


| Basic Information | |
|---|---|
| Family ID | F079255 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 116 |
| Average Sequence Length | 48 residues |
| Representative Sequence | PARYMRWSLPSLRRFMDKRPDLRVTLQGLVNRDLAGKLERLLS |
| Number of Associated Samples | 101 |
| Number of Associated Scaffolds | 116 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.88 % |
| % of genes near scaffold ends (potentially truncated) | 93.97 % |
| % of genes from short scaffolds (< 2000 bps) | 91.38 % |
| Associated GOLD sequencing projects | 97 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (62.931 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (13.793 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.138 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (37.931 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.48% β-sheet: 0.00% Coil/Unstructured: 53.52% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 116 Family Scaffolds |
|---|---|---|
| PF00206 | Lyase_1 | 23.28 |
| PF00881 | Nitroreductase | 5.17 |
| PF01663 | Phosphodiest | 3.45 |
| PF01872 | RibD_C | 2.59 |
| PF02518 | HATPase_c | 2.59 |
| PF02515 | CoA_transf_3 | 2.59 |
| PF00496 | SBP_bac_5 | 1.72 |
| PF04831 | Popeye | 1.72 |
| PF01547 | SBP_bac_1 | 1.72 |
| PF07690 | MFS_1 | 1.72 |
| PF12833 | HTH_18 | 1.72 |
| PF03200 | Glyco_hydro_63 | 1.72 |
| PF00072 | Response_reg | 0.86 |
| PF02604 | PhdYeFM_antitox | 0.86 |
| PF00196 | GerE | 0.86 |
| PF10415 | FumaraseC_C | 0.86 |
| PF01042 | Ribonuc_L-PSP | 0.86 |
| PF01590 | GAF | 0.86 |
| PF03916 | NrfD | 0.86 |
| PF00296 | Bac_luciferase | 0.86 |
| PF13229 | Beta_helix | 0.86 |
| PF01699 | Na_Ca_ex | 0.86 |
| PF02653 | BPD_transp_2 | 0.86 |
| PF07885 | Ion_trans_2 | 0.86 |
| COG ID | Name | Functional Category | % Frequency in 116 Family Scaffolds |
|---|---|---|---|
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 2.59 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 2.59 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 2.59 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.86 |
| COG0387 | Cation (Ca2+/Na+/K+)/H+ antiporter ChaA | Inorganic ion transport and metabolism [P] | 0.86 |
| COG0530 | Ca2+/Na+ antiporter | Inorganic ion transport and metabolism [P] | 0.86 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.86 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.86 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.86 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 64.66 % |
| Unclassified | root | N/A | 35.34 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000955|JGI1027J12803_105995840 | All Organisms → cellular organisms → Bacteria | 1145 | Open in IMG/M |
| 3300000956|JGI10216J12902_119420442 | Not Available | 698 | Open in IMG/M |
| 3300003993|Ga0055468_10311126 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300005093|Ga0062594_102887865 | Not Available | 535 | Open in IMG/M |
| 3300005294|Ga0065705_11054190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 513 | Open in IMG/M |
| 3300005338|Ga0068868_100559868 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
| 3300005345|Ga0070692_10857170 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300005518|Ga0070699_101007041 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300005553|Ga0066695_10022508 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3544 | Open in IMG/M |
| 3300005553|Ga0066695_10079046 | All Organisms → cellular organisms → Bacteria | 1996 | Open in IMG/M |
| 3300005764|Ga0066903_104173282 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 773 | Open in IMG/M |
| 3300005764|Ga0066903_105596735 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300005764|Ga0066903_106514943 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300006034|Ga0066656_10971532 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 545 | Open in IMG/M |
| 3300006163|Ga0070715_10591786 | Not Available | 649 | Open in IMG/M |
| 3300006804|Ga0079221_10533005 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300006845|Ga0075421_100984459 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
| 3300006846|Ga0075430_100554524 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
| 3300006847|Ga0075431_100176118 | All Organisms → cellular organisms → Bacteria | 2197 | Open in IMG/M |
| 3300006852|Ga0075433_10577825 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 987 | Open in IMG/M |
| 3300006852|Ga0075433_10785537 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300006871|Ga0075434_101588383 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 663 | Open in IMG/M |
| 3300006903|Ga0075426_10060697 | All Organisms → cellular organisms → Bacteria | 2701 | Open in IMG/M |
| 3300006904|Ga0075424_100323922 | All Organisms → cellular organisms → Bacteria | 1641 | Open in IMG/M |
| 3300007076|Ga0075435_100174328 | All Organisms → cellular organisms → Bacteria | 1815 | Open in IMG/M |
| 3300009012|Ga0066710_102356306 | Not Available | 773 | Open in IMG/M |
| 3300009094|Ga0111539_12789184 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 566 | Open in IMG/M |
| 3300009100|Ga0075418_10898921 | Not Available | 957 | Open in IMG/M |
| 3300009147|Ga0114129_12262653 | Not Available | 653 | Open in IMG/M |
| 3300009157|Ga0105092_10113877 | Not Available | 1490 | Open in IMG/M |
| 3300009162|Ga0075423_12009447 | Not Available | 626 | Open in IMG/M |
| 3300009162|Ga0075423_12708603 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 543 | Open in IMG/M |
| 3300009609|Ga0105347_1092347 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1133 | Open in IMG/M |
| 3300009789|Ga0126307_11472029 | Not Available | 552 | Open in IMG/M |
| 3300010043|Ga0126380_10295878 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 1149 | Open in IMG/M |
| 3300010043|Ga0126380_11180061 | Not Available | 658 | Open in IMG/M |
| 3300010046|Ga0126384_11572246 | Not Available | 618 | Open in IMG/M |
| 3300010047|Ga0126382_11934473 | Not Available | 559 | Open in IMG/M |
| 3300010166|Ga0126306_11176171 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300010359|Ga0126376_10210180 | All Organisms → cellular organisms → Bacteria | 1621 | Open in IMG/M |
| 3300010359|Ga0126376_13230526 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 504 | Open in IMG/M |
| 3300010360|Ga0126372_12195863 | Not Available | 601 | Open in IMG/M |
| 3300010362|Ga0126377_11743694 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300011107|Ga0151490_1073407 | Not Available | 509 | Open in IMG/M |
| 3300011445|Ga0137427_10277102 | Not Available | 703 | Open in IMG/M |
| 3300012198|Ga0137364_10452141 | Not Available | 964 | Open in IMG/M |
| 3300012206|Ga0137380_10446804 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp. | 1144 | Open in IMG/M |
| 3300012208|Ga0137376_10116369 | All Organisms → cellular organisms → Bacteria | 2278 | Open in IMG/M |
| 3300012209|Ga0137379_10588456 | Not Available | 1020 | Open in IMG/M |
| 3300012285|Ga0137370_10698983 | Not Available | 630 | Open in IMG/M |
| 3300012354|Ga0137366_10869093 | Not Available | 637 | Open in IMG/M |
| 3300012501|Ga0157351_1052036 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 542 | Open in IMG/M |
| 3300012922|Ga0137394_10858814 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 759 | Open in IMG/M |
| 3300012923|Ga0137359_10442925 | Not Available | 1150 | Open in IMG/M |
| 3300012929|Ga0137404_10951323 | Not Available | 785 | Open in IMG/M |
| 3300012971|Ga0126369_10610038 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium | 1162 | Open in IMG/M |
| 3300012985|Ga0164308_11911931 | Not Available | 553 | Open in IMG/M |
| 3300015052|Ga0137411_1317788 | All Organisms → cellular organisms → Bacteria | 5294 | Open in IMG/M |
| 3300015371|Ga0132258_11549989 | All Organisms → cellular organisms → Bacteria | 1673 | Open in IMG/M |
| 3300015371|Ga0132258_13738024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1038 | Open in IMG/M |
| 3300015374|Ga0132255_105162389 | Not Available | 553 | Open in IMG/M |
| 3300016270|Ga0182036_10099339 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 1975 | Open in IMG/M |
| 3300016357|Ga0182032_11466419 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 592 | Open in IMG/M |
| 3300016387|Ga0182040_11860151 | Not Available | 516 | Open in IMG/M |
| 3300016422|Ga0182039_12249443 | Not Available | 503 | Open in IMG/M |
| 3300018060|Ga0187765_11334406 | Not Available | 509 | Open in IMG/M |
| 3300025908|Ga0207643_10930451 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 563 | Open in IMG/M |
| 3300025931|Ga0207644_11761844 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 518 | Open in IMG/M |
| 3300025935|Ga0207709_10819703 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 752 | Open in IMG/M |
| 3300025935|Ga0207709_11661293 | Not Available | 531 | Open in IMG/M |
| 3300025961|Ga0207712_11347518 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 638 | Open in IMG/M |
| 3300026089|Ga0207648_10890448 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 831 | Open in IMG/M |
| 3300026089|Ga0207648_11322180 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 677 | Open in IMG/M |
| 3300026324|Ga0209470_1014190 | All Organisms → cellular organisms → Bacteria | 4574 | Open in IMG/M |
| 3300026342|Ga0209057_1100341 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium | 1165 | Open in IMG/M |
| 3300026343|Ga0209159_1268360 | Not Available | 519 | Open in IMG/M |
| 3300026537|Ga0209157_1090542 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium | 1477 | Open in IMG/M |
| 3300027907|Ga0207428_10610969 | Not Available | 785 | Open in IMG/M |
| 3300027909|Ga0209382_12222737 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 518 | Open in IMG/M |
| 3300028592|Ga0247822_11939139 | Not Available | 505 | Open in IMG/M |
| 3300028597|Ga0247820_10714624 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 699 | Open in IMG/M |
| 3300028809|Ga0247824_10742434 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300031226|Ga0307497_10135731 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1005 | Open in IMG/M |
| 3300031538|Ga0310888_10171169 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1174 | Open in IMG/M |
| 3300031547|Ga0310887_10261540 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 970 | Open in IMG/M |
| 3300031679|Ga0318561_10534988 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 645 | Open in IMG/M |
| 3300031740|Ga0307468_100446980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1005 | Open in IMG/M |
| 3300031740|Ga0307468_100954187 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 749 | Open in IMG/M |
| 3300031740|Ga0307468_101191856 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 686 | Open in IMG/M |
| 3300031744|Ga0306918_10108471 | All Organisms → cellular organisms → Bacteria | 1990 | Open in IMG/M |
| 3300031747|Ga0318502_10361272 | Not Available | 860 | Open in IMG/M |
| 3300031754|Ga0307475_11248065 | Not Available | 577 | Open in IMG/M |
| 3300031765|Ga0318554_10383272 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300031765|Ga0318554_10843949 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 512 | Open in IMG/M |
| 3300031769|Ga0318526_10036444 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 1823 | Open in IMG/M |
| 3300031771|Ga0318546_10490066 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 862 | Open in IMG/M |
| 3300031778|Ga0318498_10054457 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 1780 | Open in IMG/M |
| 3300031792|Ga0318529_10545898 | Not Available | 538 | Open in IMG/M |
| 3300031793|Ga0318548_10564024 | Not Available | 555 | Open in IMG/M |
| 3300031797|Ga0318550_10537172 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 563 | Open in IMG/M |
| 3300031858|Ga0310892_10315382 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 991 | Open in IMG/M |
| 3300031880|Ga0318544_10195464 | Not Available | 780 | Open in IMG/M |
| 3300031892|Ga0310893_10157171 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 888 | Open in IMG/M |
| 3300031893|Ga0318536_10403088 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 691 | Open in IMG/M |
| 3300031911|Ga0307412_10650501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp. | 899 | Open in IMG/M |
| 3300031941|Ga0310912_10085733 | Not Available | 2295 | Open in IMG/M |
| 3300031946|Ga0310910_10714910 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300032009|Ga0318563_10337209 | Not Available | 816 | Open in IMG/M |
| 3300032066|Ga0318514_10599166 | Not Available | 587 | Open in IMG/M |
| 3300032075|Ga0310890_11039908 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 660 | Open in IMG/M |
| 3300032075|Ga0310890_11234274 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 610 | Open in IMG/M |
| 3300032180|Ga0307471_101533752 | Not Available | 824 | Open in IMG/M |
| 3300032180|Ga0307471_101637193 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 799 | Open in IMG/M |
| 3300032205|Ga0307472_100029502 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3156 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.79% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 13.79% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.62% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 7.76% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.03% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 5.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.31% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.59% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.59% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.59% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.72% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.72% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.86% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.86% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.86% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.86% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.86% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.86% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.86% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.86% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.86% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.86% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003993 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009609 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 | Environmental | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300011107 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300011445 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012501 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.4.yng.170610 | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300028597 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14 | Environmental | Open in IMG/M |
| 3300028809 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48 | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031892 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2 | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J12803_1059958403 | 3300000955 | Soil | PVEVTFTEPTRYMRWSLPSLRRFIDKRPDLRVALQALVNRDLAGKLEKLL |
| JGI10216J12902_1194204421 | 3300000956 | Soil | TEPARYMRWSLPSLRRFMDTRPDLRVTLQGLVSRDLAEKLNLVVKET* |
| Ga0055468_103111262 | 3300003993 | Natural And Restored Wetlands | VEVTFTEPARYMRWSLPSLRSFMDKRPELRITLQGLVNRDLAGKLEQLVVREHNGGRGSA |
| Ga0062594_1028878651 | 3300005093 | Soil | RYMSWPLSSLRAFVDKRPEMRVTLQGMVSRDLAGKLERLLS* |
| Ga0065705_110541902 | 3300005294 | Switchgrass Rhizosphere | PSPVEMTFAEPARYMRWSLPSLRKFIDSRPDLRVILQGLVNRDLAQKLETVLS* |
| Ga0068868_1005598682 | 3300005338 | Miscanthus Rhizosphere | FTEPARYMRWSLPSLRKFMDTRPDLRVTLQGLVNRDLAEKLNLVMKET* |
| Ga0070692_108571701 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | FTEPARYMRWSLPSLRRFMDSRPDLRVALQGLVNRDLAEKLNLVMKET* |
| Ga0070699_1010070413 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | TGEPSPVEVTFTEPARYMRWSLPSLRRFMDKRPDLRVTLQGLVNRDLAGKLERLLS* |
| Ga0066695_100225084 | 3300005553 | Soil | GEPSPVEVTFAEPARYMRWSLPSLRSFMDKRPDLRVTLQGLVNRDLAGKLERLMS* |
| Ga0066695_100790461 | 3300005553 | Soil | LTGDPSPVDATFTGTARYMSWPLQSIRTFLDRRPDLRVTLQGLVNRELAGKLERVSSMLAGDTRA* |
| Ga0066903_1041732821 | 3300005764 | Tropical Forest Soil | ARYMCWPLASLRRFIDKRPDLRVALQQLVNRDLVSKLGTLVPP* |
| Ga0066903_1055967351 | 3300005764 | Tropical Forest Soil | WPLHNIRSFLDRRPELRVNLQGLVNRDLAGKLEGLVSA* |
| Ga0066903_1065149431 | 3300005764 | Tropical Forest Soil | IEPARYMRWSLPDLRSFMDKRPDLRVTLQQHVNRDLAGKLEKLLTAR* |
| Ga0066656_109715321 | 3300006034 | Soil | SLPSLRRFMDKRPDLRVTLQSLVNRDLAGKLERLLS* |
| Ga0070715_105917862 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | SPVEVTFTEPARYMRWSLPSLRSFMDKRPDLRVTLQRLVNRDLAGKLERLLS* |
| Ga0079221_105330052 | 3300006804 | Agricultural Soil | TPSPVEIVFTEPARYMRWSLANLRSFMDKRPDLRVTLQGLVNRALAGKLEKLLSAS* |
| Ga0075421_1009844592 | 3300006845 | Populus Rhizosphere | TRYMRWSLPSLRRFMDKRPDLRVTLQSLVNRDLAGKLERLLS* |
| Ga0075430_1005545241 | 3300006846 | Populus Rhizosphere | PVEVTFTEPARYMRWSLPSLRSFMDRRPELRITLQGLVNRDLAGKLERVLP* |
| Ga0075431_1001761184 | 3300006847 | Populus Rhizosphere | SSLRAFVDKRPEMRVTLQGMVSRDLAGKLERLLS* |
| Ga0075433_105778251 | 3300006852 | Populus Rhizosphere | PAHYMRWSLPSLRRFMDKRPDLRGALQAMVNRDLAGKVGALLSP* |
| Ga0075433_107855372 | 3300006852 | Populus Rhizosphere | RWSLPNLRRFIDKRPDLRVTLQGLVNRDLAAKLEALLSS* |
| Ga0075434_1015883831 | 3300006871 | Populus Rhizosphere | PSLLAFMDRRPDLRVALQSLVSHDLTRKIDRLLAER* |
| Ga0075426_100606974 | 3300006903 | Populus Rhizosphere | ALAADPSPVEMTFAEPARYMRWSLPSLRKFIDGRPDLRVILQGLVNRDLAQKLETVLS* |
| Ga0075424_1003239222 | 3300006904 | Populus Rhizosphere | RYMCWPLHELRSFLDRRPDLRVTLQGLVNHDLARKLEALLGPSAR* |
| Ga0075435_1001743284 | 3300007076 | Populus Rhizosphere | EIVFTEPARYMRWSLANLRSFMDKRPDLRVTLQGLVNRDLAGKLEKLLSAS* |
| Ga0066710_1023563062 | 3300009012 | Grasslands Soil | LALTGEPSPVEVTFTEPTRYMRWSLPSLRRFMDKRPDLRVTLQSLVNRDLAGKLERLLS |
| Ga0111539_127891841 | 3300009094 | Populus Rhizosphere | VTFTEPARYMRWSLPSLRRFMDTRPDLRVTLQGLVNRDLAEKLNLVVKET* |
| Ga0075418_108989211 | 3300009100 | Populus Rhizosphere | GEPSPVEVTFTEPTRYMRWSLPSLRRFMDKRPDLRVTLQSLVNRDLAGKLERLLS* |
| Ga0114129_122626532 | 3300009147 | Populus Rhizosphere | YMRWSLPSLRSFMDRRPELRITLQGLVNRDLAGKLERVLP* |
| Ga0105092_101138771 | 3300009157 | Freshwater Sediment | NIRSFLDKRPELRITLQSLVNRDLAEKLEGVLSK* |
| Ga0075423_120094471 | 3300009162 | Populus Rhizosphere | PSPVEVTFTEPARYMRWSLPSLRRFMDTRPDLRATLQGLVNRDLAGKLERLLS* |
| Ga0075423_127086032 | 3300009162 | Populus Rhizosphere | LALTGEPSPVEVTFTEPARYMRWSLPSLRRFMDTRPDLRVTLQGLVNRDLAEKLNFVVKET* |
| Ga0105347_10923473 | 3300009609 | Soil | TEPARYMRWSLPSLRSFMDKRPELRVALQGLVNRDLAGKLERVLS* |
| Ga0126307_114720292 | 3300009789 | Serpentine Soil | TGEPSPVQVTFTEPARYMRWSLPSLRRFMDTRPDLRVTLQGLVNRDLAGKLERLLS* |
| Ga0126380_102958782 | 3300010043 | Tropical Forest Soil | YMRWSVPSLRRFMDKRPDLRVALQGLVNHDLAGKVGQLLAR* |
| Ga0126380_111800612 | 3300010043 | Tropical Forest Soil | MRWSLPDLKTFMDNRPELRVTLQQLVNRELAVKVEKLLSAR* |
| Ga0126384_115722462 | 3300010046 | Tropical Forest Soil | PSPVDVTFTEPGRYISWPLASLHRFIDTRPDLRVTLQGLVSRDLAGKVERLLS* |
| Ga0126382_119344732 | 3300010047 | Tropical Forest Soil | TFTEPSRYMSWPLSSLRTFVDKRPDLRVTLQGLVNRDLVTKLERLLS* |
| Ga0126306_111761711 | 3300010166 | Serpentine Soil | PSPVEVTFTEPARYMRWSLPSLRRFMDKRPDLRVTLQGLVNRDLAGKLERVLA* |
| Ga0126376_102101803 | 3300010359 | Tropical Forest Soil | ASLRRFIDKRPDLRVALQQLVNRDLVTKLGTLMPP* |
| Ga0126376_132305261 | 3300010359 | Tropical Forest Soil | ALTGDPSPVEITFAEPARYMRWPLASLRRFIDKRPDLRVALQQLVNRDLVTKLGTLVPP* |
| Ga0126372_121958631 | 3300010360 | Tropical Forest Soil | TGRARYICWPLSGIRAFLDKRPELRVTLQGLVNRDLAGKVERLLSV* |
| Ga0126377_117436941 | 3300010362 | Tropical Forest Soil | SLRTFMDKKPDLRIALQGLVSRDLSGKLERLLPQ* |
| Ga0151490_10734071 | 3300011107 | Soil | GPSPVDATFVNSGRYMSWPIANLRTFLDKRPELRTAIQGLISRDLARKIERLASRQINAS |
| Ga0137427_102771021 | 3300011445 | Soil | VTFTEPARYMRWSLPSLRSFMDKRPELRVTLQGLVNRDLAGKLERVLS* |
| Ga0137364_104521412 | 3300012198 | Vadose Zone Soil | VEVTFAEPARYMRWSLPSLRRFMDTRPDLRVTLQGLVNRDLAGKLERLLS* |
| Ga0137380_104468041 | 3300012206 | Vadose Zone Soil | PSPVEVTFTEPARYMRWSLPSLRTFMDTRPDLRVTLQGLVNRDLAGKLERLLS* |
| Ga0137376_101163694 | 3300012208 | Vadose Zone Soil | VEVIFAEFARYMRWSLPSLRRFIDKRPDLRVTLQGLVNRDLAGKLERLMS* |
| Ga0137379_105884562 | 3300012209 | Vadose Zone Soil | VTFTEPARYMRWSLPSLRRFMDTRPDLRVTLQGLVNRDLAGKLERLMS* |
| Ga0137370_106989832 | 3300012285 | Vadose Zone Soil | YMRWSLPSLRRFMDTRPDLRVTLQGLVNRDLAGKLERLLS* |
| Ga0137366_108690931 | 3300012354 | Vadose Zone Soil | TRYMRWSLPSLRRFMDKRPDLRVTLRGLVNRDLAGKLERLLS* |
| Ga0157351_10520362 | 3300012501 | Unplanted Soil | EPARYMRWSLPSLRKFIDGRPDLRVILQGLVNRDLAQKLETVLS* |
| Ga0137394_108588143 | 3300012922 | Vadose Zone Soil | SLPSLRRFMDKRPDLRVALQALVNRDLAGKLGALLSP* |
| Ga0137359_104429251 | 3300012923 | Vadose Zone Soil | SLPSLRRFMDTRPDLRVTLQGLVNRDLAGKLERLMS* |
| Ga0137404_109513232 | 3300012929 | Vadose Zone Soil | SPVEVTFTEPARYMRWSLPSLRRFMDTRPDLRVTLQGLVNRDLAEKLNLVVKET* |
| Ga0126369_106100381 | 3300012971 | Tropical Forest Soil | EPARYMRWSLPSLRRFVDNRPDLRVTLQGLMNRDLARKLETVLS* |
| Ga0164308_119119312 | 3300012985 | Soil | MVSPVEVTFTEPARYMRWSLPSLRSFMDKRPDLRVTLQRLVNRDLAGKLERLLS* |
| Ga0137411_13177881 | 3300015052 | Vadose Zone Soil | MRWSLPNLRSFMDKRPDLRVTLQSLVNRDLAGKLEKVLSA* |
| Ga0132258_115499893 | 3300015371 | Arabidopsis Rhizosphere | MRWSVADLRTFMDKRPDLRVTLQQHVNRDLADKLEKLLSAS* |
| Ga0132258_137380241 | 3300015371 | Arabidopsis Rhizosphere | TFAEPARYMRWSLPSLRKFIDSRPDLRVTLQGLVNRDLAGKLDTVLS* |
| Ga0132255_1051623892 | 3300015374 | Arabidopsis Rhizosphere | EIVFAEPARYMRWSLPDLRVFMDKRPELRVTLQQLVNRDLAGKLEKVLSAS* |
| Ga0182036_100993391 | 3300016270 | Soil | ARYISWPVESLRTFADKRPDLRVTLQALVSRDLARKVEELMS |
| Ga0182032_114664192 | 3300016357 | Soil | TGSRSPVEATFTGSARYMSWPVESLRTFIDKRPDLRVALQGLVSRDLAGKVERLLVP |
| Ga0182040_118601512 | 3300016387 | Soil | RWSLGNLRALLDRRPELRATLQGLVNRDLAVKLEELLSKE |
| Ga0182039_122494431 | 3300016422 | Soil | SARYMSWPVASLRTFIDRRPDLRVALQGLVNRDLAWKLEQLIVP |
| Ga0187765_113344061 | 3300018060 | Tropical Peatland | TGSARYISWPVASLRTFIDKRPDLRVALQGLVNRDLAWKLERLIIP |
| Ga0207643_109304511 | 3300025908 | Miscanthus Rhizosphere | ALTGEPSPVEVTFTEPARYMRWSLPSLRRFMDSRPDLRVALQGLVNRDLAEKLNLVMKET |
| Ga0207644_117618441 | 3300025931 | Switchgrass Rhizosphere | NALALAADPSPVEMTFAEPARYMRWSLPSLRKFIDGRPDLRVILQGLVNRDLAQKLETVL |
| Ga0207709_108197032 | 3300025935 | Miscanthus Rhizosphere | TEPARYMSWPLPSLRTFMDKRPDLRVALQALVSRDLAGKVERLLPQSGSEGR |
| Ga0207709_116612931 | 3300025935 | Miscanthus Rhizosphere | LQSLRSFIDRRPELRGTLQSLVNRDLATKLGHALSTG |
| Ga0207704_118658542 | 3300025938 | Miscanthus Rhizosphere | TGRYMCWPLQSLRSFIDRRPELRGTLQSLVNRDLATKLGHALSTG |
| Ga0207689_109422302 | 3300025942 | Miscanthus Rhizosphere | AGRYMCWPLQSLRSFIDRRPELRGTLQSLVNRDLASKLGQVLSTG |
| Ga0207712_113475181 | 3300025961 | Switchgrass Rhizosphere | RYMSWPLPSLRTFMDKRPDLRVALQALVSRDLAGKVERLLPQSGSEGR |
| Ga0207648_108904481 | 3300026089 | Miscanthus Rhizosphere | LTGAPSPVEATFTEPARYMSWPLPSLRAFMDKRPDLRVALQALVSRDLAVKVEGLLPQ |
| Ga0207648_113221801 | 3300026089 | Miscanthus Rhizosphere | SLPDLRAFIDKRPELRVTLQQHVNRDLVGKLEKMLSAS |
| Ga0209470_10141905 | 3300026324 | Soil | ALALTGEPSPVEVTFAEPARYMRWSLPSLRSFMDKRPDLRVTLQGLVNRDLAGKLERLMS |
| Ga0209057_11003411 | 3300026342 | Soil | GEPSPVEVTFAEPARYMRWSLPSLRRFMDKRPDLRVTLQGLVNRDLAGKLERLMS |
| Ga0209159_12683602 | 3300026343 | Soil | ALALTGEPSPVEVTFTEPTRYMRWSLPSLRRFMDKRPDLRVTLQGLVNRDLAGKLERLLS |
| Ga0209157_10905423 | 3300026537 | Soil | TALALTGDPSPIDITFIEPAHYMRWSLPSLRRFMDKRPDLRVTLQGLVNRDLAGKLERLM |
| Ga0207428_106109692 | 3300027907 | Populus Rhizosphere | SPVEVTFTEPARYMRWSLPSLRRFMDTRPDLRVTLQGLVNRDLAGKLERLLS |
| Ga0209382_122227372 | 3300027909 | Populus Rhizosphere | PVEVTFTEPARYMRWSLPSLRSFMDRRPELRITLQGLVNRDLAGKLERVLS |
| Ga0247822_119391391 | 3300028592 | Soil | RYMRWSVPNLRSFMDKRPDLRVTLQHLVNRDLAGKLEKLLSP |
| Ga0247820_107146242 | 3300028597 | Soil | SLPDLRTFMDKRPELRVTLQQLVNRDLAGKLEKVLSPS |
| Ga0247824_107424341 | 3300028809 | Soil | GEPSPVEVTFTEPARYMRWSLPSLRSFMDKRPELRITLQGLVNRDLAGKLERVLP |
| Ga0307497_101357313 | 3300031226 | Soil | ARYMSWPLQSLRAFMDKRPDLRVALQALVSRDLAGKVERLLPQSGSEGR |
| Ga0310888_101711691 | 3300031538 | Soil | ARYMRLSLPDLRTFMDRRPELRVTLQHLVNRDLAGKLEKVLSPS |
| Ga0310887_102615403 | 3300031547 | Soil | LGSLRTFIDKRPDLRIALQGLVSRDLAGKLERLLPQ |
| Ga0318561_105349881 | 3300031679 | Soil | LALTGSPSPVEATFTGSARYMSWPVPSLRTFIDKRPDLRVALQALFSRDLAEKIERLIAP |
| Ga0307468_1004469801 | 3300031740 | Hardwood Forest Soil | ILTFTEPARYMRWPLPSLRRFMDKRPDLRVTLQGLVNRDLAGKVERLLS |
| Ga0307468_1009541871 | 3300031740 | Hardwood Forest Soil | TGAPSPVEATFTEPARYMSWPLQSLRAFMDKRPDLRVALQALVSRDLAGKVERLLPQSGSEGR |
| Ga0307468_1011918563 | 3300031740 | Hardwood Forest Soil | LASLRTFMDKRPDLRIALQGLVSRDLAGKVERLLPQ |
| Ga0306918_101084712 | 3300031744 | Soil | RYMSWPVASLRTFIDRRPDLRVALQGLVNRDLAWKLERLMVP |
| Ga0318502_103612721 | 3300031747 | Soil | YISWPVESLRTFADKRPDLRVTLQALVSRDLARKVEELMS |
| Ga0307475_112480651 | 3300031754 | Hardwood Forest Soil | PARYMRWSLPSLRRFMDKRPDLRVTLQGLVNRDLAGKLERLLS |
| Ga0318554_103832721 | 3300031765 | Soil | SWPVASLRTFIDRRPDLRVALQGLVNRDLAWKLERLMVP |
| Ga0318554_108439492 | 3300031765 | Soil | EATFTGSARYMSWPVESLRTFIDKRPDLRVALQGLVSRDLAGKVERLLVP |
| Ga0318526_100364441 | 3300031769 | Soil | TEAARYISWPVESLRTFADKRPDLRVTLQALVSRDLARKVEELMS |
| Ga0318546_104900662 | 3300031771 | Soil | ARYMSWPVESLRTFIDKRPDLRVALQGLVSRDLAGKVERLLVP |
| Ga0318498_100544571 | 3300031778 | Soil | SWPVESLRTFADKRPDLRVTLQALVSRDLARKVEELMS |
| Ga0318529_105458982 | 3300031792 | Soil | YMSWPVPSLRTFIDKRPDLRVALQALFSRDLAEKIERLIAP |
| Ga0318548_105640241 | 3300031793 | Soil | DATFTEAARYISWPVESLRTFADKRPDLRVTLQALVSRDLARKVEELMS |
| Ga0318550_105371722 | 3300031797 | Soil | ARYMRWALPSLRKFIDSRPDLRVTLQGLVNHDLARKLETVLS |
| Ga0310892_103153823 | 3300031858 | Soil | VPSLRTFMDKRPDLRVALQALVSRDLAGKVEQLLPQSGSERR |
| Ga0318544_101954642 | 3300031880 | Soil | SLALTGAQSPVDATFTEAARYISWPVESLRTFADKRPDLRVTLQALVSRDLARKVEELMS |
| Ga0310893_101571711 | 3300031892 | Soil | YMAWPLASLRTFMDKRPDLRIALQGLVSRDLAGKLERLLPQ |
| Ga0318536_104030881 | 3300031893 | Soil | VEATFAGSARYMSWPVASLRTFIDRRPDLRVALQGLVNRDLAWKLEQLIVP |
| Ga0307412_106505011 | 3300031911 | Rhizosphere | PSPVEVTFTEPARYMRWSLPSLRRFMDTRPDLRVTLQGLVNRDLARKLERALS |
| Ga0310912_100857331 | 3300031941 | Soil | VEATFTGSARYMSWPVASLRTFIDRRPDLRVALQGLVNRDLAWKLERLMVP |
| Ga0310910_107149101 | 3300031946 | Soil | MSWPVASLRTFIDRRPDLRVALQGLVNRDLAWKLERLMVP |
| Ga0318563_103372092 | 3300032009 | Soil | AQSPVDATFTEPARYISWPVESLRTFADKRPDLRVTLQALVSRDLARKVEELMS |
| Ga0318514_105991661 | 3300032066 | Soil | QSPVDATFTEPARYISWPVESLRTFADKRPDLRVTLQALVSRDLARKVEELMS |
| Ga0310890_110399081 | 3300032075 | Soil | ATFTQPARYMAWPLASLRTFMDKRPDLRIVLQGLVSRDLAGKLERLLPQ |
| Ga0310890_112342743 | 3300032075 | Soil | TGEPSPVEVTFTEPARYMRWSLPSLRKFMDTRPDLRVTLQGLVNRDLAEKLHRLVKQT |
| Ga0307471_1015337523 | 3300032180 | Hardwood Forest Soil | DMALTGRARYMRWSLPSLRTFMDKRPDLRTTLQGLVNRDLAGKVEGLLT |
| Ga0307471_1016371931 | 3300032180 | Hardwood Forest Soil | PVDMALTGPARYMRWSLPSLRTFMDKRPDLRTTLQGLVNRDLAGKVEGLLT |
| Ga0307472_1000295021 | 3300032205 | Hardwood Forest Soil | RWSLPSLRRFMDTRPDLRVTLQGLVNRDLAGKLERLLS |
| ⦗Top⦘ |