897|Ga0318520_10467192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 776 | Open in IMG/M |
| 3300031897|Ga0318520_10869511 | Not Available | 567 | Open in IMG/M |
| 3300031910|Ga0306923_10293473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1858 | Open in IMG/M |
| 3300031912|Ga0306921_10803014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1074 | Open in IMG/M |
| 3300031912|Ga0306921_11102034 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 890 | Open in IMG/M |
| 3300031942|Ga0310916_10207299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1642 | Open in IMG/M |
| 3300032041|Ga0318549_10463000 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 571 | Open in IMG/M |
| 3300032052|Ga0318506_10305619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 705 | Open in IMG/M |
| 3300032064|Ga0318510_10137691 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 956 | Open in IMG/M |
| 3300032068|Ga0318553_10426693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 694 | Open in IMG/M |
| 3300032076|Ga0306924_11639099 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 676 | Open in IMG/M |
| 3300032089|Ga0318525_10340262 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 770 | Open in IMG/M |
| 3300032091|Ga0318577_10345505 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 711 | Open in IMG/M |
| 3300032091|Ga0318577_10430410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 630 | Open in IMG/M |
| 3300032205|Ga0307472_101000285 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 783 | Open in IMG/M |
| 3300032261|Ga0306920_103382644 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 593 | Open in IMG/M |
| 3300032892|Ga0335081_11840392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 653 | Open in IMG/M |
| 3300033158|Ga0335077_10796725 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 963 | Open in IMG/M |
| 3300033158|Ga0335077_11297574 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 707 | Open in IMG/M |
| 3300033289|Ga0310914_11379891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 607 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 38.79% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 12.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.90% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.31% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.45% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.45% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.59% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.59% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.72% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.72% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.72% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.86% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.86% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.86% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.86% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.86% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.86% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.86% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.86% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.86% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.86% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300003219 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021362 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09 | Environmental | Open in IMG/M |
| 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Host-Associated | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023547 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023660 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026494 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-A | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300026988 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 5 (SPAdes) | Environmental | Open in IMG/M |
| 3300027029 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF045 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029701 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI26341J46601_100745282 | 3300003219 | Bog Forest Soil | SLEEVQQKIAAARKNGRKNVLVRVERESSARFIALPFEAG* |
| Ga0062384_1013861612 | 3300004082 | Bog Forest Soil | DLLVAVGHEAVGSLEEVQQKVAAAKKNGRKNALVRVEREGSTRFIALPFEAGGRG* |
| Ga0066684_109456542 | 3300005179 | Soil | HEAVAAPEDVQQKAAVAKKNGRKNVLVRVEREGNSRFIALPLETS* |
| Ga0066388_1003083841 | 3300005332 | Tropical Forest Soil | PEEVAQLVAGARKNGHRNVLVRVEREGNSRFVALPVETG* |
| Ga0070710_103147922 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | VAAPEEVQQKAAAAKKNGRRNVLVRVEREGNSRFIALPLETG* |
| Ga0066695_107536012 | 3300005553 | Soil | ANPEDVPGLVAGAKKAGHKNILLRVEREGNSRFVALPVEAG* |
| Ga0066661_101045293 | 3300005554 | Soil | ANPEDVPGLVAGAKKAGHKNILVRVEREGNTRFVALPTETS* |
| Ga0066700_108059822 | 3300005559 | Soil | GLVAGAKKAGHKNILVRVEREGNTRFVALPTETS* |
| Ga0066670_104922691 | 3300005560 | Soil | SAVANPEDLPQLVAGARKHGRKNVLVRVEREGSSRFVALPLETG* |
| Ga0066705_109345141 | 3300005569 | Soil | RSAVANPEDVPQLIAGARKNGHRNVLVRVEREGSSRFVALPVETG* |
| Ga0066654_100265024 | 3300005587 | Soil | ANPEQVPQLAAAARKAGQKKVLVRVEREGNTRFVALPVVETG* |
| Ga0066654_103376052 | 3300005587 | Soil | VANPEDVPQLIAGARKNGHRNVLVRVEREGSSRFVALPVETG* |
| Ga0066903_1014030352 | 3300005764 | Tropical Forest Soil | DLQQKIAAAKKSGHRNVLVRVEREGNTRFVALPLEAG* |
| Ga0066903_1015732542 | 3300005764 | Tropical Forest Soil | EEVQQKVAAAKKNGHKNALVRVEREGNTRFIALPFEAG* |
| Ga0070715_104702381 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | EVQQKAAAAKKNGRRNVLVRVEREGNSRFIALPLETG* |
| Ga0070712_1005847632 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | HESVGSLEELQQKVAAARKNGRKNVILRVEREGNTRFIALPFEAG* |
| Ga0079220_112112991 | 3300006806 | Agricultural Soil | QKAAAAKKNGRKNVLVRVEREGNSRFVALPLETS* |
| Ga0099829_113476301 | 3300009038 | Vadose Zone Soil | VANPEDVPGLVAGAKKAGHKNILLRVEREGNSRFVALPLEAG* |
| Ga0099830_105088361 | 3300009088 | Vadose Zone Soil | VSQLAAGARKAGQKRALVRVEREGNTRFVALPIEAG* |
| Ga0066709_1002851462 | 3300009137 | Grasslands Soil | SLEELQQKVGAARKTGRKNVILRVEREGNTRFIALPFEAG* |
| Ga0066709_1030349112 | 3300009137 | Grasslands Soil | PDAVPPLLGEAKKVGRKKLLVRVEREGNTRFVALPVEPG* |
| Ga0066709_1034322752 | 3300009137 | Grasslands Soil | GHAAVANPEDVPGLVAGAKKAGHKNILVRVEREGNTRFVALPTETS* |
| Ga0105249_118771471 | 3300009553 | Switchgrass Rhizosphere | EDMQQKVAAAKKVGHKNVLVRVEREGTTRFVALPLEIG* |
| Ga0116216_106830962 | 3300009698 | Peatlands Soil | VGSSLVSTPEEIQQKAAAAKKIGRNELLVRVERDGITRFVALPAEGG* |
| Ga0126382_100919262 | 3300010047 | Tropical Forest Soil | PVATTDELQQKLAALKKVGHKNVLIRVEREGNSRFVALPLETG* |
| Ga0126373_112755892 | 3300010048 | Tropical Forest Soil | SLEEVQQKVAASKKNGRKNVLVRVEREGNTRFIALPFEAG* |
| Ga0134084_103064471 | 3300010322 | Grasslands Soil | PEDVPQLIAGARKNGHRNVLVRVEREGSSRFVALPVETG* |
| Ga0074045_102475422 | 3300010341 | Bog Forest Soil | ESVATLEEAQQKLAAAKKNGRKNVLVRVEREGNSRFIALPLETG* |
| Ga0126378_131506562 | 3300010361 | Tropical Forest Soil | APEEVQQKAAAAKKNGRKNVLVRVEREGNSRFVALPLETG* |
| Ga0137364_107372482 | 3300012198 | Vadose Zone Soil | ESVGSPEELQQKIAAARKNGRKNIILRVEREGNTLFIALPFEAG* |
| Ga0137363_115892421 | 3300012202 | Vadose Zone Soil | EAVGALEEFQQKIAAAKKNGHKNILVRVEREGSTRFVALPLETG* |
| Ga0137362_102214711 | 3300012205 | Vadose Zone Soil | LEDLQQKLTAAKKNGHKNVLVRVEREGNTRFVALPLETA* |
| Ga0137362_103020962 | 3300012205 | Vadose Zone Soil | EELQQKVAAARKNGRKNVILRVEREGNTRFIALPFEAG* |
| Ga0137370_103634353 | 3300012285 | Vadose Zone Soil | VGRSAIANPEDLPPLVSGAKKHGRKNVLVRVEREGSSRFVALPLETS* |
| Ga0137360_103477042 | 3300012361 | Vadose Zone Soil | EPVGSLEELQQKVAAARKNGRKNVILRVEREGNTRFIALPFEAG* |
| Ga0137361_113065352 | 3300012362 | Vadose Zone Soil | PDEVSQLAAGARKAGQKRALVRVEREGNTRFVALPIEAG* |
| Ga0137358_104617152 | 3300012582 | Vadose Zone Soil | GHEPVGALEDLQQKLTAAKKNGHKNVLVRVEREGNTRFVALPLETA* |
| Ga0137397_111112432 | 3300012685 | Vadose Zone Soil | GRSAVANPEDFPPLVAGAKKHGRKNVLVRVEREGSSRFVALPLETS* |
| Ga0137395_105560842 | 3300012917 | Vadose Zone Soil | SPDEVSQLAAGARKAGQKRALVRVEREGNTRFVALPIEAG* |
| Ga0134076_104202541 | 3300012976 | Grasslands Soil | AAVDGPEAVTQFLAGAKRNGQKKVLVRVEREGNTRFVALPVETG* |
| Ga0120158_103410112 | 3300013772 | Permafrost | PEEMPQLAAAAKKAGQKKVLVRVEREGNTRFVALPLEAS* |
| Ga0137412_106034502 | 3300015242 | Vadose Zone Soil | QQKAAAAKKNGRKNVLVRVEREGNSRFIALPLETS* |
| Ga0182033_104727871 | 3300016319 | Soil | QQKVAAAKKSGHKNALVRVEREGNTRFIALPFEAG |
| Ga0182034_110489001 | 3300016371 | Soil | VGHELVGSLEEVQQKVAASKKNGRKNVLLRVEREGNTRFIALPFEAG |
| Ga0182040_113682622 | 3300016387 | Soil | GALEEFQQKVAAAKKNGHKNILVRVEREGNTRFVALPLETG |
| Ga0182039_122352762 | 3300016422 | Soil | EEVQQKVAAAKKSGHKNALVRVEREGNTRFIALPVEGG |
| Ga0187782_112883922 | 3300017975 | Tropical Peatland | VADADHQIAGAKKAGQKKLLVRVEREGNSRFVALPAEAG |
| Ga0187784_108900671 | 3300018062 | Tropical Peatland | IQKKAAAARKAGRKNLLVRVERGPTRRFVALPAEGG |
| Ga0066655_110558741 | 3300018431 | Grasslands Soil | PQLIAGARKNGHRNVLVRVEREGSSRFVALPVETG |
| Ga0066662_122763331 | 3300018468 | Grasslands Soil | VTTLEGAQQILAAAKKNGHKNVLVRVEREGNTRFVALPLETG |
| Ga0210407_112298682 | 3300020579 | Soil | GHEPIGSLEEVQQKVAAAKKNGHKNALVRVEREGNTRFIALPFETG |
| Ga0210403_112831761 | 3300020580 | Soil | LEAVTAPEEVQQKAAAAKKNGRKNVLVRVEREGNSRFVALPLETG |
| Ga0213882_102250031 | 3300021362 | Exposed Rock | GHEAVSAPEEVQQKAAAAKKNGRKNVLVRVEREGNSRFVALPLETS |
| Ga0213875_102253461 | 3300021388 | Plant Roots | APEEVQQKAAAAKKNGRKNVLVRVEREGNSRFVALPLETS |
| Ga0210393_100776351 | 3300021401 | Soil | EEVQQKAAAAKKNGRRNVLVRVEREGNSRFIALPLETG |
| Ga0210385_107344172 | 3300021402 | Soil | GVTTPDEMQQKAAASKKTGRKNVLVRVERDGITRFVALPAEGG |
| Ga0242657_12118542 | 3300022722 | Soil | AVAAPEEVQQKAAAAKKNGRRNVLVRVEREGNSRFIALPLETG |
| Ga0242657_12321561 | 3300022722 | Soil | AAPEEVQQKAAAAKKNGRKNVLVRVEREGNSRFVALPLETG |
| Ga0242665_102894701 | 3300022724 | Soil | AGAVTAPDEVQQKAAAAQKTARKNLLVRVERDGTTRFVALPAEGG |
| Ga0247554_1037891 | 3300023547 | Soil | RAPVATPEEVQQKATVSSKKGSKDLLVRVERDGNTRFVALPATGG |
| Ga0247550_1008222 | 3300023660 | Soil | AIGRAPVATPEEVQQKSAVSTKKGSKGLLVRVERDGNTRFVALPATGG |
| Ga0207684_116101422 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VQQTLASAKKNGHKNVLVRVEREGNTHFVALPFETG |
| Ga0257159_10428522 | 3300026494 | Soil | PVGALEDLQQKLTAAKKNGHKNVLVRVEREGNTRFVALPLETA |
| Ga0179593_11555677 | 3300026555 | Vadose Zone Soil | LPPLVSGAKKHGRKNVLVRVEREGSSRFVALPLETS |
| Ga0207834_10059123 | 3300026988 | Tropical Forest Soil | VVGSLEEVQQRIAVAKKNGHKNALVRVEREGSTRFIALPFETG |
| Ga0208731_10153632 | 3300027029 | Forest Soil | DEVQQKAAAAQKTARKNLLVRVERDGTTRFVALPAEGG |
| Ga0209180_103117521 | 3300027846 | Vadose Zone Soil | DEVSQLAAGAKKAGQKKALVRVEREGSTRFVALPIEAG |
| Ga0222749_103332552 | 3300029636 | Soil | AVGLEAVTAPEEVQQKAAAAKKNGRKNVLVRVEREGNSRFVALPLETG |
| Ga0222748_10352052 | 3300029701 | Soil | AVAAPEEVQQKAAAAKKNGRKNVLVRVEREGNSRFVALPLETG |
| Ga0170818_1013930022 | 3300031474 | Forest Soil | EAVAAPEEVQQKAAAAKKNGRKNVLVRVEREGNSRFVALPLETG |
| Ga0318538_101791342 | 3300031546 | Soil | LVIAVGHDPVTALEDLQQKIAAAKKNGHKNVLVRVEREGNSRFIALPLETG |
| Ga0318528_100409662 | 3300031561 | Soil | LVGSLEEVQQKVAASKKNGRKNVLVRVEREGNTRFIALPFEAG |
| Ga0318573_100546742 | 3300031564 | Soil | VGSLEEVQQKVAASKKNGRKNVLVRVEREGNTRFIALPFEAS |
| Ga0318515_101014591 | 3300031572 | Soil | IAIGHEPIGSLEEVQQKVAAAKKNGHKNALVRVEREGNTRFIALPFEAG |
| Ga0318555_107275411 | 3300031640 | Soil | EEVQQKLAAAKKGGHKNALVRVEREGNTRFIALPFEAG |
| Ga0318542_100900882 | 3300031668 | Soil | AVGGLEEVQQKLAAAKKNGHKNVLVRVEREGNTRFVALPLEAG |
| Ga0318542_102237031 | 3300031668 | Soil | QQKVAAAKKSGRKNALLRVEREGNTRFIALPFEAG |
| Ga0318500_104653091 | 3300031724 | Soil | SAPEEVQQKAAVAKKNGRKNVLVRVEREGNSRFVALPLETS |
| Ga0306918_101421421 | 3300031744 | Soil | GHEPIGSLEEVQQKVAAAKKNGHKNALVRVEREGNTRFIALPFEAG |
| Ga0318521_103837231 | 3300031770 | Soil | HEPIKSLEEVQQKLAAAKKGGHKNALVRVEREGNTRFIALSFEAG |
| Ga0318521_104972731 | 3300031770 | Soil | VQQKVAAAKKSGHKNALVRVEREGNTRFIALPFEAG |
| Ga0318546_112609762 | 3300031771 | Soil | LEELQQKVAAAKKIGHKNVLVRVEREGATRFVALPLEPG |
| Ga0318547_102337492 | 3300031781 | Soil | HDEVKSLEEVQQKVAAAKKSGHKNALVRVEREGNTRFIALPFEAG |
| Ga0318547_109801201 | 3300031781 | Soil | LEEVQQRLAAVKKNGHKNVLVRVEREGNTRFVALPVEAS |
| Ga0318529_104361911 | 3300031792 | Soil | EEVQQKVAASKKNGRKNVLVRVEREGNTRFIALPFEAG |
| Ga0318503_101495701 | 3300031794 | Soil | VGSLEEVQQKVAAAKKNGRKNALVRVEREGNTRFIALPFEAA |
| Ga0318567_105740532 | 3300031821 | Soil | LVTAVGHDPVTALDELQQKIAAAKKNGHKNVLLRVEREGNSRFIALPLETG |
| Ga0318499_102055112 | 3300031832 | Soil | HELVGSLEEVQQKVAASKKNGRKNVLVRVEREGNTRFIALPFEAG |
| Ga0310917_100185414 | 3300031833 | Soil | IAVGHELVGSLEEVQQKVAASKKNGRKNVLVRVEREGNTRFIALPFEAG |
| Ga0310917_104539012 | 3300031833 | Soil | SLEEVQQKVAGAKKNGHKNALVRVEREGNTRFIALPFETG |
| Ga0318512_101931882 | 3300031846 | Soil | EVQQKVAAAKKNGRKNALVRVEREGNTRFIALPFEAG |
| Ga0306919_100210531 | 3300031879 | Soil | AVTSLEEVQQKVAGAKKNGHKNALVRVEREGNTRFIALPFETG |
| Ga0318544_101601891 | 3300031880 | Soil | SLEEVQQKVAAAKKYGHKNALVRVEREGNTRFIALPFEAG |
| Ga0318536_102252272 | 3300031893 | Soil | VAIGHEPIKSLEEVQQKMAAAKKSGHKNALVRVEREGNTRFIALPFEAG |
| Ga0318551_103528401 | 3300031896 | Soil | LVAVGHEAVGGLEEVQQKLAAAKKNGHKNVLVRVEREGNTRFVALPLEAG |
| Ga0318520_104166151 | 3300031897 | Soil | LEEVQQKVAAAKKNGRKNALVRVEREGNTRFIALPFEAG |
| Ga0318520_104671922 | 3300031897 | Soil | VGSLEEVQQKVAASKKNGRKNVLVRVEREGNTRFIALPFEAG |
| Ga0318520_108695112 | 3300031897 | Soil | VSVGRAPVATPEEVQQKATVSAKKGGKDLLVRVERDGNIRFVALPVEGG |
| Ga0306923_102934731 | 3300031910 | Soil | EEVQQKLAAAKKNGHKNVLVRVEREGNTRFVALPLEAG |
| Ga0306921_108030142 | 3300031912 | Soil | LLVAVGHEAVGGLEEVQQKLAAAKKNGHKNVLVRVEREGNTRFVALPLEAG |
| Ga0306921_111020341 | 3300031912 | Soil | VQQKAAAAKKNGHKNVLVRVEREGNSRFVALPLETG |
| Ga0310916_102072992 | 3300031942 | Soil | VAIGREPIKSLEEVQQKLAAAKKGGHKNALVRVEREGNTRFIALPFEAG |
| Ga0318549_104630001 | 3300032041 | Soil | AVGHEGVGSLEEVQQKVAAAKKYGHKNALVRVEREGNTRFIALPFEAG |
| Ga0318506_103056192 | 3300032052 | Soil | HEAVSAPEEVQQKAAVAKKNGRKNVLVRVEREGNSRFVALPLETS |
| Ga0318510_101376912 | 3300032064 | Soil | LVGSLEEVQQKVAASKKNGRKNVLVRVEREGNTRFIALPFEAS |
| Ga0318553_104266932 | 3300032068 | Soil | EAVTSLEEVQQKVAGAKKNGHKNALVRVEREGNTRFIALPFETG |
| Ga0306924_116390991 | 3300032076 | Soil | VGHELVGSLEEVQQKVAASKKNGRKNVLVRVEREGNTRFIALPFEAS |
| Ga0318525_103402622 | 3300032089 | Soil | IIAIGHEPIGSLEEVQQKVAAAKKNGHKNALVRVEREGNTRFIALPFEAG |
| Ga0318577_103455051 | 3300032091 | Soil | GHDPVTALEDLQQKIAAAKKNGHKNVLVRVEREGNSRFIALPLETG |
| Ga0318577_104304102 | 3300032091 | Soil | VQQKVAAAKKNGHKNALVRVEREGNTRFIALPFEAG |
| Ga0307472_1010002852 | 3300032205 | Hardwood Forest Soil | ELQQKVAAARKNGRKNVILRVEREGNTRFIALPFEAG |
| Ga0306920_1033826442 | 3300032261 | Soil | QQKLAAAKKNGHKNALVRVEREGNTRFIALPFETG |
| Ga0335081_118403922 | 3300032892 | Soil | QQKIAAARKNGRKNVLVRVERESSARFIALPFEAG |
| Ga0335077_107967253 | 3300033158 | Soil | VVPPLVAAAKKAGLKKVLVRVEREGNTRFVALPLEAG |
| Ga0335077_112975741 | 3300033158 | Soil | GSLEEVQQKIAAARKNGRKNVLVRVERESSARFIALPFEAG |
| Ga0310914_113798911 | 3300033289 | Soil | QQKVAGAKKNGHKNALVRVEREGNTRFIALPFETG |
| ⦗Top⦘ |